0s autopkgtest [18:16:04]: starting date and time: 2026-02-06 18:16:04+0000 1s autopkgtest [18:16:05]: git checkout: 4b346b80 nova: make wait_reboot return success even when a no-op 1s autopkgtest [18:16:05]: host juju-7f2275-prod-proposed-migration-environment-15; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.qxfq0rwu/out --timeout-copy=6000 --needs-internet=try --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:glibc --apt-upgrade fasta3 --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=glibc/2.42-2ubuntu5 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-cpu2-ram4-disk20-amd64 --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-15@sto01-12.secgroup --name adt-resolute-amd64-fasta3-20260206-181604-juju-7f2275-prod-proposed-migration-environment-15-cdffc3e4-b215-49d3-a2bf-badec20bc66f --image adt/ubuntu-resolute-amd64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-15 --net-id=net_prod-autopkgtest-workers-amd64 -e TERM=linux --mirror=http://ftpmaster.internal/ubuntu/ 5s Creating nova instance adt-resolute-amd64-fasta3-20260206-181604-juju-7f2275-prod-proposed-migration-environment-15-cdffc3e4-b215-49d3-a2bf-badec20bc66f from image adt/ubuntu-resolute-amd64-server-20260204.img (UUID fedf54b4-458b-493e-8072-6425c19717b4)... 80s autopkgtest [18:17:24]: testbed dpkg architecture: amd64 80s autopkgtest [18:17:24]: testbed apt version: 3.1.14 80s autopkgtest [18:17:24]: @@@@@@@@@@@@@@@@@@@@ test bed setup 81s autopkgtest [18:17:25]: testbed release detected to be: None 81s autopkgtest [18:17:25]: updating testbed package index (apt update) 81s Get:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease [124 kB] 81s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 81s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 82s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 82s Get:5 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse Sources [32.1 kB] 82s Get:6 http://ftpmaster.internal/ubuntu resolute-proposed/main Sources [197 kB] 82s Get:7 http://ftpmaster.internal/ubuntu resolute-proposed/universe Sources [1507 kB] 82s Get:8 http://ftpmaster.internal/ubuntu resolute-proposed/restricted Sources [10.7 kB] 82s Get:9 http://ftpmaster.internal/ubuntu resolute-proposed/main i386 Packages [185 kB] 82s Get:10 http://ftpmaster.internal/ubuntu resolute-proposed/main amd64 Packages [259 kB] 82s Get:11 http://ftpmaster.internal/ubuntu resolute-proposed/main amd64 c-n-f Metadata [6332 B] 82s Get:12 http://ftpmaster.internal/ubuntu resolute-proposed/restricted amd64 Packages [80.4 kB] 82s Get:13 http://ftpmaster.internal/ubuntu resolute-proposed/restricted i386 Packages [3692 B] 82s Get:14 http://ftpmaster.internal/ubuntu resolute-proposed/restricted amd64 c-n-f Metadata [336 B] 82s Get:15 http://ftpmaster.internal/ubuntu resolute-proposed/universe i386 Packages [538 kB] 82s Get:16 http://ftpmaster.internal/ubuntu resolute-proposed/universe amd64 Packages [1400 kB] 82s Get:17 http://ftpmaster.internal/ubuntu resolute-proposed/universe amd64 c-n-f Metadata [36.5 kB] 82s Get:18 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse i386 Packages [4892 B] 82s Get:19 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse amd64 Packages [28.2 kB] 82s Get:20 http://ftpmaster.internal/ubuntu resolute-proposed/multiverse amd64 c-n-f Metadata [1104 B] 83s Fetched 4415 kB in 1s (3840 kB/s) 84s Reading package lists... 84s Hit:1 http://ftpmaster.internal/ubuntu resolute-proposed InRelease 84s Hit:2 http://ftpmaster.internal/ubuntu resolute InRelease 84s Hit:3 http://ftpmaster.internal/ubuntu resolute-updates InRelease 84s Hit:4 http://ftpmaster.internal/ubuntu resolute-security InRelease 85s Reading package lists... 85s Reading package lists... 85s Building dependency tree... 85s Reading state information... 85s Calculating upgrade... 85s The following packages will be upgraded: 85s amd64-microcode apt busybox-initramfs busybox-static dmsetup findutils less 85s libapt-pkg7.0 libattr1 libc-bin libc-gconv-modules-extra libc6 85s libdevmapper1.02.1 libdrm-amdgpu1 libdrm-common libdrm2 libgpm2 libkeyutils1 85s libmaxminddb0 libnpth0t64 libsensors-config libsensors5 locales mawk patch 85s pollinate python3-linkify-it python3-markdown-it python3-referencing sed tar 86s 31 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 86s Need to get 14.4 MB of archives. 86s After this operation, 270 kB disk space will be freed. 86s Get:1 http://ftpmaster.internal/ubuntu resolute/main amd64 findutils amd64 4.10.0-3build2 [307 kB] 86s Get:2 http://ftpmaster.internal/ubuntu resolute/main amd64 sed amd64 4.9-2build3 [195 kB] 86s Get:3 http://ftpmaster.internal/ubuntu resolute/main amd64 tar amd64 1.35+dfsg-3.1build2 [257 kB] 86s Get:4 http://ftpmaster.internal/ubuntu resolute-proposed/main amd64 libc-gconv-modules-extra amd64 2.42-2ubuntu5 [1394 kB] 86s Get:5 http://ftpmaster.internal/ubuntu resolute-proposed/main amd64 libc6 amd64 2.42-2ubuntu5 [2041 kB] 86s Get:6 http://ftpmaster.internal/ubuntu resolute-proposed/main amd64 libc-bin amd64 2.42-2ubuntu5 [702 kB] 86s Get:7 http://ftpmaster.internal/ubuntu resolute/main amd64 libattr1 amd64 1:2.5.2-3build2 [11.4 kB] 86s Get:8 http://ftpmaster.internal/ubuntu resolute/main amd64 mawk amd64 1.3.4.20260129-1 [133 kB] 86s Get:9 http://ftpmaster.internal/ubuntu resolute/main amd64 libapt-pkg7.0 amd64 3.1.15 [1151 kB] 86s Get:10 http://ftpmaster.internal/ubuntu resolute/main amd64 apt amd64 3.1.15 [1479 kB] 86s Get:11 http://ftpmaster.internal/ubuntu resolute/main amd64 libdevmapper1.02.1 amd64 2:1.02.205-2ubuntu3 [142 kB] 86s Get:12 http://ftpmaster.internal/ubuntu resolute/main amd64 dmsetup amd64 2:1.02.205-2ubuntu3 [79.4 kB] 86s Get:13 http://ftpmaster.internal/ubuntu resolute/main amd64 less amd64 668-1build1 [172 kB] 86s Get:14 http://ftpmaster.internal/ubuntu resolute/main amd64 libkeyutils1 amd64 1.6.3-6ubuntu3 [10.6 kB] 86s Get:15 http://ftpmaster.internal/ubuntu resolute-proposed/main amd64 locales all 2.42-2ubuntu5 [4255 kB] 86s Get:16 http://ftpmaster.internal/ubuntu resolute/main amd64 python3-linkify-it all 2.0.3-1ubuntu3 [19.4 kB] 86s Get:17 http://ftpmaster.internal/ubuntu resolute/main amd64 python3-markdown-it all 3.0.0-3build1 [54.4 kB] 86s Get:18 http://ftpmaster.internal/ubuntu resolute/main amd64 busybox-static amd64 1:1.37.0-7ubuntu1 [1034 kB] 86s Get:19 http://ftpmaster.internal/ubuntu resolute/main amd64 libdrm-common all 2.4.131-1 [9774 B] 86s Get:20 http://ftpmaster.internal/ubuntu resolute/main amd64 libdrm2 amd64 2.4.131-1 [42.3 kB] 86s Get:21 http://ftpmaster.internal/ubuntu resolute/main amd64 libgpm2 amd64 1.20.7-12build1 [14.4 kB] 86s Get:22 http://ftpmaster.internal/ubuntu resolute/main amd64 libmaxminddb0 amd64 1.12.2-1build2 [18.9 kB] 86s Get:23 http://ftpmaster.internal/ubuntu resolute/main amd64 libsensors-config all 1:3.6.2-2build1 [6862 B] 86s Get:24 http://ftpmaster.internal/ubuntu resolute/main amd64 libsensors5 amd64 1:3.6.2-2build1 [28.9 kB] 86s Get:25 http://ftpmaster.internal/ubuntu resolute/main amd64 busybox-initramfs amd64 1:1.37.0-7ubuntu1 [191 kB] 86s Get:26 http://ftpmaster.internal/ubuntu resolute/main amd64 libdrm-amdgpu1 amd64 2.4.131-1 [23.2 kB] 86s Get:27 http://ftpmaster.internal/ubuntu resolute/main amd64 libnpth0t64 amd64 1.8-3build1 [9302 B] 86s Get:28 http://ftpmaster.internal/ubuntu resolute/main amd64 patch amd64 2.8-2build1 [95.7 kB] 86s Get:29 http://ftpmaster.internal/ubuntu resolute/main amd64 pollinate all 4.33-4ubuntu5 [14.0 kB] 86s Get:30 http://ftpmaster.internal/ubuntu resolute/main amd64 python3-referencing all 0.36.2-1ubuntu2 [22.2 kB] 86s Get:31 http://ftpmaster.internal/ubuntu resolute/main amd64 amd64-microcode amd64 3.20251202.1ubuntu1 [459 kB] 86s dpkg-preconfigure: unable to re-open stdin: No such file or directory 86s Fetched 14.4 MB in 0s (32.8 MB/s) 86s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 86s Preparing to unpack .../findutils_4.10.0-3build2_amd64.deb ... 86s Unpacking findutils (4.10.0-3build2) over (4.10.0-3build1) ... 86s Setting up findutils (4.10.0-3build2) ... 86s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 86s Preparing to unpack .../sed_4.9-2build3_amd64.deb ... 86s Unpacking sed (4.9-2build3) over (4.9-2build2) ... 86s Setting up sed (4.9-2build3) ... 86s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 86s Preparing to unpack .../tar_1.35+dfsg-3.1build2_amd64.deb ... 87s Unpacking tar (1.35+dfsg-3.1build2) over (1.35+dfsg-3.1build1) ... 87s Setting up tar (1.35+dfsg-3.1build2) ... 87s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 87s Preparing to unpack .../libc-gconv-modules-extra_2.42-2ubuntu5_amd64.deb ... 87s Unpacking libc-gconv-modules-extra:amd64 (2.42-2ubuntu5) over (2.42-2ubuntu4) ... 87s Setting up libc-gconv-modules-extra:amd64 (2.42-2ubuntu5) ... 87s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 87s Preparing to unpack .../libc6_2.42-2ubuntu5_amd64.deb ... 87s Unpacking libc6:amd64 (2.42-2ubuntu5) over (2.42-2ubuntu4) ... 87s Setting up libc6:amd64 (2.42-2ubuntu5) ... 87s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 87s Preparing to unpack .../libc-bin_2.42-2ubuntu5_amd64.deb ... 87s Unpacking libc-bin (2.42-2ubuntu5) over (2.42-2ubuntu4) ... 87s Setting up libc-bin (2.42-2ubuntu5) ... 87s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 87s Preparing to unpack .../libattr1_1%3a2.5.2-3build2_amd64.deb ... 87s Unpacking libattr1:amd64 (1:2.5.2-3build2) over (1:2.5.2-3build1) ... 87s Setting up libattr1:amd64 (1:2.5.2-3build2) ... 87s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83957 files and directories currently installed.) 87s Preparing to unpack .../00-mawk_1.3.4.20260129-1_amd64.deb ... 87s Unpacking mawk (1.3.4.20260129-1) over (1.3.4.20250131-2) ... 87s Preparing to unpack .../01-libapt-pkg7.0_3.1.15_amd64.deb ... 87s Unpacking libapt-pkg7.0:amd64 (3.1.15) over (3.1.14) ... 87s Preparing to unpack .../02-apt_3.1.15_amd64.deb ... 87s Unpacking apt (3.1.15) over (3.1.14) ... 88s Preparing to unpack .../03-libdevmapper1.02.1_2%3a1.02.205-2ubuntu3_amd64.deb ... 88s Unpacking libdevmapper1.02.1:amd64 (2:1.02.205-2ubuntu3) over (2:1.02.205-2ubuntu2) ... 88s Preparing to unpack .../04-dmsetup_2%3a1.02.205-2ubuntu3_amd64.deb ... 88s Unpacking dmsetup (2:1.02.205-2ubuntu3) over (2:1.02.205-2ubuntu2) ... 88s Preparing to unpack .../05-less_668-1build1_amd64.deb ... 88s Unpacking less (668-1build1) over (668-1) ... 88s Preparing to unpack .../06-libkeyutils1_1.6.3-6ubuntu3_amd64.deb ... 88s Unpacking libkeyutils1:amd64 (1.6.3-6ubuntu3) over (1.6.3-6ubuntu2) ... 88s Preparing to unpack .../07-locales_2.42-2ubuntu5_all.deb ... 88s Unpacking locales (2.42-2ubuntu5) over (2.42-2ubuntu4) ... 88s Preparing to unpack .../08-python3-linkify-it_2.0.3-1ubuntu3_all.deb ... 88s Unpacking python3-linkify-it (2.0.3-1ubuntu3) over (2.0.3-1ubuntu2) ... 88s Preparing to unpack .../09-python3-markdown-it_3.0.0-3build1_all.deb ... 88s Unpacking python3-markdown-it (3.0.0-3build1) over (3.0.0-3) ... 88s Preparing to unpack .../10-busybox-static_1%3a1.37.0-7ubuntu1_amd64.deb ... 88s Unpacking busybox-static (1:1.37.0-7ubuntu1) over (1:1.37.0-4ubuntu1) ... 88s Preparing to unpack .../11-libdrm-common_2.4.131-1_all.deb ... 88s Unpacking libdrm-common (2.4.131-1) over (2.4.129-1) ... 88s Preparing to unpack .../12-libdrm2_2.4.131-1_amd64.deb ... 88s Unpacking libdrm2:amd64 (2.4.131-1) over (2.4.129-1) ... 88s Preparing to unpack .../13-libgpm2_1.20.7-12build1_amd64.deb ... 88s Unpacking libgpm2:amd64 (1.20.7-12build1) over (1.20.7-12) ... 88s Preparing to unpack .../14-libmaxminddb0_1.12.2-1build2_amd64.deb ... 88s Unpacking libmaxminddb0:amd64 (1.12.2-1build2) over (1.12.2-1build1) ... 88s Preparing to unpack .../15-libsensors-config_1%3a3.6.2-2build1_all.deb ... 88s Unpacking libsensors-config (1:3.6.2-2build1) over (1:3.6.2-2) ... 88s Preparing to unpack .../16-libsensors5_1%3a3.6.2-2build1_amd64.deb ... 88s Unpacking libsensors5:amd64 (1:3.6.2-2build1) over (1:3.6.2-2) ... 88s Preparing to unpack .../17-busybox-initramfs_1%3a1.37.0-7ubuntu1_amd64.deb ... 88s Unpacking busybox-initramfs (1:1.37.0-7ubuntu1) over (1:1.37.0-4ubuntu1) ... 88s Preparing to unpack .../18-libdrm-amdgpu1_2.4.131-1_amd64.deb ... 88s Unpacking libdrm-amdgpu1:amd64 (2.4.131-1) over (2.4.129-1) ... 88s Preparing to unpack .../19-libnpth0t64_1.8-3build1_amd64.deb ... 88s Unpacking libnpth0t64:amd64 (1.8-3build1) over (1.8-3) ... 88s Preparing to unpack .../20-patch_2.8-2build1_amd64.deb ... 88s Unpacking patch (2.8-2build1) over (2.8-2) ... 89s Preparing to unpack .../21-pollinate_4.33-4ubuntu5_all.deb ... 89s Unpacking pollinate (4.33-4ubuntu5) over (4.33-4ubuntu4) ... 89s Preparing to unpack .../22-python3-referencing_0.36.2-1ubuntu2_all.deb ... 89s Unpacking python3-referencing (0.36.2-1ubuntu2) over (0.36.2-1ubuntu1) ... 89s Preparing to unpack .../23-amd64-microcode_3.20251202.1ubuntu1_amd64.deb ... 89s Unpacking amd64-microcode (3.20251202.1ubuntu1) over (3.20250708.1ubuntu1) ... 89s Setting up libnpth0t64:amd64 (1.8-3build1) ... 89s Setting up libkeyutils1:amd64 (1.6.3-6ubuntu3) ... 89s Setting up libgpm2:amd64 (1.20.7-12build1) ... 89s Setting up libmaxminddb0:amd64 (1.12.2-1build2) ... 89s Setting up libsensors-config (1:3.6.2-2build1) ... 89s Setting up less (668-1build1) ... 89s Setting up amd64-microcode (3.20251202.1ubuntu1) ... 89s amd64-microcode: microcode will be updated at next boot 89s Setting up locales (2.42-2ubuntu5) ... 89s Generating locales (this might take a while)... 90s en_US.UTF-8... done 90s Generation complete. 90s Setting up pollinate (4.33-4ubuntu5) ... 101s Setting up busybox-static (1:1.37.0-7ubuntu1) ... 101s Setting up patch (2.8-2build1) ... 101s Setting up libsensors5:amd64 (1:3.6.2-2build1) ... 101s Setting up busybox-initramfs (1:1.37.0-7ubuntu1) ... 101s Setting up libdevmapper1.02.1:amd64 (2:1.02.205-2ubuntu3) ... 101s Setting up dmsetup (2:1.02.205-2ubuntu3) ... 101s Setting up python3-linkify-it (2.0.3-1ubuntu3) ... 101s Setting up mawk (1.3.4.20260129-1) ... 101s Setting up libapt-pkg7.0:amd64 (3.1.15) ... 101s Setting up libdrm-common (2.4.131-1) ... 101s Setting up python3-referencing (0.36.2-1ubuntu2) ... 101s Setting up apt (3.1.15) ... 101s Setting up python3-markdown-it (3.0.0-3build1) ... 101s Setting up libdrm2:amd64 (2.4.131-1) ... 101s Setting up libdrm-amdgpu1:amd64 (2.4.131-1) ... 101s Processing triggers for libc-bin (2.42-2ubuntu5) ... 101s Processing triggers for systemd (259-1ubuntu3) ... 102s Processing triggers for man-db (2.13.1-1) ... 103s Processing triggers for install-info (7.2-5) ... 103s Processing triggers for initramfs-tools (0.150ubuntu7) ... 103s update-initramfs: Generating /boot/initrd.img-6.18.0-9-generic 108s autopkgtest [18:17:52]: upgrading testbed (apt dist-upgrade and autopurge) 109s Reading package lists... 109s Building dependency tree... 109s Reading state information... 109s Calculating upgrade... 109s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 109s Reading package lists... 110s Building dependency tree... 110s Reading state information...autopkgtest [18:17:54]: rebooting testbed after setup commands that affected boot 110s 110s Solving dependencies... 110s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 139s autopkgtest [18:18:23]: testbed running kernel: Linux 6.18.0-9-generic #9-Ubuntu SMP PREEMPT_DYNAMIC Mon Jan 12 16:49:02 UTC 2026 141s autopkgtest [18:18:25]: @@@@@@@@@@@@@@@@@@@@ apt-source fasta3 143s Get:1 http://ftpmaster.internal/ubuntu resolute/multiverse fasta3 36.3.8i.14-Nov-2020-4 (dsc) [2248 B] 143s Get:2 http://ftpmaster.internal/ubuntu resolute/multiverse fasta3 36.3.8i.14-Nov-2020-4 (tar) [1403 kB] 143s Get:3 http://ftpmaster.internal/ubuntu resolute/multiverse fasta3 36.3.8i.14-Nov-2020-4 (diff) [14.8 kB] 143s gpgv: Signature made Wed Sep 24 06:35:50 2025 UTC 143s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 143s gpgv: issuer "tillea@rki.de" 143s gpgv: Can't check signature: No public key 143s dpkg-source: warning: cannot verify inline signature for ./fasta3_36.3.8i.14-Nov-2020-4.dsc: no acceptable signature found 143s autopkgtest [18:18:27]: testing package fasta3 version 36.3.8i.14-Nov-2020-4 143s autopkgtest [18:18:27]: build not needed 144s autopkgtest [18:18:28]: test run-unit-test: preparing testbed 144s Reading package lists... 144s Building dependency tree... 144s Reading state information... 144s Solving dependencies... 145s The following NEW packages will be installed: 145s bedtools fasta3 libclone-perl libdbd-mysql-perl libdbi-perl 145s libencode-locale-perl libfile-listing-perl libhtml-parser-perl 145s libhtml-tagset-perl libhtml-tree-perl libhttp-cookies-perl libhttp-date-perl 145s libhttp-message-perl libhttp-negotiate-perl libio-html-perl 145s libio-socket-ssl-perl libjson-perl liblwp-mediatypes-perl 145s liblwp-protocol-https-perl libmysqlclient24 libnet-http-perl 145s libnet-ssleay-perl libtimedate-perl libtry-tiny-perl liburi-perl libwww-perl 145s libwww-robotrules-perl libxml-parser-perl libxml-twig-perl mysql-common 145s perl-openssl-defaults python3-mysqldb 145s 0 upgraded, 32 newly installed, 0 to remove and 0 not upgraded. 145s Need to get 5592 kB of archives. 145s After this operation, 24.7 MB of additional disk space will be used. 145s Get:1 http://ftpmaster.internal/ubuntu resolute/universe amd64 bedtools amd64 2.31.1+dfsg-3 [580 kB] 145s Get:2 http://ftpmaster.internal/ubuntu resolute/multiverse amd64 fasta3 amd64 36.3.8i.14-Nov-2020-4 [981 kB] 145s Get:3 http://ftpmaster.internal/ubuntu resolute/main amd64 libclone-perl amd64 0.47-1 [10.7 kB] 145s Get:4 http://ftpmaster.internal/ubuntu resolute/main amd64 libdbi-perl amd64 1.647-1build1 [829 kB] 145s Get:5 http://ftpmaster.internal/ubuntu resolute/main amd64 mysql-common all 5.8+1.1.1ubuntu2 [7002 B] 145s Get:6 http://ftpmaster.internal/ubuntu resolute/main amd64 libmysqlclient24 amd64 8.4.8-0ubuntu1 [1258 kB] 145s Get:7 http://ftpmaster.internal/ubuntu resolute/universe amd64 libdbd-mysql-perl amd64 4.053-1ubuntu1 [89.1 kB] 145s Get:8 http://ftpmaster.internal/ubuntu resolute/main amd64 libencode-locale-perl all 1.05-3 [11.6 kB] 145s Get:9 http://ftpmaster.internal/ubuntu resolute/main amd64 libtimedate-perl all 2.3300-2 [34.0 kB] 145s Get:10 http://ftpmaster.internal/ubuntu resolute/main amd64 libhttp-date-perl all 6.06-1 [10.2 kB] 145s Get:11 http://ftpmaster.internal/ubuntu resolute/main amd64 libfile-listing-perl all 6.16-1 [11.3 kB] 145s Get:12 http://ftpmaster.internal/ubuntu resolute/main amd64 libhtml-tagset-perl all 3.24-1 [14.1 kB] 145s Get:13 http://ftpmaster.internal/ubuntu resolute/main amd64 liburi-perl all 5.34-2build1 [100 kB] 145s Get:14 http://ftpmaster.internal/ubuntu resolute/main amd64 libhtml-parser-perl amd64 3.83-1build1 [86.2 kB] 145s Get:15 http://ftpmaster.internal/ubuntu resolute/main amd64 libhtml-tree-perl all 5.07-3 [200 kB] 145s Get:16 http://ftpmaster.internal/ubuntu resolute/main amd64 libio-html-perl all 1.004-3 [15.9 kB] 145s Get:17 http://ftpmaster.internal/ubuntu resolute/main amd64 liblwp-mediatypes-perl all 6.04-2 [20.1 kB] 145s Get:18 http://ftpmaster.internal/ubuntu resolute/main amd64 libhttp-message-perl all 7.01-1ubuntu1 [76.1 kB] 145s Get:19 http://ftpmaster.internal/ubuntu resolute/main amd64 libhttp-cookies-perl all 6.11-1 [18.2 kB] 145s Get:20 http://ftpmaster.internal/ubuntu resolute/main amd64 libhttp-negotiate-perl all 6.01-2 [12.4 kB] 145s Get:21 http://ftpmaster.internal/ubuntu resolute/main amd64 perl-openssl-defaults amd64 7build4 [6710 B] 145s Get:22 http://ftpmaster.internal/ubuntu resolute/main amd64 libnet-ssleay-perl amd64 1.94-3 [318 kB] 145s Get:23 http://ftpmaster.internal/ubuntu resolute/main amd64 libio-socket-ssl-perl all 2.098-1 [205 kB] 145s Get:24 http://ftpmaster.internal/ubuntu resolute/main amd64 libjson-perl all 4.10000-1 [81.9 kB] 145s Get:25 http://ftpmaster.internal/ubuntu resolute/main amd64 libnet-http-perl all 6.24-1build1 [21.7 kB] 145s Get:26 http://ftpmaster.internal/ubuntu resolute/main amd64 libtry-tiny-perl all 0.32-1 [21.2 kB] 145s Get:27 http://ftpmaster.internal/ubuntu resolute/main amd64 libwww-robotrules-perl all 6.02-1build1 [12.4 kB] 145s Get:28 http://ftpmaster.internal/ubuntu resolute/main amd64 libwww-perl all 6.81-1build1 [141 kB] 145s Get:29 http://ftpmaster.internal/ubuntu resolute/main amd64 liblwp-protocol-https-perl all 6.14-1 [9040 B] 145s Get:30 http://ftpmaster.internal/ubuntu resolute/main amd64 libxml-parser-perl amd64 2.47-1build4 [202 kB] 145s Get:31 http://ftpmaster.internal/ubuntu resolute/main amd64 libxml-twig-perl all 1:3.54-1build1 [157 kB] 145s Get:32 http://ftpmaster.internal/ubuntu resolute/main amd64 python3-mysqldb amd64 1.4.6-2build7 [51.4 kB] 145s Fetched 5592 kB in 0s (11.3 MB/s) 145s Selecting previously unselected package bedtools. 145s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 83962 files and directories currently installed.) 145s Preparing to unpack .../00-bedtools_2.31.1+dfsg-3_amd64.deb ... 145s Unpacking bedtools (2.31.1+dfsg-3) ... 145s Selecting previously unselected package fasta3. 145s Preparing to unpack .../01-fasta3_36.3.8i.14-Nov-2020-4_amd64.deb ... 145s Unpacking fasta3 (36.3.8i.14-Nov-2020-4) ... 146s Selecting previously unselected package libclone-perl:amd64. 146s Preparing to unpack .../02-libclone-perl_0.47-1_amd64.deb ... 146s Unpacking libclone-perl:amd64 (0.47-1) ... 146s Selecting previously unselected package libdbi-perl:amd64. 146s Preparing to unpack .../03-libdbi-perl_1.647-1build1_amd64.deb ... 146s Unpacking libdbi-perl:amd64 (1.647-1build1) ... 146s Selecting previously unselected package mysql-common. 146s Preparing to unpack .../04-mysql-common_5.8+1.1.1ubuntu2_all.deb ... 146s Unpacking mysql-common (5.8+1.1.1ubuntu2) ... 146s Selecting previously unselected package libmysqlclient24:amd64. 146s Preparing to unpack .../05-libmysqlclient24_8.4.8-0ubuntu1_amd64.deb ... 146s Unpacking libmysqlclient24:amd64 (8.4.8-0ubuntu1) ... 146s Selecting previously unselected package libdbd-mysql-perl:amd64. 146s Preparing to unpack .../06-libdbd-mysql-perl_4.053-1ubuntu1_amd64.deb ... 146s Unpacking libdbd-mysql-perl:amd64 (4.053-1ubuntu1) ... 146s Selecting previously unselected package libencode-locale-perl. 146s Preparing to unpack .../07-libencode-locale-perl_1.05-3_all.deb ... 146s Unpacking libencode-locale-perl (1.05-3) ... 146s Selecting previously unselected package libtimedate-perl. 146s Preparing to unpack .../08-libtimedate-perl_2.3300-2_all.deb ... 146s Unpacking libtimedate-perl (2.3300-2) ... 146s Selecting previously unselected package libhttp-date-perl. 146s Preparing to unpack .../09-libhttp-date-perl_6.06-1_all.deb ... 146s Unpacking libhttp-date-perl (6.06-1) ... 146s Selecting previously unselected package libfile-listing-perl. 146s Preparing to unpack .../10-libfile-listing-perl_6.16-1_all.deb ... 146s Unpacking libfile-listing-perl (6.16-1) ... 146s Selecting previously unselected package libhtml-tagset-perl. 146s Preparing to unpack .../11-libhtml-tagset-perl_3.24-1_all.deb ... 146s Unpacking libhtml-tagset-perl (3.24-1) ... 146s Selecting previously unselected package liburi-perl. 146s Preparing to unpack .../12-liburi-perl_5.34-2build1_all.deb ... 146s Unpacking liburi-perl (5.34-2build1) ... 146s Selecting previously unselected package libhtml-parser-perl:amd64. 146s Preparing to unpack .../13-libhtml-parser-perl_3.83-1build1_amd64.deb ... 146s Unpacking libhtml-parser-perl:amd64 (3.83-1build1) ... 146s Selecting previously unselected package libhtml-tree-perl. 146s Preparing to unpack .../14-libhtml-tree-perl_5.07-3_all.deb ... 146s Unpacking libhtml-tree-perl (5.07-3) ... 146s Selecting previously unselected package libio-html-perl. 146s Preparing to unpack .../15-libio-html-perl_1.004-3_all.deb ... 146s Unpacking libio-html-perl (1.004-3) ... 146s Selecting previously unselected package liblwp-mediatypes-perl. 146s Preparing to unpack .../16-liblwp-mediatypes-perl_6.04-2_all.deb ... 146s Unpacking liblwp-mediatypes-perl (6.04-2) ... 146s Selecting previously unselected package libhttp-message-perl. 146s Preparing to unpack .../17-libhttp-message-perl_7.01-1ubuntu1_all.deb ... 146s Unpacking libhttp-message-perl (7.01-1ubuntu1) ... 146s Selecting previously unselected package libhttp-cookies-perl. 146s Preparing to unpack .../18-libhttp-cookies-perl_6.11-1_all.deb ... 146s Unpacking libhttp-cookies-perl (6.11-1) ... 146s Selecting previously unselected package libhttp-negotiate-perl. 146s Preparing to unpack .../19-libhttp-negotiate-perl_6.01-2_all.deb ... 146s Unpacking libhttp-negotiate-perl (6.01-2) ... 146s Selecting previously unselected package perl-openssl-defaults:amd64. 146s Preparing to unpack .../20-perl-openssl-defaults_7build4_amd64.deb ... 146s Unpacking perl-openssl-defaults:amd64 (7build4) ... 146s Selecting previously unselected package libnet-ssleay-perl:amd64. 146s Preparing to unpack .../21-libnet-ssleay-perl_1.94-3_amd64.deb ... 146s Unpacking libnet-ssleay-perl:amd64 (1.94-3) ... 146s Selecting previously unselected package libio-socket-ssl-perl. 146s Preparing to unpack .../22-libio-socket-ssl-perl_2.098-1_all.deb ... 146s Unpacking libio-socket-ssl-perl (2.098-1) ... 146s Selecting previously unselected package libjson-perl. 146s Preparing to unpack .../23-libjson-perl_4.10000-1_all.deb ... 146s Unpacking libjson-perl (4.10000-1) ... 146s Selecting previously unselected package libnet-http-perl. 146s Preparing to unpack .../24-libnet-http-perl_6.24-1build1_all.deb ... 146s Unpacking libnet-http-perl (6.24-1build1) ... 146s Selecting previously unselected package libtry-tiny-perl. 146s Preparing to unpack .../25-libtry-tiny-perl_0.32-1_all.deb ... 146s Unpacking libtry-tiny-perl (0.32-1) ... 146s Selecting previously unselected package libwww-robotrules-perl. 146s Preparing to unpack .../26-libwww-robotrules-perl_6.02-1build1_all.deb ... 146s Unpacking libwww-robotrules-perl (6.02-1build1) ... 146s Selecting previously unselected package libwww-perl. 146s Preparing to unpack .../27-libwww-perl_6.81-1build1_all.deb ... 146s Unpacking libwww-perl (6.81-1build1) ... 146s Selecting previously unselected package liblwp-protocol-https-perl. 146s Preparing to unpack .../28-liblwp-protocol-https-perl_6.14-1_all.deb ... 146s Unpacking liblwp-protocol-https-perl (6.14-1) ... 146s Selecting previously unselected package libxml-parser-perl. 146s Preparing to unpack .../29-libxml-parser-perl_2.47-1build4_amd64.deb ... 146s Unpacking libxml-parser-perl (2.47-1build4) ... 146s Selecting previously unselected package libxml-twig-perl. 146s Preparing to unpack .../30-libxml-twig-perl_1%3a3.54-1build1_all.deb ... 146s Unpacking libxml-twig-perl (1:3.54-1build1) ... 146s Selecting previously unselected package python3-mysqldb. 146s Preparing to unpack .../31-python3-mysqldb_1.4.6-2build7_amd64.deb ... 146s Unpacking python3-mysqldb (1.4.6-2build7) ... 146s Setting up mysql-common (5.8+1.1.1ubuntu2) ... 146s update-alternatives: using /etc/mysql/my.cnf.fallback to provide /etc/mysql/my.cnf (my.cnf) in auto mode 146s Setting up libclone-perl:amd64 (0.47-1) ... 146s Setting up libhtml-tagset-perl (3.24-1) ... 146s Setting up liblwp-mediatypes-perl (6.04-2) ... 146s Setting up fasta3 (36.3.8i.14-Nov-2020-4) ... 146s Setting up libtry-tiny-perl (0.32-1) ... 146s Setting up perl-openssl-defaults:amd64 (7build4) ... 146s Setting up libencode-locale-perl (1.05-3) ... 146s Setting up libmysqlclient24:amd64 (8.4.8-0ubuntu1) ... 146s Setting up python3-mysqldb (1.4.6-2build7) ... 146s Setting up libio-html-perl (1.004-3) ... 146s Setting up libtimedate-perl (2.3300-2) ... 146s Setting up libjson-perl (4.10000-1) ... 146s Setting up bedtools (2.31.1+dfsg-3) ... 146s Setting up liburi-perl (5.34-2build1) ... 146s Setting up libdbi-perl:amd64 (1.647-1build1) ... 146s Setting up libnet-ssleay-perl:amd64 (1.94-3) ... 146s Setting up libhttp-date-perl (6.06-1) ... 146s Setting up libfile-listing-perl (6.16-1) ... 146s Setting up libnet-http-perl (6.24-1build1) ... 146s Setting up libdbd-mysql-perl:amd64 (4.053-1ubuntu1) ... 146s Setting up libwww-robotrules-perl (6.02-1build1) ... 146s Setting up libhtml-parser-perl:amd64 (3.83-1build1) ... 146s Setting up libio-socket-ssl-perl (2.098-1) ... 146s Setting up libhttp-message-perl (7.01-1ubuntu1) ... 146s Setting up libhttp-negotiate-perl (6.01-2) ... 146s Setting up libhttp-cookies-perl (6.11-1) ... 146s Setting up libhtml-tree-perl (5.07-3) ... 146s Setting up liblwp-protocol-https-perl (6.14-1) ... 146s Setting up libwww-perl (6.81-1build1) ... 146s Setting up libxml-parser-perl (2.47-1build4) ... 146s Setting up libxml-twig-perl (1:3.54-1build1) ... 146s Processing triggers for man-db (2.13.1-1) ... 146s Processing triggers for libc-bin (2.42-2ubuntu5) ... 147s autopkgtest [18:18:31]: test run-unit-test: [----------------------- 147s + pkg=fasta3 147s + export LC_ALL=C.UTF-8 147s + LC_ALL=C.UTF-8 147s + '[' /tmp/autopkgtest.34RUFv/autopkgtest_tmp = '' ']' 147s + cp -a /usr/share/doc/fasta3/examples/seq/bovgh.seq /usr/share/doc/fasta3/examples/seq/bovprl.seq /usr/share/doc/fasta3/examples/seq/dna_test_s.nlib /usr/share/doc/fasta3/examples/seq/dyr_human.aa /usr/share/doc/fasta3/examples/seq/egmsmg.aa /usr/share/doc/fasta3/examples/seq/grou_drome.pseg /usr/share/doc/fasta3/examples/seq/gst.nlib /usr/share/doc/fasta3/examples/seq/gst.seq /usr/share/doc/fasta3/examples/seq/gstm1_human.vaa /usr/share/doc/fasta3/examples/seq/gstm1b_human.nt /usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt /usr/share/doc/fasta3/examples/seq/gstt1_drome.aa /usr/share/doc/fasta3/examples/seq/gtm1_human.aa /usr/share/doc/fasta3/examples/seq/gtt1_drome.aa /usr/share/doc/fasta3/examples/seq/h10_human.aa /usr/share/doc/fasta3/examples/seq/hahu.aa /usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg /usr/share/doc/fasta3/examples/seq/hsgstm1b.seq /usr/share/doc/fasta3/examples/seq/humgstd.seq /usr/share/doc/fasta3/examples/seq/lcbo.aa /usr/share/doc/fasta3/examples/seq/m1r.aa /usr/share/doc/fasta3/examples/seq/m2.aa /usr/share/doc/fasta3/examples/seq/mchu.aa /usr/share/doc/fasta3/examples/seq/mgstm1.3nt /usr/share/doc/fasta3/examples/seq/mgstm1.aa /usr/share/doc/fasta3/examples/seq/mgstm1.aaa /usr/share/doc/fasta3/examples/seq/mgstm1.e05 /usr/share/doc/fasta3/examples/seq/mgstm1.eeq /usr/share/doc/fasta3/examples/seq/mgstm1.esq /usr/share/doc/fasta3/examples/seq/mgstm1.gcg /usr/share/doc/fasta3/examples/seq/mgstm1.lc /usr/share/doc/fasta3/examples/seq/mgstm1.nt /usr/share/doc/fasta3/examples/seq/mgstm1.nt1 /usr/share/doc/fasta3/examples/seq/mgstm1.nt12r /usr/share/doc/fasta3/examples/seq/mgstm1.nt13 /usr/share/doc/fasta3/examples/seq/mgstm1.nt13r /usr/share/doc/fasta3/examples/seq/mgstm1.nt1r /usr/share/doc/fasta3/examples/seq/mgstm1.nts /usr/share/doc/fasta3/examples/seq/mgstm1.raa /usr/share/doc/fasta3/examples/seq/mgstm1.rev /usr/share/doc/fasta3/examples/seq/mgstm1.seq /usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq /usr/share/doc/fasta3/examples/seq/mgtt2_x.seq /usr/share/doc/fasta3/examples/seq/ms1.aa /usr/share/doc/fasta3/examples/seq/mu.lib /usr/share/doc/fasta3/examples/seq/musplfm.aa /usr/share/doc/fasta3/examples/seq/mwkw.aa /usr/share/doc/fasta3/examples/seq/mwrtc1.aa /usr/share/doc/fasta3/examples/seq/myosin_bp.aa /usr/share/doc/fasta3/examples/seq/n0.aa /usr/share/doc/fasta3/examples/seq/n1.aa /usr/share/doc/fasta3/examples/seq/n2.aa /usr/share/doc/fasta3/examples/seq/n2_fs.lib /usr/share/doc/fasta3/examples/seq/n2s.aa /usr/share/doc/fasta3/examples/seq/n2t.aa /usr/share/doc/fasta3/examples/seq/n_fs.lib /usr/share/doc/fasta3/examples/seq/ngt.aa /usr/share/doc/fasta3/examples/seq/ngts.aa /usr/share/doc/fasta3/examples/seq/oohu.aa /usr/share/doc/fasta3/examples/seq/oohu.raa /usr/share/doc/fasta3/examples/seq/prio_atepa.aa /usr/share/doc/fasta3/examples/seq/prot_test.lib /usr/share/doc/fasta3/examples/seq/prot_test.lseg /usr/share/doc/fasta3/examples/seq/prot_test_s.lseg /usr/share/doc/fasta3/examples/seq/qrhuld.aa /usr/share/doc/fasta3/examples/seq/titin_hum.aa /usr/share/doc/fasta3/examples/seq/titin_hum.seq /usr/share/doc/fasta3/examples/seq/vav_human.aa /usr/share/doc/fasta3/examples/seq/xurt8c.aa /usr/share/doc/fasta3/examples/seq/xurt8c.lc /usr/share/doc/fasta3/examples/seq/xurtg.aa /tmp/autopkgtest.34RUFv/autopkgtest_tmp 147s + cd /tmp/autopkgtest.34RUFv/autopkgtest_tmp 147s + /usr/share/fasta3/scripts/test_ann_scripts.sh 147s /usr/share/fasta3/scripts/ann_exons_up_www.pl P09488 148s >P09488 148s 1 - 12 exon_1~1 148s 13 - 37 exon_2~2 148s 38 - 59 exon_3~3 148s 60 - 86 exon_4~4 148s 87 - 120 exon_5~5 148s 121 - 152 exon_6~6 148s 153 - 189 exon_7~7 148s 190 - 218 exon_8~8 148s /usr/share/fasta3/scripts/ann_exons_up_www.pl sp|P09488 148s >sp|P09488 148s 1 - 12 exon_1~1 148s 13 - 37 exon_2~2 148s 38 - 59 exon_3~3 148s 60 - 86 exon_4~4 148s 87 - 120 exon_5~5 148s 121 - 152 exon_6~6 148s 153 - 189 exon_7~7 148s 190 - 218 exon_8~8 148s /usr/share/fasta3/scripts/ann_exons_up_www.pl up|P09488|GSTM1_HUMAN 149s >up|P09488|GSTM1_HUMAN 149s 1 - 12 exon_1~1 149s 13 - 37 exon_2~2 149s 38 - 59 exon_3~3 149s 60 - 86 exon_4~4 149s 87 - 120 exon_5~5 149s 121 - 152 exon_6~6 149s 153 - 189 exon_7~7 149s 190 - 218 exon_8~8 149s /usr/share/fasta3/scripts/ann_exons_up_www.pl SP:GSTM1_HUMAN P09488 149s >SP:GSTM1_HUMAN P09488 149s 1 - 12 exon_1~1 149s 13 - 37 exon_2~2 149s 38 - 59 exon_3~3 149s 60 - 86 exon_4~4 149s 87 - 120 exon_5~5 149s 121 - 152 exon_6~6 149s 153 - 189 exon_7~7 149s 190 - 218 exon_8~8 149s /usr/share/fasta3/scripts/ann_exons_up_www.pl SP:GSTM1_HUMAN 149s *** /usr/share/fasta3/scripts/ann_exons_up_www.pl - accession required: SP:GSTM1_HUMAN at /usr/share/fasta3/scripts/ann_exons_up_www.pl line 130. 149s >SP:GSTM1_HUMAN 149s ***DONE*** /usr/share/fasta3/scripts/ann_exons_up_www.pl Fri Feb 6 18:18:33 UTC 2026 149s /usr/share/fasta3/scripts/ann_feats_up_sql.pl P09488 149s /usr/share/fasta3/scripts/ann_feats_up_sql.pl sp|P09488 149s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_feats_up_sql.pl line 98. 150s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_feats_up_sql.pl line 98. 150s /usr/share/fasta3/scripts/ann_feats_up_sql.pl up|P09488|GSTM1_HUMAN 150s /usr/share/fasta3/scripts/ann_feats_up_sql.pl SP:GSTM1_HUMAN P09488 150s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_feats_up_sql.pl line 98. 150s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_feats_up_sql.pl line 98. 150s /usr/share/fasta3/scripts/ann_feats_up_sql.pl SP:GSTM1_HUMAN 150s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_feats_up_sql.pl line 98. 150s ***DONE*** /usr/share/fasta3/scripts/ann_feats_up_sql.pl Fri Feb 6 18:18:33 UTC 2026 150s /usr/share/fasta3/scripts/ann_feats_up_www2.pl P09488 282s ==:Active site 282s =*:Modified 282s =#:Binding 282s =^:Metal binding 282s =@:Site 282s >P09488 282s /usr/share/fasta3/scripts/ann_feats_up_www2.pl sp|P09488 418s ==:Active site 418s =*:Modified 418s =#:Binding 418s =^:Metal binding 418s =@:Site 418s >sp|P09488 418s /usr/share/fasta3/scripts/ann_feats_up_www2.pl up|P09488|GSTM1_HUMAN 553s ==:Active site 553s =*:Modified 553s =#:Binding 553s =^:Metal binding 553s =@:Site 553s >up|P09488|GSTM1_HUMAN 553s /usr/share/fasta3/scripts/ann_feats_up_www2.pl SP:GSTM1_HUMAN P09488 688s ==:Active site 688s =*:Modified 688s =#:Binding 688s =^:Metal binding 688s =@:Site 688s >SP:GSTM1_HUMAN P09488 688s /usr/share/fasta3/scripts/ann_feats_up_www2.pl SP:GSTM1_HUMAN 688s ==:Active site 688s =*:Modified 688s =#:Binding 688s =^:Metal binding 688s =@:Site 688s >SP:GSTM1_HUMAN 688s *** /usr/share/fasta3/scripts/ann_feats_up_www2.pl accession required: SP:GSTM1_HUMAN 688s ***DONE*** /usr/share/fasta3/scripts/ann_feats_up_www2.pl Fri Feb 6 18:27:32 UTC 2026 688s /usr/share/fasta3/scripts/ann_ipr_www.pl P09488 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s >P09488 689s 1 - 88 PS50404:Glutathione_S-transferase,_N-terminal~1 689s 2 - 201 PTHR11571:Glutathione_S-transferase_superfamily~2 689s 3 - 200 SFLDS00019:Glutathione_transferase_family~3 689s 3 - 85 SSF52833:Thioredoxin-like_superfamily~4 689s 5 - 82 PF02798:Glutathione_S-transferase,_N-terminal~1 689s 31 - 43 :Glutathione_S-transferase,_Mu_class~5 689s 44 - 56 :Glutathione_S-transferase,_Mu_class~5 689s 86 - 217 SSF47616:Glutathione_S-transferase,_C-terminal_domain_superfamily~6 689s 87 - 98 :Glutathione_S-transferase,_Mu_class~5 689s 90 - 208 PS50405:Glutathione_S-transferase,_C-terminal-like~7 689s 105 - 191 PF00043:Glutathione_S-transferase,_C-terminal~8 689s 139 - 152 :Glutathione_S-transferase,_Mu_class~5 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s /usr/share/fasta3/scripts/ann_ipr_www.pl sp|P09488 689s >sp|P09488 689s 1 - 88 PS50404:Glutathione_S-transferase,_N-terminal~1 689s 2 - 201 PTHR11571:Glutathione_S-transferase_superfamily~2 689s 3 - 200 SFLDS00019:Glutathione_transferase_family~3 689s 3 - 85 SSF52833:Thioredoxin-like_superfamily~4 689s 5 - 82 PF02798:Glutathione_S-transferase,_N-terminal~1 689s 31 - 43 :Glutathione_S-transferase,_Mu_class~5 689s 44 - 56 :Glutathione_S-transferase,_Mu_class~5 689s 86 - 217 SSF47616:Glutathione_S-transferase,_C-terminal_domain_superfamily~6 689s 87 - 98 :Glutathione_S-transferase,_Mu_class~5 689s 90 - 208 PS50405:Glutathione_S-transferase,_C-terminal-like~7 689s 105 - 191 PF00043:Glutathione_S-transferase,_C-terminal~8 689s 139 - 152 :Glutathione_S-transferase,_Mu_class~5 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s /usr/share/fasta3/scripts/ann_ipr_www.pl up|P09488|GSTM1_HUMAN 689s >up|P09488|GSTM1_HUMAN 689s 1 - 88 PS50404:Glutathione_S-transferase,_N-terminal~1 689s 2 - 201 PTHR11571:Glutathione_S-transferase_superfamily~2 689s 3 - 200 SFLDS00019:Glutathione_transferase_family~3 689s 3 - 85 SSF52833:Thioredoxin-like_superfamily~4 689s 5 - 82 PF02798:Glutathione_S-transferase,_N-terminal~1 689s 31 - 43 :Glutathione_S-transferase,_Mu_class~5 689s 44 - 56 :Glutathione_S-transferase,_Mu_class~5 689s 86 - 217 SSF47616:Glutathione_S-transferase,_C-terminal_domain_superfamily~6 689s 87 - 98 :Glutathione_S-transferase,_Mu_class~5 689s 90 - 208 PS50405:Glutathione_S-transferase,_C-terminal-like~7 689s 105 - 191 PF00043:Glutathione_S-transferase,_C-terminal~8 689s 139 - 152 :Glutathione_S-transferase,_Mu_class~5 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s /usr/share/fasta3/scripts/ann_ipr_www.pl SP:GSTM1_HUMAN P09488 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s >SP:GSTM1_HUMAN P09488 689s 1 - 88 PS50404:Glutathione_S-transferase,_N-terminal~1 689s 2 - 201 PTHR11571:Glutathione_S-transferase_superfamily~2 689s 3 - 200 SFLDS00019:Glutathione_transferase_family~3 689s 3 - 85 SSF52833:Thioredoxin-like_superfamily~4 689s 5 - 82 PF02798:Glutathione_S-transferase,_N-terminal~1 689s 31 - 43 :Glutathione_S-transferase,_Mu_class~5 689s 44 - 56 :Glutathione_S-transferase,_Mu_class~5 689s 86 - 217 SSF47616:Glutathione_S-transferase,_C-terminal_domain_superfamily~6 689s 87 - 98 :Glutathione_S-transferase,_Mu_class~5 689s 90 - 208 PS50405:Glutathione_S-transferase,_C-terminal-like~7 689s 105 - 191 PF00043:Glutathione_S-transferase,_C-terminal~8 689s 139 - 152 :Glutathione_S-transferase,_Mu_class~5 689s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 689s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 689s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 689s /usr/share/fasta3/scripts/ann_ipr_www.pl SP:GSTM1_HUMAN 690s >SP:GSTM1_HUMAN 690s 1 - 88 PS50404:Glutathione_S-transferase,_N-terminal~1 690s 2 - 201 PTHR11571:Glutathione_S-transferase_superfamily~2 690s 3 - 200 SFLDS00019:Glutathione_transferase_family~3 690s 3 - 85 SSF52833:Thioredoxin-like_superfamily~4 690s 5 - 82 PF02798:Glutathione_S-transferase,_N-terminal~1 690s 31 - 43 :Glutathione_S-transferase,_Mu_class~5 690s 44 - 56 :Glutathione_S-transferase,_Mu_class~5 690s 86 - 217 SSF47616:Glutathione_S-transferase,_C-terminal_domain_superfamily~6 690s 87 - 98 :Glutathione_S-transferase,_Mu_class~5 690s 90 - 208 PS50405:Glutathione_S-transferase,_C-terminal-like~7 690s 105 - 191 PF00043:Glutathione_S-transferase,_C-terminal~8 690s 139 - 152 :Glutathione_S-transferase,_Mu_class~5 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $primary_acc in concatenation (.) or string at /usr/share/fasta3/scripts/ann_ipr_www.pl line 380. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s Use of uninitialized value $ipr_data{"db"} in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 371. 690s Use of uninitialized value $ipr_data{"descr"} in substitution (s///) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 372. 690s Use of uninitialized value in pattern match (m//) at /usr/share/fasta3/scripts/ann_ipr_www.pl line 379. 690s ***DONE*** /usr/share/fasta3/scripts/ann_ipr_www.pl Fri Feb 6 18:27:33 UTC 2026 690s /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl P09488 690s ==:Active site 690s =*:Modified 690s =#:Substrate binding 690s =^:Metal binding 690s =@:Site 690s 690s not well-formed (invalid token) at line 1, column 237, byte 237 at /usr/lib/x86_64-linux-gnu/perl5/5.40/XML/Parser.pm line 187. 690s at /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl line 324. 690s /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl sp|P09488 691s 691s not well-formed (invalid token) at line 1, column 237, byte 237 at /usr/lib/x86_64-linux-gnu/perl5/5.40/XML/Parser.pm line 187. 691s at /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl line 324. 691s ==:Active site 691s =*:Modified 691s =#:Substrate binding 691s =^:Metal binding 691s =@:Site 691s /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl up|P09488|GSTM1_HUMAN 691s ==:Active site 691s =*:Modified 691s =#:Substrate binding 691s =^:Metal binding 691s =@:Site 691s 691s not well-formed (invalid token) at line 1, column 237, byte 237 at /usr/lib/x86_64-linux-gnu/perl5/5.40/XML/Parser.pm line 187. 691s at /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl line 324. 691s /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl SP:GSTM1_HUMAN P09488 691s 691s not well-formed (invalid token) at line 1, column 237, byte 237 at /usr/lib/x86_64-linux-gnu/perl5/5.40/XML/Parser.pm line 187. 691s at /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl line 324. 691s ==:Active site 691s =*:Modified 691s =#:Substrate binding 691s =^:Metal binding 691s =@:Site 691s /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl SP:GSTM1_HUMAN 691s *** /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl - accession required: SP:GSTM1_HUMAN at /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl line 198. 692s ==:Active site 692s =*:Modified 692s =#:Substrate binding 692s =^:Metal binding 692s =@:Site 692s 692s not well-formed (invalid token) at line 1, column 237, byte 237 at /usr/lib/x86_64-linux-gnu/perl5/5.40/XML/Parser.pm line 187. 692s at /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl line 324. 692s ***DONE*** /usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl Fri Feb 6 18:27:35 UTC 2026 692s + /usr/share/fasta3/scripts/test_py.sh 692s get_protein.py 692s >sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 OS=Homo sapiens OX=9606 GN=GSTM1 PE=1 SV=3 692s MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 692s PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 692s EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 692s LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 692s 693s >sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 OS=Homo sapiens OX=9606 GN=GSTM1 PE=1 SV=3 693s MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 693s PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 693s EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 693s LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 693s 756s Traceback (most recent call last): 756s File "/usr/lib/python3.13/urllib/request.py", line 1319, in do_open 756s h.request(req.get_method(), req.selector, req.data, headers, 756s ~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s encode_chunked=req.has_header('Transfer-encoding')) 756s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/http/client.py", line 1358, in request 756s self._send_request(method, url, body, headers, encode_chunked) 756s ~~~~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/http/client.py", line 1404, in _send_request 756s self.endheaders(body, encode_chunked=encode_chunked) 756s ~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/http/client.py", line 1353, in endheaders 756s self._send_output(message_body, encode_chunked=encode_chunked) 756s ~~~~~~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/http/client.py", line 1113, in _send_output 756s self.send(msg) 756s ~~~~~~~~~^^^^^ 756s File "/usr/lib/python3.13/http/client.py", line 1057, in send 756s self.connect() 756s ~~~~~~~~~~~~^^ 756s File "/usr/lib/python3.13/http/client.py", line 1499, in connect 756s self.sock = self._context.wrap_socket(self.sock, 756s ~~~~~~~~~~~~~~~~~~~~~~~~~^^^^^^^^^^^ 756s server_hostname=server_hostname) 756s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/ssl.py", line 455, in wrap_socket 756s return self.sslsocket_class._create( 756s ~~~~~~~~~~~~~~~~~~~~~~~~~~~~^ 756s sock=sock, 756s ^^^^^^^^^^ 756s ...<5 lines>... 756s session=session 756s ^^^^^^^^^^^^^^^ 756s ) 756s ^ 756s File "/usr/lib/python3.13/ssl.py", line 1076, in _create 756s self.do_handshake() 756s ~~~~~~~~~~~~~~~~~^^ 756s File "/usr/lib/python3.13/ssl.py", line 1372, in do_handshake 756s self._sslobj.do_handshake() 756s ~~~~~~~~~~~~~~~~~~~~~~~~~^^ 756s ssl.SSLEOFError: [SSL: UNEXPECTED_EOF_WHILE_READING] EOF occurred in violation of protocol (_ssl.c:1033) 756s 756s During handling of the above exception, another exception occurred: 756s 756s Traceback (most recent call last): 756s File "/usr/share/fasta3/scripts/get_protein.py", line 43, in 756s req = urllib.request.urlopen(url_string) 756s File "/usr/lib/python3.13/urllib/request.py", line 189, in urlopen 756s return opener.open(url, data, timeout) 756s ~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/urllib/request.py", line 489, in open 756s response = self._open(req, data) 756s File "/usr/lib/python3.13/urllib/request.py", line 506, in _open 756s result = self._call_chain(self.handle_open, protocol, protocol + 756s '_open', req) 756s File "/usr/lib/python3.13/urllib/request.py", line 466, in _call_chain 756s result = func(*args) 756s File "/usr/lib/python3.13/urllib/request.py", line 1367, in https_open 756s return self.do_open(http.client.HTTPSConnection, req, 756s ~~~~~~~~~~~~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 756s context=self._context) 756s ^^^^^^^^^^^^^^^^^^^^^^ 756s File "/usr/lib/python3.13/urllib/request.py", line 1322, in do_open 756s raise URLError(err) 756s urllib.error.URLError: 756s 756s During handling of the above exception, another exception occurred: 756s 756s Traceback (most recent call last): 756s File "/usr/share/fasta3/scripts/get_protein.py", line 46, in 756s sys.stderr.write(e.read().decode('utf-8')+'\n') 756s ^^^^^^ 756s AttributeError: 'URLError' object has no attribute 'read' 756s get_refseq.py 762s >NP_000552.2 glutathione S-transferase Mu 1 isoform 1 [Homo sapiens] 762s MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI 762s TQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSE 762s FLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS 762s KMAVWGNK 762s 767s +Error%3A+CEFetchPApplication%3A%3Aproxy_stream()%3A+Error%3A+F+a+i+l+e+d++t+o++r+e+t+r+i+e+v+e++s+e+q+u+e+n+c+e+%3A++N+P+_+0+0+0+0+5+5+2+%0A%0A 767s get_uniprot.py 768s >sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 OS=Homo sapiens OX=9606 GN=GSTM1 PE=1 SV=3 768s MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 768s PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 768s EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 768s LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 768s 768s >sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 OS=Homo sapiens OX=9606 GN=GSTM1 PE=1 SV=3 768s MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 768s PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 768s EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 768s LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 768s 768s ################################################################ 768s map_exon_coords.py -- look for chrA:start-stop::chrB:start-stop in output 770s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_exons_up_sql.pl line 81. 770s *** ERROR [compacc2e.c:2269] -- get_annot() - premature annotation file end () 770s DBI connect('database=uniprot;host=wrpxdb.its.virginia.edu','web_user',...) failed: Unknown MySQL server host 'wrpxdb.its.virginia.edu' (-2) at /usr/share/fasta3/scripts/ann_exons_up_sql.pl line 81. 770s *** ERROR [compacc2e.c:1873] - premature annotation file end (annot_bline_UEqMd8.annot) 770s *** ERROR [compacc2e.c:1107] - !/usr/share/fasta3/scripts/ann_exons_up_sql.pl --gen_coord --exon_label did not produce annotations for sp|P30711|GSTT1_HUMAN Glutathione S-transferase theta-1 OS=Homo sapiens OX=9606 GN=GSTT1 PE=1 SV=4 - 240 aa 770s #/usr/share/fasta3/scripts/map_exon_coords.py hum_chk_map_test.m8CBL 770s # fasta36 -q -m 8CBL -V !/usr/share/fasta3/scripts/ann_exons_up_sql.pl+--gen_coord+--exon_label -V q!/usr/share/fasta3/scripts/ann_exons_up_sql.pl+--gen_coord+--exon_label !/usr/share/fasta3/scripts/get_protein.py+P30711 !/usr/share/fasta3/scripts/get_protein.py+P20135 770s # FASTA 36.3.8i Nov, 2022 770s # Query: sp|P30711|GSTT1_HUMAN Glutathione S-transferase theta-1 OS=Homo sapiens OX=9606 GN=GSTT1 PE=1 SV=4 - 240 aa 770s # Database: !/usr/share/fasta3/scripts/get_protein.py+P20135 770s # Fields: query id, query length, subject id, subject length, % identity, alignment length, mismatches, gap opens, q. start, q. end, s. start, s. end, evalue, bit score, BTOP 770s # 1 hits found 770s sp|P30711|GSTT1_HUMAN 240 sp|P20135|GSTT1_CHICK 261 54.17 240 110 21 1 240 1 261 3.9e-56 200.0 15ASVI4KRKT1DN4LFRKIH1DE1IF1-D-S-V-L-G-K-K-P-A-A-A-S-G-A-E-R-P-R-T1QPHSLN1DEAGFDAGQKVINSPL5AV8TA1SCVT6TS3KNVT2YH3QS1LIQKAK2RQ5AS1QH1TATNLI1RASNCALPRKATLM1HI2MLFI1VL1LT1EQ1VQSPPSQETK1AQAETVLMAEEG1DSVTTS1QKLQLF1DEKR3ND3LITI1PSHE9TV3HQ3AV2QDVI2GD2KR1AMTE2QR3AE3EKDE2QFEQ3VM2KNAI1DEFLPS-N-IPQAI2TQIL1QEKH1MA1WVVLLMAK1ILRK | 15ASVI4KRKT1DN4LFRKIH1DE1IF1-D-S-V-L-G-K-K-P-A-A-A-S-G-A-E-R-P-R-T1QPHSLN1DEAGFDAGQKVINSPL5AV8TA1SCVT6TS3KNVT2YH3QS1LIQKAK2RQ5AS1QH1TATNLI1RASNCALPRKATLM1HI2MLFI1VL1LT1EQ1VQSPPSQETK1AQAETVLMAEEG1DSVTTS1QKLQLF1DEKR3ND3LITI1PSHE9TV3HQ3AV2QDVI2GD2KR1AMTE2QR3AE3EKDE2QFEQ3VM2KNAI1DEFLPS-N-IPQAI2TQIL1QEKH1MA1WVVLLMAK1ILRK 770s # FASTA processed 1 queries 770s rename_exons.py -- look for exon_X in output 770s # fasta36 -q -m 8CBL -V !/usr/share/fasta3/scripts/ann_exons_up_sql.pl+--gen_coord+--exon_label -V q!/usr/share/fasta3/scripts/ann_exons_up_sql.pl+--gen_coord+--exon_label !/usr/share/fasta3/scripts/get_protein.py+P30711 !/usr/share/fasta3/scripts/get_protein.py+P20135 770s # FASTA 36.3.8i Nov, 2022 770s # Query: sp|P30711|GSTT1_HUMAN Glutathione S-transferase theta-1 OS=Homo sapiens OX=9606 GN=GSTT1 PE=1 SV=4 - 240 aa 770s # Database: !/usr/share/fasta3/scripts/get_protein.py+P20135 770s # Fields: query id, query length, subject id, subject length, % identity, alignment length, mismatches, gap opens, q. start, q. end, s. start, s. end, evalue, bit score, BTOP 770s # 1 hits found 770s sp|P30711|GSTT1_HUMAN 240 sp|P20135|GSTT1_CHICK 261 54.17 240 110 21 1 240 1 261 3.9e-56 200.0 15ASVI4KRKT1DN4LFRKIH1DE1IF1-D-S-V-L-G-K-K-P-A-A-A-S-G-A-E-R-P-R-T1QPHSLN1DEAGFDAGQKVINSPL5AV8TA1SCVT6TS3KNVT2YH3QS1LIQKAK2RQ5AS1QH1TATNLI1RASNCALPRKATLM1HI2MLFI1VL1LT1EQ1VQSPPSQETK1AQAETVLMAEEG1DSVTTS1QKLQLF1DEKR3ND3LITI1PSHE9TV3HQ3AV2QDVI2GD2KR1AMTE2QR3AE3EKDE2QFEQ3VM2KNAI1DEFLPS-N-IPQAI2TQIL1QEKH1MA1WVVLLMAK1ILRK 770s # FASTA processed 1 queries 770s + fasta36 -q mgstm1.aa prot_test.lseg 770s # fasta36 -q mgstm1.aa prot_test.lseg 770s FASTA searches a protein or DNA sequence data bank 770s version 36.3.8i Nov, 2022 770s Please cite: 770s W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 770s 770s Query: mgstm1.aa 770s 1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa 770s Library: prot_test.lseg 770s 2267 residues in 12 sequences 770s 770s Statistics: (shuffled [488]) MLE statistics: Lambda= 0.1649; K=0.00484 770s statistics sampled from 4 (4) to 488 sequences 770s Algorithm: FASTA (3.8 Nov 2011) [optimized] 770s Parameters: BL50 matrix (15:-5), open/ext: -10/-2 770s ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width: 16 770s Scan time: 0.000 770s 770s The best scores are: opt bits E(12) 770s sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 304.9 9.1e-87 770s sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222) 237 65.9 8.6e-15 770s sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142) 51 21.6 0.11 770s sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351) 43 19.7 1 770s sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139) 36 18.1 1.3 770s sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108) 31 16.9 2.1 770s sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105) 30 16.6 2.4 770s sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle ( 160) 30 16.6 3.5 770s sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A ( 567) 37 18.3 3.8 770s sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A ( 95) 26 15.7 3.9 770s sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc ( 54) 22 14.7 4.2 770s sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106) 23 15.0 6.2 770s 770s >>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O (218 aa) 770s initn: 1242 init1: 1242 opt: 1242 Z-score: 1609.6 bits: 304.9 E(12): 9.1e-87 770s Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218) 770s 770s 10 20 30 40 50 60 770s sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL 770s ::::::::..:::.: ::.:::::::::.::.::::::::.::::::::::::::::::: 770s sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 770s 10 20 30 40 50 60 770s 770s 70 80 90 100 110 120 770s sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF 770s ::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.: 770s sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 770s 70 80 90 100 110 120 770s 770s 130 140 150 160 170 180 770s sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN 770s :: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.::::::::::: 770s sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 770s 130 140 150 160 170 180 770s 770s 190 200 210 770s sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK 770s :.::..:::::.::::::::::.. :.::::: :.:: 770s sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 770s 190 200 210 770s 770s >>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1 (222 aa) 770s initn: 204 init1: 73 opt: 237 Z-score: 317.4 bits: 65.9 E(12): 8.6e-15 770s Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218) 770s 770s 10 20 30 40 50 770s sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD 770s .: :.:.:: . :: :: . .::: : .: ::.: .: 770s sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM 770s 10 20 30 40 50 770s 770s 60 70 80 90 100 110 770s sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML 770s : ..:.. ::: :..:. ::: :.: :. : :. .:: :. . ..: :.: . .. 770s sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV 770s 60 70 80 90 100 110 770s 770s 120 130 140 150 160 170 770s sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF 770s :: .. : . : : . . . . : . . ...:...: ::. ..: . : 770s sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF 770s 120 130 140 150 160 170 770s 770s 180 190 200 210 770s sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK 770s . . : .:: :. : .:. .: ... ... . :. .:. . . : 770s sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF 770s 180 190 200 210 220 770s 770s >>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s (142 aa) 770s initn: 40 init1: 40 opt: 51 Z-score: 81.8 bits: 21.6 E(12): 0.11 770s Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73) 770s 770s 150 160 170 180 190 200 770s sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA 770s .::. . .. .:. :.. :: .:. .. .: 770s sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA 770s 10 20 30 40 50 60 770s 770s 210 770s sp|P10 TPIFSKMAHWSNK 770s . . .:: 770s sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA 770s 70 80 90 100 110 120 770s 770s >>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca (351 aa) 770s initn: 43 init1: 43 opt: 43 Z-score: 64.4 bits: 19.7 E(12): 1 770s Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300) 770s 770s 110 120 130 140 150 160 770s sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ 770s .: : :.:: . . . .. . 770s sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF 770s 200 210 220 230 240 250 770s 770s 170 180 190 200 210 770s sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK 770s : : . :: :. :: .::. .:. ...:: 770s sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK 770s 260 270 280 290 300 310 770s 770s sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 770s 320 330 340 350 770s 770s >>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase (139 aa) 770s initn: 56 init1: 36 opt: 36 Z-score: 62.7 bits: 18.1 E(12): 1.3 770s Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53) 770s 770s 10 20 30 770s sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG 770s ::.. :: 770s sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP 770s 20 30 40 50 60 70 770s 770s 40 50 60 70 80 90 770s sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR 770s 770s sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG 770s 80 90 100 110 120 130 770s 770s >>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS= (108 aa) 770s initn: 31 init1: 31 opt: 31 Z-score: 58.2 bits: 16.9 E(12): 2.1 770s Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64) 770s 770s 120 130 140 150 160 170 770s sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK 770s ::.:: . . :: :. :.. :: 770s sp|P01 DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK 770s 10 20 30 40 770s 770s 180 190 200 210 770s sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK 770s : :: ::. . .:: : 770s sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL 770s 50 60 70 80 90 100 770s 770s >>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN (105 aa) 770s initn: 30 init1: 30 opt: 30 Z-score: 57.1 bits: 16.6 E(12): 2.4 770s Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88) 770s 770s 100 110 120 130 140 150 770s sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY 770s :: :. :... :. : . :..: 770s sp|P99 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG 770s 10 20 30 40 50 770s 770s 160 170 180 190 200 210 770s sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW 770s . . . : : .: . .:: .:. . . : :.:: 770s sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE 770s 60 70 80 90 100 770s 770s 770s sp|P10 SNK 770s 770s >>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H (160 aa) 770s initn: 30 init1: 30 opt: 30 Z-score: 53.9 bits: 16.6 E(12): 3.5 770s Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62) 770s 770s 20 30 40 50 60 70 770s sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT-- 770s :. . .:: ..:. . ::. :. 770s sp|P02 MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK 770s 10 20 30 770s 770s 80 90 100 110 120 770s sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL 770s . ....:.:.. :..::. :: 770s sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE 770s 40 50 60 70 80 90 770s 770s >>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru (567 aa) 770s initn: 37 init1: 37 opt: 37 Z-score: 53.0 bits: 18.3 E(12): 3.8 770s Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437) 770s 770s 50 60 70 80 90 100 770s sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN 770s : ... .: :... : : . : . .:. 770s sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK 770s 370 380 390 400 410 420 770s 770s 110 120 130 140 150 160 770s sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD 770s : ::...: 770s sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH 770s 430 440 450 460 470 480 770s 770s >>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O (95 aa) 770s initn: 26 init1: 26 opt: 26 Z-score: 52.8 bits: 15.7 E(12): 3.9 770s Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94) 770s 770s 90 100 110 120 130 140 770s sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK 770s : :: ::.: 770s sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG 770s 60 70 80 90 770s 770s 150 160 170 180 190 200 770s sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI 770s 770s >>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a (54 aa) 770s initn: 22 init1: 22 opt: 22 Z-score: 52.0 bits: 14.7 E(12): 4.2 770s Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18) 770s 770s 150 160 170 180 190 200 770s sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS 770s .:.: 770s sp|P00 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV 770s 10 20 30 40 770s 770s 210 770s sp|P10 SRYIATPIFSKMAHWSNK 770s 770s sp|P00 CPVGAPNPED 770s 50 770s 770s >>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s (106 aa) 770s initn: 23 init1: 23 opt: 23 Z-score: 48.1 bits: 15.0 E(12): 6.2 770s Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82) 770s 770s 30 40 50 60 70 80 770s sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH 770s :. : .:. ... .: : . . 770s sp|P01 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK 770s 10 20 30 40 770s 770s 90 100 110 120 130 140 770s sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG 770s .:. . . ...:.. :. ..: . . :.::.: 770s sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF 770s 50 60 70 80 90 100 770s 770s 150 160 170 180 190 200 770s sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY 770s 770s sp|P01 NRGEC 770s 770s 770s 770s 770s 218 residues in 1 query sequences 770s 2267 residues in 12 library sequences 770s Tcomplib [36.3.8i Nov, 2022] (2 proc in memory [0G]) 770s start: Fri Feb 6 18:28:53 2026 done: Fri Feb 6 18:28:53 2026 770s Total Scan time: 0.000 Total Display time: 0.000 770s 770s Function used was FASTA [36.3.8i Nov, 2022] 770s autopkgtest [18:28:54]: test run-unit-test: -----------------------] 770s run-unit-test PASS 770s autopkgtest [18:28:54]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 771s autopkgtest [18:28:55]: @@@@@@@@@@@@@@@@@@@@ summary 771s run-unit-test PASS