0s autopkgtest [12:12:42]: starting date and time: 2025-05-06 12:12:42+0000 0s autopkgtest [12:12:42]: git checkout: 9986aa8c Merge branch 'skia/fix_network_interface' into 'ubuntu/production' 0s autopkgtest [12:12:42]: host juju-7f2275-prod-proposed-migration-environment-21; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.xwth3b68/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:tm-align --apt-upgrade tm-align --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=tm-align/20190822+dfsg-3 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-ppc64el --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-21@bos03-ppc64el-8.secgroup --name adt-questing-ppc64el-tm-align-20250506-121241-juju-7f2275-prod-proposed-migration-environment-21-58b4fcb5-e17d-4303-8004-348e0791f2f7 --image adt/ubuntu-questing-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-21 --net-id=net_prod-proposed-migration-ppc64el -e TERM=linux --mirror=http://ftpmaster.internal/ubuntu/ 106s autopkgtest [12:14:28]: testbed dpkg architecture: ppc64el 106s autopkgtest [12:14:28]: testbed apt version: 3.0.0 107s autopkgtest [12:14:29]: @@@@@@@@@@@@@@@@@@@@ test bed setup 107s autopkgtest [12:14:29]: testbed release detected to be: None 107s autopkgtest [12:14:29]: updating testbed package index (apt update) 108s Get:1 http://ftpmaster.internal/ubuntu questing-proposed InRelease [110 kB] 108s Hit:2 http://ftpmaster.internal/ubuntu questing InRelease 108s Hit:3 http://ftpmaster.internal/ubuntu questing-updates InRelease 108s Hit:4 http://ftpmaster.internal/ubuntu questing-security InRelease 108s Get:5 http://ftpmaster.internal/ubuntu questing-proposed/main Sources [72.4 kB] 108s Get:6 http://ftpmaster.internal/ubuntu questing-proposed/multiverse Sources [27.3 kB] 108s Get:7 http://ftpmaster.internal/ubuntu questing-proposed/universe Sources [595 kB] 109s Get:8 http://ftpmaster.internal/ubuntu questing-proposed/main ppc64el Packages [139 kB] 109s Get:9 http://ftpmaster.internal/ubuntu questing-proposed/universe ppc64el Packages [601 kB] 109s Get:10 http://ftpmaster.internal/ubuntu questing-proposed/multiverse ppc64el Packages [18.1 kB] 109s Fetched 1563 kB in 2s (1013 kB/s) 110s Reading package lists... 111s autopkgtest [12:14:33]: upgrading testbed (apt dist-upgrade and autopurge) 111s Reading package lists... 111s Building dependency tree... 111s Reading state information... 111s Calculating upgrade...Starting pkgProblemResolver with broken count: 0 111s Starting 2 pkgProblemResolver with broken count: 0 111s Done 112s Entering ResolveByKeep 112s 112s Calculating upgrade... 112s The following packages will be upgraded: 112s dhcpcd-base dirmngr gir1.2-glib-2.0 gnupg gnupg-l10n gnupg-utils gpg 112s gpg-agent gpg-wks-client gpgconf gpgsm gpgv groff-base keyboxd 112s libglib2.0-0t64 libglib2.0-data libnuma1 libperl5.40 libpython3.12-minimal 112s libpython3.12-stdlib libpython3.12t64 libsemanage-common libsemanage2 112s libx11-6 libx11-data libxml2 numactl openssh-client openssh-server 112s openssh-sftp-server perl perl-base perl-modules-5.40 python3-dbus 112s python3-wadllib 112s 35 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 112s Need to get 25.9 MB of archives. 112s After this operation, 287 kB disk space will be freed. 112s Get:1 http://ftpmaster.internal/ubuntu questing/main ppc64el libperl5.40 ppc64el 5.40.1-3 [4949 kB] 114s Get:2 http://ftpmaster.internal/ubuntu questing/main ppc64el perl ppc64el 5.40.1-3 [262 kB] 114s Get:3 http://ftpmaster.internal/ubuntu questing/main ppc64el perl-base ppc64el 5.40.1-3 [1923 kB] 115s Get:4 http://ftpmaster.internal/ubuntu questing/main ppc64el perl-modules-5.40 all 5.40.1-3 [3217 kB] 115s Get:5 http://ftpmaster.internal/ubuntu questing/main ppc64el openssh-sftp-server ppc64el 1:9.9p1-3ubuntu3.1 [43.4 kB] 115s Get:6 http://ftpmaster.internal/ubuntu questing/main ppc64el openssh-server ppc64el 1:9.9p1-3ubuntu3.1 [679 kB] 116s Get:7 http://ftpmaster.internal/ubuntu questing/main ppc64el openssh-client ppc64el 1:9.9p1-3ubuntu3.1 [1168 kB] 116s Get:8 http://ftpmaster.internal/ubuntu questing/main ppc64el libsemanage-common all 3.8.1-1 [7826 B] 116s Get:9 http://ftpmaster.internal/ubuntu questing/main ppc64el libsemanage2 ppc64el 3.8.1-1 [121 kB] 116s Get:10 http://ftpmaster.internal/ubuntu questing/main ppc64el gpg-wks-client ppc64el 2.4.4-2ubuntu24 [84.3 kB] 116s Get:11 http://ftpmaster.internal/ubuntu questing/main ppc64el dirmngr ppc64el 2.4.4-2ubuntu24 [390 kB] 116s Get:12 http://ftpmaster.internal/ubuntu questing/main ppc64el gpgsm ppc64el 2.4.4-2ubuntu24 [292 kB] 116s Get:13 http://ftpmaster.internal/ubuntu questing/main ppc64el gnupg-utils ppc64el 2.4.4-2ubuntu24 [123 kB] 116s Get:14 http://ftpmaster.internal/ubuntu questing/main ppc64el gpg-agent ppc64el 2.4.4-2ubuntu24 [275 kB] 116s Get:15 http://ftpmaster.internal/ubuntu questing/main ppc64el gpg ppc64el 2.4.4-2ubuntu24 [707 kB] 116s Get:16 http://ftpmaster.internal/ubuntu questing/main ppc64el gpgconf ppc64el 2.4.4-2ubuntu24 [115 kB] 116s Get:17 http://ftpmaster.internal/ubuntu questing/main ppc64el gnupg all 2.4.4-2ubuntu24 [359 kB] 116s Get:18 http://ftpmaster.internal/ubuntu questing/main ppc64el keyboxd ppc64el 2.4.4-2ubuntu24 [93.1 kB] 116s Get:19 http://ftpmaster.internal/ubuntu questing/main ppc64el gpgv ppc64el 2.4.4-2ubuntu24 [197 kB] 116s Get:20 http://ftpmaster.internal/ubuntu questing/main ppc64el dhcpcd-base ppc64el 1:10.1.0-10 [280 kB] 116s Get:21 http://ftpmaster.internal/ubuntu questing/main ppc64el gir1.2-glib-2.0 ppc64el 2.84.1-2 [184 kB] 117s Get:22 http://ftpmaster.internal/ubuntu questing/main ppc64el libglib2.0-0t64 ppc64el 2.84.1-2 [1803 kB] 117s Get:23 http://ftpmaster.internal/ubuntu questing/main ppc64el libglib2.0-data all 2.84.1-2 [53.2 kB] 117s Get:24 http://ftpmaster.internal/ubuntu questing/main ppc64el libxml2 ppc64el 2.12.7+dfsg+really2.9.14-0.4ubuntu0.1 [836 kB] 117s Get:25 http://ftpmaster.internal/ubuntu questing/main ppc64el python3-dbus ppc64el 1.4.0-1 [109 kB] 117s Get:26 http://ftpmaster.internal/ubuntu questing/main ppc64el groff-base ppc64el 1.23.0-8 [1110 kB] 117s Get:27 http://ftpmaster.internal/ubuntu questing/main ppc64el libnuma1 ppc64el 2.0.19-1 [27.9 kB] 117s Get:28 http://ftpmaster.internal/ubuntu questing/main ppc64el libx11-data all 2:1.8.12-1 [116 kB] 117s Get:29 http://ftpmaster.internal/ubuntu questing/main ppc64el libx11-6 ppc64el 2:1.8.12-1 [739 kB] 118s Get:30 http://ftpmaster.internal/ubuntu questing/main ppc64el numactl ppc64el 2.0.19-1 [43.2 kB] 118s Get:31 http://ftpmaster.internal/ubuntu questing/main ppc64el gnupg-l10n all 2.4.4-2ubuntu24 [66.8 kB] 118s Get:32 http://ftpmaster.internal/ubuntu questing-proposed/universe ppc64el libpython3.12t64 ppc64el 3.12.10-1 [2558 kB] 118s Get:33 http://ftpmaster.internal/ubuntu questing-proposed/universe ppc64el libpython3.12-stdlib ppc64el 3.12.10-1 [2105 kB] 119s Get:34 http://ftpmaster.internal/ubuntu questing-proposed/universe ppc64el libpython3.12-minimal ppc64el 3.12.10-1 [841 kB] 119s Get:35 http://ftpmaster.internal/ubuntu questing/main ppc64el python3-wadllib all 2.0.0-3 [36.3 kB] 120s Preconfiguring packages ... 120s Fetched 25.9 MB in 7s (3564 kB/s) 120s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 107214 files and directories currently installed.) 120s Preparing to unpack .../libperl5.40_5.40.1-3_ppc64el.deb ... 120s Unpacking libperl5.40:ppc64el (5.40.1-3) over (5.40.1-2) ... 120s Preparing to unpack .../perl_5.40.1-3_ppc64el.deb ... 120s Unpacking perl (5.40.1-3) over (5.40.1-2) ... 120s Preparing to unpack .../perl-base_5.40.1-3_ppc64el.deb ... 120s Unpacking perl-base (5.40.1-3) over (5.40.1-2) ... 121s Setting up perl-base (5.40.1-3) ... 121s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 107214 files and directories currently installed.) 121s Preparing to unpack .../perl-modules-5.40_5.40.1-3_all.deb ... 121s Unpacking perl-modules-5.40 (5.40.1-3) over (5.40.1-2) ... 121s Preparing to unpack .../openssh-sftp-server_1%3a9.9p1-3ubuntu3.1_ppc64el.deb ... 121s Unpacking openssh-sftp-server (1:9.9p1-3ubuntu3.1) over (1:9.9p1-3ubuntu3) ... 121s Preparing to unpack .../openssh-server_1%3a9.9p1-3ubuntu3.1_ppc64el.deb ... 121s Unpacking openssh-server (1:9.9p1-3ubuntu3.1) over (1:9.9p1-3ubuntu3) ... 121s Preparing to unpack .../openssh-client_1%3a9.9p1-3ubuntu3.1_ppc64el.deb ... 121s Unpacking openssh-client (1:9.9p1-3ubuntu3.1) over (1:9.9p1-3ubuntu3) ... 121s Preparing to unpack .../libsemanage-common_3.8.1-1_all.deb ... 121s Unpacking libsemanage-common (3.8.1-1) over (3.7-2.1build1) ... 121s Setting up libsemanage-common (3.8.1-1) ... 121s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 107214 files and directories currently installed.) 121s Preparing to unpack .../libsemanage2_3.8.1-1_ppc64el.deb ... 121s Unpacking libsemanage2:ppc64el (3.8.1-1) over (3.7-2.1build1) ... 121s Setting up libsemanage2:ppc64el (3.8.1-1) ... 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 107214 files and directories currently installed.) 122s Preparing to unpack .../0-gpg-wks-client_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gpg-wks-client (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../1-dirmngr_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking dirmngr (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../2-gpgsm_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gpgsm (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../3-gnupg-utils_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gnupg-utils (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../4-gpg-agent_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gpg-agent (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../5-gpg_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gpg (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../6-gpgconf_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gpgconf (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../7-gnupg_2.4.4-2ubuntu24_all.deb ... 122s Unpacking gnupg (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../8-keyboxd_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking keyboxd (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../9-gpgv_2.4.4-2ubuntu24_ppc64el.deb ... 122s Unpacking gpgv (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Setting up gpgv (2.4.4-2ubuntu24) ... 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 107214 files and directories currently installed.) 122s Preparing to unpack .../00-dhcpcd-base_1%3a10.1.0-10_ppc64el.deb ... 122s Unpacking dhcpcd-base (1:10.1.0-10) over (1:10.1.0-8) ... 122s Preparing to unpack .../01-gir1.2-glib-2.0_2.84.1-2_ppc64el.deb ... 122s Unpacking gir1.2-glib-2.0:ppc64el (2.84.1-2) over (2.84.1-1) ... 122s Preparing to unpack .../02-libglib2.0-0t64_2.84.1-2_ppc64el.deb ... 122s Unpacking libglib2.0-0t64:ppc64el (2.84.1-2) over (2.84.1-1) ... 122s Preparing to unpack .../03-libglib2.0-data_2.84.1-2_all.deb ... 122s Unpacking libglib2.0-data (2.84.1-2) over (2.84.1-1) ... 122s Preparing to unpack .../04-libxml2_2.12.7+dfsg+really2.9.14-0.4ubuntu0.1_ppc64el.deb ... 122s Unpacking libxml2:ppc64el (2.12.7+dfsg+really2.9.14-0.4ubuntu0.1) over (2.12.7+dfsg+really2.9.14-0.4) ... 122s Preparing to unpack .../05-python3-dbus_1.4.0-1_ppc64el.deb ... 122s Unpacking python3-dbus (1.4.0-1) over (1.3.2-5build5) ... 122s Preparing to unpack .../06-groff-base_1.23.0-8_ppc64el.deb ... 122s Unpacking groff-base (1.23.0-8) over (1.23.0-7) ... 122s Preparing to unpack .../07-libnuma1_2.0.19-1_ppc64el.deb ... 122s Unpacking libnuma1:ppc64el (2.0.19-1) over (2.0.18-1build1) ... 122s Preparing to unpack .../08-libx11-data_2%3a1.8.12-1_all.deb ... 122s Unpacking libx11-data (2:1.8.12-1) over (2:1.8.10-2) ... 122s Preparing to unpack .../09-libx11-6_2%3a1.8.12-1_ppc64el.deb ... 122s Unpacking libx11-6:ppc64el (2:1.8.12-1) over (2:1.8.10-2) ... 122s Preparing to unpack .../10-numactl_2.0.19-1_ppc64el.deb ... 122s Unpacking numactl (2.0.19-1) over (2.0.18-1build1) ... 122s Preparing to unpack .../11-gnupg-l10n_2.4.4-2ubuntu24_all.deb ... 122s Unpacking gnupg-l10n (2.4.4-2ubuntu24) over (2.4.4-2ubuntu23) ... 122s Preparing to unpack .../12-libpython3.12t64_3.12.10-1_ppc64el.deb ... 122s Unpacking libpython3.12t64:ppc64el (3.12.10-1) over (3.12.8-3) ... 122s Preparing to unpack .../13-libpython3.12-stdlib_3.12.10-1_ppc64el.deb ... 122s Unpacking libpython3.12-stdlib:ppc64el (3.12.10-1) over (3.12.8-3) ... 123s Preparing to unpack .../14-libpython3.12-minimal_3.12.10-1_ppc64el.deb ... 123s Unpacking libpython3.12-minimal:ppc64el (3.12.10-1) over (3.12.8-3) ... 123s Preparing to unpack .../15-python3-wadllib_2.0.0-3_all.deb ... 123s Unpacking python3-wadllib (2.0.0-3) over (2.0.0-2) ... 123s Setting up openssh-client (1:9.9p1-3ubuntu3.1) ... 123s Setting up libpython3.12-minimal:ppc64el (3.12.10-1) ... 123s Setting up libglib2.0-0t64:ppc64el (2.84.1-2) ... 123s No schema files found: doing nothing. 123s Setting up libglib2.0-data (2.84.1-2) ... 123s Setting up libx11-data (2:1.8.12-1) ... 123s Setting up gnupg-l10n (2.4.4-2ubuntu24) ... 123s Setting up python3-wadllib (2.0.0-3) ... 123s Setting up dhcpcd-base (1:10.1.0-10) ... 123s Installing new version of config file /etc/dhcpcd.conf ... 123s Setting up gir1.2-glib-2.0:ppc64el (2.84.1-2) ... 123s Setting up libnuma1:ppc64el (2.0.19-1) ... 123s Setting up perl-modules-5.40 (5.40.1-3) ... 123s Setting up groff-base (1.23.0-8) ... 123s Setting up gpgconf (2.4.4-2ubuntu24) ... 123s Setting up libx11-6:ppc64el (2:1.8.12-1) ... 123s Setting up libxml2:ppc64el (2.12.7+dfsg+really2.9.14-0.4ubuntu0.1) ... 123s Setting up gpg (2.4.4-2ubuntu24) ... 123s Setting up gnupg-utils (2.4.4-2ubuntu24) ... 123s Setting up openssh-sftp-server (1:9.9p1-3ubuntu3.1) ... 123s Setting up python3-dbus (1.4.0-1) ... 123s Setting up gpg-agent (2.4.4-2ubuntu24) ... 124s Setting up libpython3.12-stdlib:ppc64el (3.12.10-1) ... 124s Setting up numactl (2.0.19-1) ... 124s Setting up openssh-server (1:9.9p1-3ubuntu3.1) ... 125s Setting up gpgsm (2.4.4-2ubuntu24) ... 125s Setting up libpython3.12t64:ppc64el (3.12.10-1) ... 125s Setting up libperl5.40:ppc64el (5.40.1-3) ... 125s Setting up dirmngr (2.4.4-2ubuntu24) ... 125s Setting up perl (5.40.1-3) ... 125s Setting up keyboxd (2.4.4-2ubuntu24) ... 125s Setting up gnupg (2.4.4-2ubuntu24) ... 125s Setting up gpg-wks-client (2.4.4-2ubuntu24) ... 125s Processing triggers for ufw (0.36.2-9) ... 125s Processing triggers for man-db (2.13.1-1) ... 127s Processing triggers for install-info (7.1.1-1) ... 127s Processing triggers for libc-bin (2.41-6ubuntu1) ... 128s Reading package lists... 128s Building dependency tree... 128s Reading state information... 128s Starting pkgProblemResolver with broken count: 0 128s Starting 2 pkgProblemResolver with broken count: 0 128s Done 128s Solving dependencies... 128s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 128s autopkgtest [12:14:50]: rebooting testbed after setup commands that affected boot 162s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 169s autopkgtest [12:15:31]: testbed running kernel: Linux 6.14.0-15-generic #15-Ubuntu SMP Sun Apr 6 14:52:42 UTC 2025 171s autopkgtest [12:15:33]: @@@@@@@@@@@@@@@@@@@@ apt-source tm-align 174s Get:1 http://ftpmaster.internal/ubuntu questing-proposed/universe tm-align 20190822+dfsg-3 (dsc) [2077 B] 174s Get:2 http://ftpmaster.internal/ubuntu questing-proposed/universe tm-align 20190822+dfsg-3 (tar) [52.8 kB] 174s Get:3 http://ftpmaster.internal/ubuntu questing-proposed/universe tm-align 20190822+dfsg-3 (diff) [818 kB] 174s gpgv: Signature made Mon Sep 16 11:21:36 2024 UTC 174s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 174s gpgv: issuer "tille@debian.org" 174s gpgv: Can't check signature: No public key 174s dpkg-source: warning: cannot verify inline signature for ./tm-align_20190822+dfsg-3.dsc: no acceptable signature found 174s autopkgtest [12:15:36]: testing package tm-align version 20190822+dfsg-3 175s autopkgtest [12:15:37]: build not needed 175s autopkgtest [12:15:37]: test run-unit-test: preparing testbed 176s Reading package lists... 176s Building dependency tree... 176s Reading state information... 176s Starting pkgProblemResolver with broken count: 0 176s Starting 2 pkgProblemResolver with broken count: 0 176s Done 176s The following NEW packages will be installed: 176s libgfortran5 tm-align 176s 0 upgraded, 2 newly installed, 0 to remove and 0 not upgraded. 176s Need to get 1508 kB of archives. 176s After this operation, 4036 kB of additional disk space will be used. 176s Get:1 http://ftpmaster.internal/ubuntu questing/main ppc64el libgfortran5 ppc64el 15-20250404-0ubuntu1 [615 kB] 177s Get:2 http://ftpmaster.internal/ubuntu questing-proposed/universe ppc64el tm-align ppc64el 20190822+dfsg-3 [893 kB] 177s Fetched 1508 kB in 1s (1938 kB/s) 177s Selecting previously unselected package libgfortran5:ppc64el. 177s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 107214 files and directories currently installed.) 177s Preparing to unpack .../libgfortran5_15-20250404-0ubuntu1_ppc64el.deb ... 177s Unpacking libgfortran5:ppc64el (15-20250404-0ubuntu1) ... 178s Selecting previously unselected package tm-align. 178s Preparing to unpack .../tm-align_20190822+dfsg-3_ppc64el.deb ... 178s Unpacking tm-align (20190822+dfsg-3) ... 178s Setting up libgfortran5:ppc64el (15-20250404-0ubuntu1) ... 178s Setting up tm-align (20190822+dfsg-3) ... 178s Processing triggers for libc-bin (2.41-6ubuntu1) ... 178s Processing triggers for man-db (2.13.1-1) ... 179s autopkgtest [12:15:41]: test run-unit-test: [----------------------- 180s Run TMalign... 180s 180s ************************************************************************** 180s * TM-align (Version 20190822) * 180s * An algorithm for protein structure alignment and comparison * 180s * Based on statistics: * 180s * 0.0 < TM-score < 0.30, random structural similarity * 180s * 0.5 < TM-score < 1.00, in about the same fold * 180s * Reference: Y Zhang and J Skolnick, Nucl Acids Res 33, 2302-9 (2005) * 180s * Please email your comments and suggestions to: zhng@umich.edu * 180s ************************************************************************** 180s 180s Name of Chain_1: 1ni7.pdb 180s Name of Chain_2: 5eep.pdb 180s Length of Chain_1: 149 residues 180s Length of Chain_2: 140 residues 180s 180s Aligned length= 140, RMSD= 1.60, Seq_ID=n_identical/n_aligned= 0.986 180s TM-score= 0.85044 (if normalized by length of Chain_1) 180s TM-score= 0.90009 (if normalized by length of Chain_2) 180s (You should use TM-score normalized by length of the reference protein) 180s 180s (":" denotes aligned residue pairs of d < 5.0 A, "." denotes other aligned residues) 180s MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE 180s : ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 180s ------G-HPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV-- 180s 180s Run TMscore... 180s Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 180s 180s ***************************************************************************** 180s * TM-SCORE * 180s * A scoring function to assess the similarity of protein structures * 180s * Based on statistics: * 180s * 0.0 < TM-score < 0.17, random structural similarity * 180s * 0.5 < TM-score < 1.00, in about the same fold * 180s * Reference: Yang Zhang and Jeffrey Skolnick, Proteins 2004 57: 702-710 * 180s * For comments, please email to: zhng@umich.edu * 180s ***************************************************************************** 180s 180s Structure1: 1ni7.pdb Length= 149 180s Structure2: 5eep.pdb Length= 140 (by which all scores are normalized) 180s Number of residues in common= 140 180s RMSD of the common residues= 1.616 180s 180s TM-score = 0.8987 (d0= 4.40) 180s MaxSub-score= 0.8459 (d0= 3.50) 180s GDT-TS-score= 0.8321 %(d<1)=0.4786 %(d<2)=0.8571 %(d<4)=0.9929 %(d<8)=1.0000 180s GDT-HA-score= 0.6214 %(d<0.5)=0.1571 %(d<1)=0.4786 %(d<2)=0.8571 %(d<4)=0.9929 180s 180s -------- rotation matrix to rotate Chain-1 to Chain-2 ------ 180s i t(i) u(i,1) u(i,2) u(i,3) 180s 1 0.9977278941 -0.2584957318 -0.9156232244 -0.3079189302 180s 2 13.5083713477 -0.8848339137 0.0965207762 0.4557989522 180s 3 45.5856492856 -0.3876195322 0.3902791958 -0.8351246898 180s 180s Superposition in the TM-score: Length(d<5.0)=140 RMSD= 1.62 180s (":" denotes the residue pairs of distance < 5.0 Angstrom) 180s MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE 180s :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 180s -------GHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV-- 180s 12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789 180s 180s autopkgtest [12:15:42]: test run-unit-test: -----------------------] 180s autopkgtest [12:15:42]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 180s run-unit-test FAIL stderr: Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 181s autopkgtest [12:15:43]: test run-unit-test: - - - - - - - - - - stderr - - - - - - - - - - 181s Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 181s autopkgtest [12:15:43]: @@@@@@@@@@@@@@@@@@@@ summary 181s run-unit-test FAIL stderr: Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 198s nova [W] Using flock in prodstack6-ppc64el 198s Creating nova instance adt-questing-ppc64el-tm-align-20250506-121241-juju-7f2275-prod-proposed-migration-environment-21-58b4fcb5-e17d-4303-8004-348e0791f2f7 from image adt/ubuntu-questing-ppc64el-server-20250505.img (UUID 5eb71ea2-eb0e-41c3-98a9-f40539045bc8)... 198s nova [W] Timed out waiting for 0bddf1bb-043c-41db-b8d8-40af867b9fb4 to get deleted.