0s autopkgtest [22:18:04]: starting date and time: 2025-10-18 22:18:04+0000 0s autopkgtest [22:18:04]: git checkout: 4b346b80 nova: make wait_reboot return success even when a no-op 0s autopkgtest [22:18:04]: host juju-7f2275-prod-proposed-migration-environment-20; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.i24vb2_t/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=python3-defaults/3.13.7-2 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-ppc64el --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-20@bos03-ppc64el-7.secgroup --name adt-resolute-ppc64el-libedlib-20251018-221804-juju-7f2275-prod-proposed-migration-environment-20-2f4881e2-8d4a-4318-8b46-9f4b32bde20b --image adt/ubuntu-resolute-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-20 --net-id=net_prod-proposed-migration-ppc64el -e TERM=linux --mirror=http://ftpmaster.internal/ubuntu/ 4s Creating nova instance adt-resolute-ppc64el-libedlib-20251018-221804-juju-7f2275-prod-proposed-migration-environment-20-2f4881e2-8d4a-4318-8b46-9f4b32bde20b from image adt/ubuntu-resolute-ppc64el-server-20251018.img (UUID 746a0a80-14f1-4bf7-89b6-cbb5ab236a4e)... 51s autopkgtest [22:18:55]: testbed dpkg architecture: ppc64el 52s autopkgtest [22:18:56]: testbed apt version: 3.1.8ubuntu1 52s autopkgtest [22:18:56]: @@@@@@@@@@@@@@@@@@@@ test bed setup 52s autopkgtest [22:18:56]: testbed release detected to be: None 53s autopkgtest [22:18:57]: updating testbed package index (apt update) 53s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease [83.3 kB] 53s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 54s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 54s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 54s Get:5 http://ftpmaster.internal/ubuntu resolute-proposed/universe Sources [431 kB] 54s Get:6 http://ftpmaster.internal/ubuntu resolute-proposed/main Sources [54.3 kB] 54s Get:7 http://ftpmaster.internal/ubuntu resolute-proposed/restricted Sources [5028 B] 54s Get:8 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse Sources [18.2 kB] 54s Get:9 http://ftpmaster.internal/ubuntu resolute-proposed/main ppc64el Packages [96.8 kB] 54s Get:10 http://ftpmaster.internal/ubuntu resolute-proposed/restricted ppc64el Packages [940 B] 54s Get:11 http://ftpmaster.internal/ubuntu resolute-proposed/universe ppc64el Packages [295 kB] 54s Get:12 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse ppc64el Packages [4660 B] 54s Fetched 989 kB in 1s (930 kB/s) 55s Reading package lists... 55s Failed to check for VM: Permission denied 56s Hit:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease 56s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 56s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 56s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 57s Reading package lists... 57s Reading package lists... 57s Building dependency tree... 57s Reading state information... 57s Calculating upgrade... 57s The following packages will be upgraded: 57s gir1.2-girepository-2.0 libgirepository-1.0-1 libpython3-stdlib python3 57s python3-minimal 57s 5 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 57s Need to get 185 kB of archives. 57s After this operation, 2048 B of additional disk space will be used. 57s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed/main ppc64el python3-minimal ppc64el 3.13.7-2 [27.8 kB] 57s Get:2 http://ftpmaster.internal/ubuntu resolute-proposed/main ppc64el python3 ppc64el 3.13.7-2 [23.9 kB] 57s Get:3 http://ftpmaster.internal/ubuntu resolute-proposed/main ppc64el libpython3-stdlib ppc64el 3.13.7-2 [10.6 kB] 57s Get:4 http://ftpmaster.internal/ubuntu resolute/main ppc64el libgirepository-1.0-1 ppc64el 1.86.0-6 [97.4 kB] 57s Get:5 http://ftpmaster.internal/ubuntu resolute/main ppc64el gir1.2-girepository-2.0 ppc64el 1.86.0-6 [25.3 kB] 58s dpkg-preconfigure: unable to re-open stdin: No such file or directory 58s Fetched 185 kB in 0s (435 kB/s) 58s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 76461 files and directories currently installed.) 58s Preparing to unpack .../python3-minimal_3.13.7-2_ppc64el.deb ... 58s Unpacking python3-minimal (3.13.7-2) over (3.13.7-1) ... 58s Setting up python3-minimal (3.13.7-2) ... 58s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 76461 files and directories currently installed.) 58s Preparing to unpack .../python3_3.13.7-2_ppc64el.deb ... 58s running python pre-rtupdate hooks for python3.13... 58s Unpacking python3 (3.13.7-2) over (3.13.7-1) ... 58s Preparing to unpack .../libpython3-stdlib_3.13.7-2_ppc64el.deb ... 58s Unpacking libpython3-stdlib:ppc64el (3.13.7-2) over (3.13.7-1) ... 58s Preparing to unpack .../libgirepository-1.0-1_1.86.0-6_ppc64el.deb ... 58s Unpacking libgirepository-1.0-1:ppc64el (1.86.0-6) over (1.84.0-1) ... 58s Preparing to unpack .../gir1.2-girepository-2.0_1.86.0-6_ppc64el.deb ... 58s Unpacking gir1.2-girepository-2.0:ppc64el (1.86.0-6) over (1.84.0-1) ... 58s Setting up libgirepository-1.0-1:ppc64el (1.86.0-6) ... 58s Setting up libpython3-stdlib:ppc64el (3.13.7-2) ... 58s Setting up python3 (3.13.7-2) ... 58s running python rtupdate hooks for python3.13... 58s running python post-rtupdate hooks for python3.13... 59s Setting up gir1.2-girepository-2.0:ppc64el (1.86.0-6) ... 59s Processing triggers for man-db (2.13.1-1) ... 60s Processing triggers for libc-bin (2.42-0ubuntu3) ... 60s autopkgtest [22:19:04]: upgrading testbed (apt dist-upgrade and autopurge) 60s Reading package lists... 60s Building dependency tree... 60s Reading state information... 60s Calculating upgrade... 60s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 60s Reading package lists... 60s Building dependency tree... 60s Reading state information... 60s Solving dependencies... 61s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 63s autopkgtest [22:19:07]: testbed running kernel: Linux 6.17.0-5-generic #5-Ubuntu SMP PREEMPT_DYNAMIC Mon Sep 22 10:02:41 UTC 2025 64s autopkgtest [22:19:08]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 69s Get:1 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (dsc) [2270 B] 69s Get:2 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (tar) [4319 kB] 69s Get:3 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (diff) [7704 B] 69s gpgv: Signature made Tue Mar 4 17:29:01 2025 UTC 69s gpgv: using RSA key 25E3FF2D7F469DBE7D0D4E50AFCFEC8E669CE1C2 69s gpgv: Can't check signature: No public key 69s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6build2.dsc: no acceptable signature found 69s autopkgtest [22:19:13]: testing package libedlib version 1.2.7-6build2 70s autopkgtest [22:19:14]: build not needed 71s autopkgtest [22:19:15]: test run-unit-test: preparing testbed 71s Reading package lists... 71s Building dependency tree... 71s Reading state information... 71s Solving dependencies... 71s The following NEW packages will be installed: 71s edlib-aligner libedlib-dev libedlib1 python3-edlib 72s 0 upgraded, 4 newly installed, 0 to remove and 0 not upgraded. 72s Need to get 153 kB of archives. 72s After this operation, 477 kB of additional disk space will be used. 72s Get:1 http://ftpmaster.internal/ubuntu resolute/universe ppc64el libedlib1 ppc64el 1.2.7-6build2 [22.0 kB] 72s Get:2 http://ftpmaster.internal/ubuntu resolute/universe ppc64el edlib-aligner ppc64el 1.2.7-6build2 [28.0 kB] 72s Get:3 http://ftpmaster.internal/ubuntu resolute/universe ppc64el libedlib-dev ppc64el 1.2.7-6build2 [26.1 kB] 72s Get:4 http://ftpmaster.internal/ubuntu resolute/universe ppc64el python3-edlib ppc64el 1.2.7-6build2 [77.4 kB] 72s Fetched 153 kB in 1s (290 kB/s) 72s Selecting previously unselected package libedlib1:ppc64el. 72s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 76461 files and directories currently installed.) 72s Preparing to unpack .../libedlib1_1.2.7-6build2_ppc64el.deb ... 72s Unpacking libedlib1:ppc64el (1.2.7-6build2) ... 72s Selecting previously unselected package edlib-aligner. 72s Preparing to unpack .../edlib-aligner_1.2.7-6build2_ppc64el.deb ... 72s Unpacking edlib-aligner (1.2.7-6build2) ... 72s Selecting previously unselected package libedlib-dev:ppc64el. 72s Preparing to unpack .../libedlib-dev_1.2.7-6build2_ppc64el.deb ... 72s Unpacking libedlib-dev:ppc64el (1.2.7-6build2) ... 72s Selecting previously unselected package python3-edlib:ppc64el. 72s Preparing to unpack .../python3-edlib_1.2.7-6build2_ppc64el.deb ... 72s Unpacking python3-edlib:ppc64el (1.2.7-6build2) ... 72s Setting up libedlib1:ppc64el (1.2.7-6build2) ... 72s Setting up python3-edlib:ppc64el (1.2.7-6build2) ... 72s Setting up edlib-aligner (1.2.7-6build2) ... 72s Setting up libedlib-dev:ppc64el (1.2.7-6build2) ... 72s Processing triggers for man-db (2.13.1-1) ... 72s Processing triggers for libc-bin (2.42-0ubuntu3) ... 74s autopkgtest [22:19:18]: test run-unit-test: [----------------------- 74s Using NW alignment mode. 74s Reading queries... 74s Read 1 queries, 110 residues total. 74s Reading target fasta file... 74s Read target, 109 residues. 74s 74s Comparing queries to target... 74s 74s Query #0 (110 residues): score = 17 74s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 74s ||||||| | |||||||||| ||||||||||||||||||||||||||| 74s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 74s 74s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 74s | |||||||||||| || |||||||||| ||||||||| |||||| | 74s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 74s 74s T: AESIKSKKKKKE-STTB (93 - 108) 74s ||||||||||| ||| 74s Q: -ESIKSKKKKKENSTT- (94 - 109) 74s 74s 74s Cpu time of searching: 0.000048 74s autopkgtest [22:19:18]: test run-unit-test: -----------------------] 75s autopkgtest [22:19:19]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 75s run-unit-test PASS 75s autopkgtest [22:19:19]: @@@@@@@@@@@@@@@@@@@@ summary 75s run-unit-test PASS