0s autopkgtest [19:00:32]: starting date and time: 2025-10-18 19:00:32+0000 0s autopkgtest [19:00:32]: git checkout: 4b346b80 nova: make wait_reboot return success even when a no-op 0s autopkgtest [19:00:32]: host juju-7f2275-prod-proposed-migration-environment-20; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.evq5b95h/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=python3-defaults/3.13.7-2 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-s390x --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-20@bos03-s390x-12.secgroup --name adt-resolute-s390x-libedlib-20251018-190032-juju-7f2275-prod-proposed-migration-environment-20-80292e3c-0ff4-4979-bc7f-b503ca61465f --image adt/ubuntu-resolute-s390x-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-20 --net-id=net_prod-proposed-migration-s390x -e TERM=linux --mirror=http://ftpmaster.internal/ubuntu/ 4s Creating nova instance adt-resolute-s390x-libedlib-20251018-190032-juju-7f2275-prod-proposed-migration-environment-20-80292e3c-0ff4-4979-bc7f-b503ca61465f from image adt/ubuntu-resolute-s390x-server-20251018.img (UUID c47ab411-f9be-46ce-b861-20d934d06dba)... 55s autopkgtest [19:01:27]: testbed dpkg architecture: s390x 55s autopkgtest [19:01:27]: testbed apt version: 3.1.6ubuntu2 56s autopkgtest [19:01:28]: @@@@@@@@@@@@@@@@@@@@ test bed setup 56s autopkgtest [19:01:28]: testbed release detected to be: None 56s autopkgtest [19:01:28]: updating testbed package index (apt update) 57s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease [83.3 kB] 57s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 57s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 57s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 57s Get:5 http://ftpmaster.internal/ubuntu resolute-proposed/restricted Sources [5028 B] 57s Get:6 http://ftpmaster.internal/ubuntu resolute-proposed/main Sources [50.7 kB] 57s Get:7 http://ftpmaster.internal/ubuntu resolute-proposed/universe Sources [456 kB] 58s Get:8 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse Sources [16.7 kB] 58s Get:9 http://ftpmaster.internal/ubuntu resolute-proposed/main s390x Packages [92.8 kB] 58s Get:10 http://ftpmaster.internal/ubuntu resolute-proposed/restricted s390x Packages [940 B] 58s Get:11 http://ftpmaster.internal/ubuntu resolute-proposed/universe s390x Packages [314 kB] 58s Get:12 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse s390x Packages [4660 B] 58s Fetched 1023 kB in 1s (960 kB/s) 58s Reading package lists... 59s Hit:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease 59s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 59s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 59s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 60s Reading package lists... 60s Reading package lists... 60s Building dependency tree... 60s Reading state information... 60s Calculating upgrade... 60s The following packages will be upgraded: 60s apt gir1.2-girepository-2.0 libapt-pkg7.0 libgirepository-1.0-1 60s libpython3-stdlib lto-disabled-list python3 python3-minimal 60s 8 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 60s Need to get 2763 kB of archives. 60s After this operation, 14.3 kB of additional disk space will be used. 60s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed/main s390x python3-minimal s390x 3.13.7-2 [27.8 kB] 61s Get:2 http://ftpmaster.internal/ubuntu resolute-proposed/main s390x python3 s390x 3.13.7-2 [23.9 kB] 61s Get:3 http://ftpmaster.internal/ubuntu resolute-proposed/main s390x libpython3-stdlib s390x 3.13.7-2 [10.6 kB] 61s Get:4 http://ftpmaster.internal/ubuntu resolute/main s390x libapt-pkg7.0 s390x 3.1.8ubuntu1 [1144 kB] 61s Get:5 http://ftpmaster.internal/ubuntu resolute/main s390x apt s390x 3.1.8ubuntu1 [1432 kB] 62s Get:6 http://ftpmaster.internal/ubuntu resolute/main s390x libgirepository-1.0-1 s390x 1.86.0-6 [86.9 kB] 62s Get:7 http://ftpmaster.internal/ubuntu resolute/main s390x gir1.2-girepository-2.0 s390x 1.86.0-6 [25.1 kB] 62s Get:8 http://ftpmaster.internal/ubuntu resolute/main s390x lto-disabled-list all 71 [12.5 kB] 62s dpkg-preconfigure: unable to re-open stdin: No such file or directory 62s Fetched 2763 kB in 2s (1493 kB/s) 62s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 56852 files and directories currently installed.) 62s Preparing to unpack .../python3-minimal_3.13.7-2_s390x.deb ... 63s Unpacking python3-minimal (3.13.7-2) over (3.13.7-1) ... 63s Setting up python3-minimal (3.13.7-2) ... 63s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 56852 files and directories currently installed.) 63s Preparing to unpack .../0-python3_3.13.7-2_s390x.deb ... 63s running python pre-rtupdate hooks for python3.13... 63s Unpacking python3 (3.13.7-2) over (3.13.7-1) ... 63s Preparing to unpack .../1-libpython3-stdlib_3.13.7-2_s390x.deb ... 63s Unpacking libpython3-stdlib:s390x (3.13.7-2) over (3.13.7-1) ... 63s Preparing to unpack .../2-libapt-pkg7.0_3.1.8ubuntu1_s390x.deb ... 63s Unpacking libapt-pkg7.0:s390x (3.1.8ubuntu1) over (3.1.6ubuntu2) ... 63s Preparing to unpack .../3-apt_3.1.8ubuntu1_s390x.deb ... 63s Unpacking apt (3.1.8ubuntu1) over (3.1.6ubuntu2) ... 63s Preparing to unpack .../4-libgirepository-1.0-1_1.86.0-6_s390x.deb ... 63s Unpacking libgirepository-1.0-1:s390x (1.86.0-6) over (1.84.0-1) ... 63s Preparing to unpack .../5-gir1.2-girepository-2.0_1.86.0-6_s390x.deb ... 63s Unpacking gir1.2-girepository-2.0:s390x (1.86.0-6) over (1.84.0-1) ... 63s Preparing to unpack .../6-lto-disabled-list_71_all.deb ... 63s Unpacking lto-disabled-list (71) over (69) ... 63s Setting up lto-disabled-list (71) ... 63s Setting up libgirepository-1.0-1:s390x (1.86.0-6) ... 63s Setting up libapt-pkg7.0:s390x (3.1.8ubuntu1) ... 63s Setting up libpython3-stdlib:s390x (3.13.7-2) ... 63s Setting up apt (3.1.8ubuntu1) ... 63s Setting up python3 (3.13.7-2) ... 63s running python rtupdate hooks for python3.13... 63s running python post-rtupdate hooks for python3.13... 64s Setting up gir1.2-girepository-2.0:s390x (1.86.0-6) ... 64s Processing triggers for man-db (2.13.1-1) ... 65s Processing triggers for libc-bin (2.42-0ubuntu3) ... 65s autopkgtest [19:01:37]: upgrading testbed (apt dist-upgrade and autopurge) 66s Reading package lists... 66s Building dependency tree... 66s Reading state information... 66s Calculating upgrade... 66s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 66s Reading package lists... 66s Building dependency tree... 66s Reading state information... 66s Solving dependencies... 66s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 67s autopkgtest [19:01:39]: rebooting testbed after setup commands that affected boot 80s autopkgtest [19:01:52]: testbed running kernel: Linux 6.17.0-5-generic #5-Ubuntu SMP Mon Sep 22 08:56:47 UTC 2025 82s autopkgtest [19:01:54]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 87s Get:1 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (dsc) [2270 B] 87s Get:2 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (tar) [4319 kB] 87s Get:3 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (diff) [7704 B] 87s gpgv: Signature made Tue Mar 4 17:29:01 2025 UTC 87s gpgv: using RSA key 25E3FF2D7F469DBE7D0D4E50AFCFEC8E669CE1C2 87s gpgv: Can't check signature: No public key 87s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6build2.dsc: no acceptable signature found 87s autopkgtest [19:01:59]: testing package libedlib version 1.2.7-6build2 88s autopkgtest [19:02:00]: build not needed 89s autopkgtest [19:02:01]: test run-unit-test: preparing testbed 89s Reading package lists... 89s Building dependency tree... 89s Reading state information... 89s Solving dependencies... 89s The following NEW packages will be installed: 89s edlib-aligner libedlib-dev libedlib1 python3-edlib 90s 0 upgraded, 4 newly installed, 0 to remove and 0 not upgraded. 90s Need to get 164 kB of archives. 90s After this operation, 443 kB of additional disk space will be used. 90s Get:1 http://ftpmaster.internal/ubuntu resolute/universe s390x libedlib1 s390x 1.2.7-6build2 [24.6 kB] 90s Get:2 http://ftpmaster.internal/ubuntu resolute/universe s390x edlib-aligner s390x 1.2.7-6build2 [30.9 kB] 90s Get:3 http://ftpmaster.internal/ubuntu resolute/universe s390x libedlib-dev s390x 1.2.7-6build2 [28.4 kB] 90s Get:4 http://ftpmaster.internal/ubuntu resolute/universe s390x python3-edlib s390x 1.2.7-6build2 [79.9 kB] 90s Fetched 164 kB in 0s (347 kB/s) 90s Selecting previously unselected package libedlib1:s390x. 90s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 56852 files and directories currently installed.) 90s Preparing to unpack .../libedlib1_1.2.7-6build2_s390x.deb ... 90s Unpacking libedlib1:s390x (1.2.7-6build2) ... 90s Selecting previously unselected package edlib-aligner. 90s Preparing to unpack .../edlib-aligner_1.2.7-6build2_s390x.deb ... 90s Unpacking edlib-aligner (1.2.7-6build2) ... 90s Selecting previously unselected package libedlib-dev:s390x. 90s Preparing to unpack .../libedlib-dev_1.2.7-6build2_s390x.deb ... 90s Unpacking libedlib-dev:s390x (1.2.7-6build2) ... 90s Selecting previously unselected package python3-edlib:s390x. 90s Preparing to unpack .../python3-edlib_1.2.7-6build2_s390x.deb ... 90s Unpacking python3-edlib:s390x (1.2.7-6build2) ... 90s Setting up libedlib1:s390x (1.2.7-6build2) ... 90s Setting up python3-edlib:s390x (1.2.7-6build2) ... 90s Setting up edlib-aligner (1.2.7-6build2) ... 90s Setting up libedlib-dev:s390x (1.2.7-6build2) ... 90s Processing triggers for man-db (2.13.1-1) ... 91s Processing triggers for libc-bin (2.42-0ubuntu3) ... 92s autopkgtest [19:02:04]: test run-unit-test: [----------------------- 92s Using NW alignment mode. 92s Reading queries... 92s Read 1 queries, 110 residues total. 92s Reading target fasta file... 92s Read target, 109 residues. 92s 92s Comparing queries to target... 92s 92s Query #0 (110 residues): score = 17 92s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 92s ||||||| | |||||||||| ||||||||||||||||||||||||||| 92s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 92s 92s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 92s | |||||||||||| || |||||||||| ||||||||| |||||| | 92s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 92s 92s T: AESIKSKKKKKE-STTB (93 - 108) 92s ||||||||||| ||| 92s Q: -ESIKSKKKKKENSTT- (94 - 109) 92s 92s 92s Cpu time of searching: 0.000053 93s autopkgtest [19:02:05]: test run-unit-test: -----------------------] 93s autopkgtest [19:02:05]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 93s run-unit-test PASS 93s autopkgtest [19:02:05]: @@@@@@@@@@@@@@@@@@@@ summary 93s run-unit-test PASS