0s autopkgtest [18:44:08]: starting date and time: 2025-10-18 18:44:08+0000 0s autopkgtest [18:44:08]: git checkout: 4b346b80 nova: make wait_reboot return success even when a no-op 0s autopkgtest [18:44:08]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.t3ukzxff/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=python3-defaults/3.13.7-2 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos03-arm64-15.secgroup --name adt-resolute-arm64-libedlib-20251018-184407-juju-7f2275-prod-proposed-migration-environment-2-26027a5f-a02d-46fd-8666-edf33b2298d4 --image adt/ubuntu-resolute-arm64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration -e TERM=linux --mirror=http://ftpmaster.internal/ubuntu/ 4s Creating nova instance adt-resolute-arm64-libedlib-20251018-184407-juju-7f2275-prod-proposed-migration-environment-2-26027a5f-a02d-46fd-8666-edf33b2298d4 from image adt/ubuntu-resolute-arm64-server-20251018.img (UUID f7a49384-4e4d-4350-9a26-1f59236f89dd)... 62s autopkgtest [18:45:10]: testbed dpkg architecture: arm64 62s autopkgtest [18:45:10]: testbed apt version: 3.1.6ubuntu2 62s autopkgtest [18:45:10]: @@@@@@@@@@@@@@@@@@@@ test bed setup 62s autopkgtest [18:45:10]: testbed release detected to be: None 63s autopkgtest [18:45:11]: updating testbed package index (apt update) 64s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease [83.3 kB] 64s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 64s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 64s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 64s Get:5 http://ftpmaster.internal/ubuntu resolute-proposed/main Sources [50.7 kB] 64s Get:6 http://ftpmaster.internal/ubuntu resolute-proposed/restricted Sources [5028 B] 64s Get:7 http://ftpmaster.internal/ubuntu resolute-proposed/universe Sources [456 kB] 64s Get:8 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse Sources [16.7 kB] 64s Get:9 http://ftpmaster.internal/ubuntu resolute-proposed/main arm64 Packages [99.7 kB] 64s Get:10 http://ftpmaster.internal/ubuntu resolute-proposed/restricted arm64 Packages [43.8 kB] 64s Get:11 http://ftpmaster.internal/ubuntu resolute-proposed/universe arm64 Packages [322 kB] 64s Get:12 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse arm64 Packages [6524 B] 65s Fetched 1083 kB in 1s (1030 kB/s) 65s Reading package lists... 66s Hit:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease 66s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 66s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 66s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 67s Reading package lists... 67s Reading package lists... 67s Building dependency tree... 67s Reading state information... 68s Calculating upgrade... 68s The following packages will be upgraded: 68s apt flash-kernel gir1.2-girepository-2.0 libapt-pkg7.0 libgirepository-1.0-1 68s libpython3-stdlib lto-disabled-list python3 python3-minimal 68s 9 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 68s Need to get 2671 kB of archives. 68s After this operation, 66.6 kB of additional disk space will be used. 68s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed/main arm64 python3-minimal arm64 3.13.7-2 [27.8 kB] 68s Get:2 http://ftpmaster.internal/ubuntu resolute-proposed/main arm64 python3 arm64 3.13.7-2 [23.9 kB] 68s Get:3 http://ftpmaster.internal/ubuntu resolute-proposed/main arm64 libpython3-stdlib arm64 3.13.7-2 [10.6 kB] 68s Get:4 http://ftpmaster.internal/ubuntu resolute/main arm64 libapt-pkg7.0 arm64 3.1.8ubuntu1 [1055 kB] 69s Get:5 http://ftpmaster.internal/ubuntu resolute/main arm64 apt arm64 3.1.8ubuntu1 [1373 kB] 69s Get:6 http://ftpmaster.internal/ubuntu resolute/main arm64 libgirepository-1.0-1 arm64 1.86.0-6 [84.5 kB] 69s Get:7 http://ftpmaster.internal/ubuntu resolute/main arm64 gir1.2-girepository-2.0 arm64 1.86.0-6 [25.3 kB] 69s Get:8 http://ftpmaster.internal/ubuntu resolute/main arm64 flash-kernel arm64 3.109ubuntu7 [58.8 kB] 69s Get:9 http://ftpmaster.internal/ubuntu resolute/main arm64 lto-disabled-list all 71 [12.5 kB] 69s dpkg-preconfigure: unable to re-open stdin: No such file or directory 69s Fetched 2671 kB in 1s (2850 kB/s) 70s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83359 files and directories currently installed.) 70s Preparing to unpack .../python3-minimal_3.13.7-2_arm64.deb ... 70s Unpacking python3-minimal (3.13.7-2) over (3.13.7-1) ... 70s Setting up python3-minimal (3.13.7-2) ... 70s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83359 files and directories currently installed.) 70s Preparing to unpack .../0-python3_3.13.7-2_arm64.deb ... 70s running python pre-rtupdate hooks for python3.13... 70s Unpacking python3 (3.13.7-2) over (3.13.7-1) ... 70s Preparing to unpack .../1-libpython3-stdlib_3.13.7-2_arm64.deb ... 70s Unpacking libpython3-stdlib:arm64 (3.13.7-2) over (3.13.7-1) ... 70s Preparing to unpack .../2-libapt-pkg7.0_3.1.8ubuntu1_arm64.deb ... 70s Unpacking libapt-pkg7.0:arm64 (3.1.8ubuntu1) over (3.1.6ubuntu2) ... 70s Preparing to unpack .../3-apt_3.1.8ubuntu1_arm64.deb ... 70s Unpacking apt (3.1.8ubuntu1) over (3.1.6ubuntu2) ... 71s Preparing to unpack .../4-libgirepository-1.0-1_1.86.0-6_arm64.deb ... 71s Unpacking libgirepository-1.0-1:arm64 (1.86.0-6) over (1.84.0-1) ... 71s Preparing to unpack .../5-gir1.2-girepository-2.0_1.86.0-6_arm64.deb ... 71s Unpacking gir1.2-girepository-2.0:arm64 (1.86.0-6) over (1.84.0-1) ... 71s Preparing to unpack .../6-flash-kernel_3.109ubuntu7_arm64.deb ... 71s Unpacking flash-kernel (3.109ubuntu7) over (3.109ubuntu6) ... 71s Preparing to unpack .../7-lto-disabled-list_71_all.deb ... 71s Unpacking lto-disabled-list (71) over (69) ... 71s Setting up lto-disabled-list (71) ... 71s Setting up libgirepository-1.0-1:arm64 (1.86.0-6) ... 71s Setting up libapt-pkg7.0:arm64 (3.1.8ubuntu1) ... 71s Setting up libpython3-stdlib:arm64 (3.13.7-2) ... 71s Setting up apt (3.1.8ubuntu1) ... 72s Setting up python3 (3.13.7-2) ... 72s running python rtupdate hooks for python3.13... 72s running python post-rtupdate hooks for python3.13... 72s Setting up gir1.2-girepository-2.0:arm64 (1.86.0-6) ... 72s Setting up flash-kernel (3.109ubuntu7) ... 72s flash-kernel: deferring update (trigger activated) 72s Processing triggers for libc-bin (2.42-0ubuntu3) ... 72s Processing triggers for man-db (2.13.1-1) ... 74s Processing triggers for initramfs-tools (0.150ubuntu3) ... 74s update-initramfs: Generating /boot/initrd.img-6.17.0-5-generic 91s System running in EFI mode, skipping. 91s Processing triggers for flash-kernel (3.109ubuntu7) ... 92s System running in EFI mode, skipping. 92s autopkgtest [18:45:40]: upgrading testbed (apt dist-upgrade and autopurge) 93s Reading package lists... 93s Building dependency tree... 93s Reading state information... 93s Calculating upgrade... 94s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 94s Reading package lists... 94s Building dependency tree... 94s Reading state information... 94s Solving dependencies... 95s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 95s autopkgtest [18:45:43]: rebooting testbed after setup commands that affected boot 123s autopkgtest [18:46:11]: testbed running kernel: Linux 6.17.0-5-generic #5-Ubuntu SMP PREEMPT_DYNAMIC Mon Sep 22 09:50:31 UTC 2025 126s autopkgtest [18:46:14]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 132s Get:1 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (dsc) [2270 B] 132s Get:2 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (tar) [4319 kB] 132s Get:3 http://ftpmaster.internal/ubuntu resolute/universe libedlib 1.2.7-6build2 (diff) [7704 B] 132s gpgv: Signature made Tue Mar 4 17:29:01 2025 UTC 132s gpgv: using RSA key 25E3FF2D7F469DBE7D0D4E50AFCFEC8E669CE1C2 132s gpgv: Can't check signature: No public key 132s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6build2.dsc: no acceptable signature found 132s autopkgtest [18:46:20]: testing package libedlib version 1.2.7-6build2 133s autopkgtest [18:46:21]: build not needed 137s autopkgtest [18:46:25]: test run-unit-test: preparing testbed 137s Reading package lists... 137s Building dependency tree... 137s Reading state information... 137s Solving dependencies... 138s The following NEW packages will be installed: 138s edlib-aligner libedlib-dev libedlib1 python3-edlib 138s 0 upgraded, 4 newly installed, 0 to remove and 0 not upgraded. 138s Need to get 136 kB of archives. 138s After this operation, 467 kB of additional disk space will be used. 138s Get:1 http://ftpmaster.internal/ubuntu resolute/universe arm64 libedlib1 arm64 1.2.7-6build2 [18.8 kB] 138s Get:2 http://ftpmaster.internal/ubuntu resolute/universe arm64 edlib-aligner arm64 1.2.7-6build2 [24.2 kB] 138s Get:3 http://ftpmaster.internal/ubuntu resolute/universe arm64 libedlib-dev arm64 1.2.7-6build2 [22.8 kB] 138s Get:4 http://ftpmaster.internal/ubuntu resolute/universe arm64 python3-edlib arm64 1.2.7-6build2 [69.7 kB] 139s Fetched 136 kB in 1s (268 kB/s) 139s Selecting previously unselected package libedlib1:arm64. 139s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83359 files and directories currently installed.) 139s Preparing to unpack .../libedlib1_1.2.7-6build2_arm64.deb ... 139s Unpacking libedlib1:arm64 (1.2.7-6build2) ... 139s Selecting previously unselected package edlib-aligner. 139s Preparing to unpack .../edlib-aligner_1.2.7-6build2_arm64.deb ... 139s Unpacking edlib-aligner (1.2.7-6build2) ... 139s Selecting previously unselected package libedlib-dev:arm64. 139s Preparing to unpack .../libedlib-dev_1.2.7-6build2_arm64.deb ... 139s Unpacking libedlib-dev:arm64 (1.2.7-6build2) ... 139s Selecting previously unselected package python3-edlib:arm64. 139s Preparing to unpack .../python3-edlib_1.2.7-6build2_arm64.deb ... 139s Unpacking python3-edlib:arm64 (1.2.7-6build2) ... 139s Setting up libedlib1:arm64 (1.2.7-6build2) ... 139s Setting up python3-edlib:arm64 (1.2.7-6build2) ... 139s Setting up edlib-aligner (1.2.7-6build2) ... 139s Setting up libedlib-dev:arm64 (1.2.7-6build2) ... 139s Processing triggers for man-db (2.13.1-1) ... 140s Processing triggers for libc-bin (2.42-0ubuntu3) ... 141s autopkgtest [18:46:29]: test run-unit-test: [----------------------- 142s Using NW alignment mode. 142s Reading queries... 142s Read 1 queries, 110 residues total. 142s Reading target fasta file... 142s Read target, 109 residues. 142s 142s Comparing queries to target... 142s 142s Query #0 (110 residues): score = 17 142s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 142s ||||||| | |||||||||| ||||||||||||||||||||||||||| 142s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 142s 142s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 142s | |||||||||||| || |||||||||| ||||||||| |||||| | 142s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 142s 142s T: AESIKSKKKKKE-STTB (93 - 108) 142s ||||||||||| ||| 142s Q: -ESIKSKKKKKENSTT- (94 - 109) 142s 142s 142s Cpu time of searching: 0.000054 142s autopkgtest [18:46:30]: test run-unit-test: -----------------------] 143s autopkgtest [18:46:31]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 143s run-unit-test PASS 143s autopkgtest [18:46:31]: @@@@@@@@@@@@@@@@@@@@ summary 143s run-unit-test PASS