0s autopkgtest [20:35:25]: starting date and time: 2024-11-23 20:35:25+0000 0s autopkgtest [20:35:25]: git checkout: 0acbae0a WIP show VirtSubproc stderr in real-time 0s autopkgtest [20:35:25]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.mey26kx1/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults --apt-upgrade pyfastx --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-s390x --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos03-s390x-4.secgroup --name adt-plucky-s390x-pyfastx-20241123-203525-juju-7f2275-prod-proposed-migration-environment-2-21cc0129-1ff6-4532-987b-16d883910cf4 --image adt/ubuntu-plucky-s390x-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration-s390x -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 102s autopkgtest [20:37:07]: testbed dpkg architecture: s390x 103s autopkgtest [20:37:08]: testbed apt version: 2.9.8 103s autopkgtest [20:37:08]: @@@@@@@@@@@@@@@@@@@@ test bed setup 103s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 104s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [54.8 kB] 104s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [13.6 kB] 104s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [9704 B] 104s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [930 kB] 104s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x Packages [70.6 kB] 104s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/restricted s390x Packages [756 B] 104s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/universe s390x Packages [760 kB] 104s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse s390x Packages [6452 B] 104s Fetched 1920 kB in 1s (2378 kB/s) 104s Reading package lists... 106s Reading package lists... 106s Building dependency tree... 106s Reading state information... 106s Calculating upgrade... 107s The following package was automatically installed and is no longer required: 107s libsgutils2-1.46-2 107s Use 'sudo apt autoremove' to remove it. 107s The following NEW packages will be installed: 107s libsgutils2-1.48 107s The following packages will be upgraded: 107s bash bpftrace curl debconf debconf-i18n distro-info gir1.2-girepository-2.0 107s gir1.2-glib-2.0 hostname libaudit-common libaudit1 libcurl3t64-gnutls 107s libcurl4t64 libgirepository-1.0-1 libglib2.0-0t64 libglib2.0-data 107s libpam-modules libpam-modules-bin libpam-runtime libpam0g libplymouth5 107s libpython3-stdlib libselinux1 libsemanage-common libsemanage2 linux-base 107s lxd-installer openssh-client openssh-server openssh-sftp-server plymouth 107s plymouth-theme-ubuntu-text python3 python3-blinker python3-debconf 107s python3-jsonschema-specifications python3-minimal python3-rpds-py 107s python3-yaml sg3-utils sg3-utils-udev vim-common vim-tiny xxd 107s 44 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 107s Need to get 11.4 MB of archives. 107s After this operation, 2418 kB of additional disk space will be used. 107s Get:1 http://ftpmaster.internal/ubuntu plucky/main s390x bash s390x 5.2.32-1ubuntu2 [845 kB] 107s Get:2 http://ftpmaster.internal/ubuntu plucky/main s390x hostname s390x 3.25 [11.2 kB] 107s Get:3 http://ftpmaster.internal/ubuntu plucky/main s390x libaudit-common all 1:4.0.2-2ubuntu1 [6578 B] 107s Get:4 http://ftpmaster.internal/ubuntu plucky/main s390x libaudit1 s390x 1:4.0.2-2ubuntu1 [52.5 kB] 107s Get:5 http://ftpmaster.internal/ubuntu plucky/main s390x debconf-i18n all 1.5.87ubuntu1 [204 kB] 107s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3-minimal s390x 3.12.7-1 [27.4 kB] 107s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3 s390x 3.12.7-1 [24.0 kB] 107s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x libpython3-stdlib s390x 3.12.7-1 [10.0 kB] 107s Get:9 http://ftpmaster.internal/ubuntu plucky/main s390x python3-debconf all 1.5.87ubuntu1 [4156 B] 107s Get:10 http://ftpmaster.internal/ubuntu plucky/main s390x debconf all 1.5.87ubuntu1 [124 kB] 107s Get:11 http://ftpmaster.internal/ubuntu plucky/main s390x libpam0g s390x 1.5.3-7ubuntu4 [70.0 kB] 107s Get:12 http://ftpmaster.internal/ubuntu plucky/main s390x libselinux1 s390x 3.7-3ubuntu1 [85.2 kB] 107s Get:13 http://ftpmaster.internal/ubuntu plucky/main s390x libpam-modules-bin s390x 1.5.3-7ubuntu4 [56.2 kB] 107s Get:14 http://ftpmaster.internal/ubuntu plucky/main s390x libpam-modules s390x 1.5.3-7ubuntu4 [294 kB] 107s Get:15 http://ftpmaster.internal/ubuntu plucky/main s390x openssh-sftp-server s390x 1:9.9p1-3ubuntu2 [38.2 kB] 107s Get:16 http://ftpmaster.internal/ubuntu plucky/main s390x openssh-server s390x 1:9.9p1-3ubuntu2 [552 kB] 107s Get:17 http://ftpmaster.internal/ubuntu plucky/main s390x openssh-client s390x 1:9.9p1-3ubuntu2 [955 kB] 107s Get:18 http://ftpmaster.internal/ubuntu plucky/main s390x libpam-runtime all 1.5.3-7ubuntu4 [40.8 kB] 107s Get:19 http://ftpmaster.internal/ubuntu plucky/main s390x libsemanage-common all 3.7-2build1 [7186 B] 107s Get:20 http://ftpmaster.internal/ubuntu plucky/main s390x libsemanage2 s390x 3.7-2build1 [97.1 kB] 107s Get:21 http://ftpmaster.internal/ubuntu plucky/main s390x distro-info s390x 1.12 [20.0 kB] 107s Get:22 http://ftpmaster.internal/ubuntu plucky/main s390x gir1.2-girepository-2.0 s390x 1.82.0-2 [25.0 kB] 107s Get:23 http://ftpmaster.internal/ubuntu plucky/main s390x gir1.2-glib-2.0 s390x 2.82.2-3 [180 kB] 107s Get:24 http://ftpmaster.internal/ubuntu plucky/main s390x libglib2.0-0t64 s390x 2.82.2-3 [1575 kB] 107s Get:25 http://ftpmaster.internal/ubuntu plucky/main s390x libgirepository-1.0-1 s390x 1.82.0-2 [84.9 kB] 107s Get:26 http://ftpmaster.internal/ubuntu plucky/main s390x libglib2.0-data all 2.82.2-3 [51.7 kB] 107s Get:27 http://ftpmaster.internal/ubuntu plucky/main s390x python3-yaml s390x 6.0.2-1build1 [188 kB] 107s Get:28 http://ftpmaster.internal/ubuntu plucky/main s390x vim-tiny s390x 2:9.1.0861-1ubuntu1 [664 kB] 107s Get:29 http://ftpmaster.internal/ubuntu plucky/main s390x vim-common all 2:9.1.0861-1ubuntu1 [395 kB] 107s Get:30 http://ftpmaster.internal/ubuntu plucky/main s390x xxd s390x 2:9.1.0861-1ubuntu1 [66.6 kB] 107s Get:31 http://ftpmaster.internal/ubuntu plucky/main s390x libplymouth5 s390x 24.004.60-2ubuntu3 [150 kB] 107s Get:32 http://ftpmaster.internal/ubuntu plucky/main s390x plymouth-theme-ubuntu-text s390x 24.004.60-2ubuntu3 [10.1 kB] 107s Get:33 http://ftpmaster.internal/ubuntu plucky/main s390x plymouth s390x 24.004.60-2ubuntu3 [144 kB] 108s Get:34 http://ftpmaster.internal/ubuntu plucky/main s390x bpftrace s390x 0.21.2-2ubuntu3 [1718 kB] 108s Get:35 http://ftpmaster.internal/ubuntu plucky/main s390x curl s390x 8.9.1-2ubuntu3 [241 kB] 108s Get:36 http://ftpmaster.internal/ubuntu plucky/main s390x libcurl4t64 s390x 8.9.1-2ubuntu3 [386 kB] 108s Get:37 http://ftpmaster.internal/ubuntu plucky/main s390x libcurl3t64-gnutls s390x 8.9.1-2ubuntu3 [379 kB] 108s Get:38 http://ftpmaster.internal/ubuntu plucky/main s390x libsgutils2-1.48 s390x 1.48-0ubuntu1 [120 kB] 108s Get:39 http://ftpmaster.internal/ubuntu plucky/main s390x linux-base all 4.10.1ubuntu1 [34.8 kB] 108s Get:40 http://ftpmaster.internal/ubuntu plucky/main s390x lxd-installer all 10 [5264 B] 108s Get:41 http://ftpmaster.internal/ubuntu plucky/main s390x python3-blinker all 1.9.0-1 [10.7 kB] 108s Get:42 http://ftpmaster.internal/ubuntu plucky/main s390x python3-rpds-py s390x 0.21.0-2ubuntu1 [368 kB] 108s Get:43 http://ftpmaster.internal/ubuntu plucky/main s390x python3-jsonschema-specifications all 2023.12.1-2 [9116 B] 108s Get:44 http://ftpmaster.internal/ubuntu plucky/main s390x sg3-utils s390x 1.48-0ubuntu1 [1027 kB] 108s Get:45 http://ftpmaster.internal/ubuntu plucky/main s390x sg3-utils-udev all 1.48-0ubuntu1 [6608 B] 108s Preconfiguring packages ... 108s Fetched 11.4 MB in 1s (9603 kB/s) 108s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 108s Preparing to unpack .../bash_5.2.32-1ubuntu2_s390x.deb ... 108s Unpacking bash (5.2.32-1ubuntu2) over (5.2.32-1ubuntu1) ... 108s Setting up bash (5.2.32-1ubuntu2) ... 108s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 108s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 108s Preparing to unpack .../hostname_3.25_s390x.deb ... 108s Unpacking hostname (3.25) over (3.23+nmu2ubuntu2) ... 108s Setting up hostname (3.25) ... 108s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 108s Preparing to unpack .../libaudit-common_1%3a4.0.2-2ubuntu1_all.deb ... 108s Unpacking libaudit-common (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 108s Setting up libaudit-common (1:4.0.2-2ubuntu1) ... 108s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 108s Preparing to unpack .../libaudit1_1%3a4.0.2-2ubuntu1_s390x.deb ... 108s Unpacking libaudit1:s390x (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 108s Setting up libaudit1:s390x (1:4.0.2-2ubuntu1) ... 108s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 108s Preparing to unpack .../debconf-i18n_1.5.87ubuntu1_all.deb ... 108s Unpacking debconf-i18n (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 108s Preparing to unpack .../python3-minimal_3.12.7-1_s390x.deb ... 108s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 108s Setting up python3-minimal (3.12.7-1) ... 109s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 109s Preparing to unpack .../python3_3.12.7-1_s390x.deb ... 109s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 109s Preparing to unpack .../libpython3-stdlib_3.12.7-1_s390x.deb ... 109s Unpacking libpython3-stdlib:s390x (3.12.7-1) over (3.12.6-0ubuntu1) ... 109s Preparing to unpack .../python3-debconf_1.5.87ubuntu1_all.deb ... 109s Unpacking python3-debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 109s Preparing to unpack .../debconf_1.5.87ubuntu1_all.deb ... 109s Unpacking debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 109s Setting up debconf (1.5.87ubuntu1) ... 109s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 109s Preparing to unpack .../libpam0g_1.5.3-7ubuntu4_s390x.deb ... 109s Unpacking libpam0g:s390x (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 109s Setting up libpam0g:s390x (1.5.3-7ubuntu4) ... 109s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 109s Preparing to unpack .../libselinux1_3.7-3ubuntu1_s390x.deb ... 109s Unpacking libselinux1:s390x (3.7-3ubuntu1) over (3.5-2ubuntu5) ... 109s Setting up libselinux1:s390x (3.7-3ubuntu1) ... 109s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 109s Preparing to unpack .../libpam-modules-bin_1.5.3-7ubuntu4_s390x.deb ... 109s Unpacking libpam-modules-bin (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 109s Setting up libpam-modules-bin (1.5.3-7ubuntu4) ... 109s pam_namespace.service is a disabled or a static unit not running, not starting it. 109s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 109s Preparing to unpack .../libpam-modules_1.5.3-7ubuntu4_s390x.deb ... 109s Unpacking libpam-modules:s390x (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 109s Setting up libpam-modules:s390x (1.5.3-7ubuntu4) ... 109s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 109s Preparing to unpack .../openssh-sftp-server_1%3a9.9p1-3ubuntu2_s390x.deb ... 109s Unpacking openssh-sftp-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 109s Preparing to unpack .../openssh-server_1%3a9.9p1-3ubuntu2_s390x.deb ... 109s Unpacking openssh-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 109s Preparing to unpack .../openssh-client_1%3a9.9p1-3ubuntu2_s390x.deb ... 109s Unpacking openssh-client (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 110s Preparing to unpack .../libpam-runtime_1.5.3-7ubuntu4_all.deb ... 110s Unpacking libpam-runtime (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 110s Setting up libpam-runtime (1.5.3-7ubuntu4) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55543 files and directories currently installed.) 110s Preparing to unpack .../libsemanage-common_3.7-2build1_all.deb ... 110s Unpacking libsemanage-common (3.7-2build1) over (3.5-1build6) ... 110s Setting up libsemanage-common (3.7-2build1) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55542 files and directories currently installed.) 110s Preparing to unpack .../libsemanage2_3.7-2build1_s390x.deb ... 110s Unpacking libsemanage2:s390x (3.7-2build1) over (3.5-1build6) ... 110s Setting up libsemanage2:s390x (3.7-2build1) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55542 files and directories currently installed.) 110s Preparing to unpack .../00-distro-info_1.12_s390x.deb ... 110s Unpacking distro-info (1.12) over (1.9) ... 110s Preparing to unpack .../01-gir1.2-girepository-2.0_1.82.0-2_s390x.deb ... 110s Unpacking gir1.2-girepository-2.0:s390x (1.82.0-2) over (1.80.1-4) ... 110s Preparing to unpack .../02-gir1.2-glib-2.0_2.82.2-3_s390x.deb ... 110s Unpacking gir1.2-glib-2.0:s390x (2.82.2-3) over (2.82.1-0ubuntu1) ... 110s Preparing to unpack .../03-libglib2.0-0t64_2.82.2-3_s390x.deb ... 110s Unpacking libglib2.0-0t64:s390x (2.82.2-3) over (2.82.1-0ubuntu1) ... 110s Preparing to unpack .../04-libgirepository-1.0-1_1.82.0-2_s390x.deb ... 110s Unpacking libgirepository-1.0-1:s390x (1.82.0-2) over (1.80.1-4) ... 110s Preparing to unpack .../05-libglib2.0-data_2.82.2-3_all.deb ... 110s Unpacking libglib2.0-data (2.82.2-3) over (2.82.1-0ubuntu1) ... 110s Preparing to unpack .../06-python3-yaml_6.0.2-1build1_s390x.deb ... 110s Unpacking python3-yaml (6.0.2-1build1) over (6.0.2-1) ... 110s Preparing to unpack .../07-vim-tiny_2%3a9.1.0861-1ubuntu1_s390x.deb ... 110s Unpacking vim-tiny (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 110s Preparing to unpack .../08-vim-common_2%3a9.1.0861-1ubuntu1_all.deb ... 110s Unpacking vim-common (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 110s Preparing to unpack .../09-xxd_2%3a9.1.0861-1ubuntu1_s390x.deb ... 110s Unpacking xxd (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 110s Preparing to unpack .../10-libplymouth5_24.004.60-2ubuntu3_s390x.deb ... 110s Unpacking libplymouth5:s390x (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 110s Preparing to unpack .../11-plymouth-theme-ubuntu-text_24.004.60-2ubuntu3_s390x.deb ... 110s Unpacking plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 110s Preparing to unpack .../12-plymouth_24.004.60-2ubuntu3_s390x.deb ... 110s Unpacking plymouth (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 110s Preparing to unpack .../13-bpftrace_0.21.2-2ubuntu3_s390x.deb ... 110s Unpacking bpftrace (0.21.2-2ubuntu3) over (0.21.2-2ubuntu2) ... 110s Preparing to unpack .../14-curl_8.9.1-2ubuntu3_s390x.deb ... 110s Unpacking curl (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 110s Preparing to unpack .../15-libcurl4t64_8.9.1-2ubuntu3_s390x.deb ... 110s Unpacking libcurl4t64:s390x (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 110s Preparing to unpack .../16-libcurl3t64-gnutls_8.9.1-2ubuntu3_s390x.deb ... 110s Unpacking libcurl3t64-gnutls:s390x (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 110s Selecting previously unselected package libsgutils2-1.48:s390x. 110s Preparing to unpack .../17-libsgutils2-1.48_1.48-0ubuntu1_s390x.deb ... 110s Unpacking libsgutils2-1.48:s390x (1.48-0ubuntu1) ... 110s Preparing to unpack .../18-linux-base_4.10.1ubuntu1_all.deb ... 110s Unpacking linux-base (4.10.1ubuntu1) over (4.5ubuntu9) ... 110s Preparing to unpack .../19-lxd-installer_10_all.deb ... 110s Unpacking lxd-installer (10) over (9) ... 110s Preparing to unpack .../20-python3-blinker_1.9.0-1_all.deb ... 110s Unpacking python3-blinker (1.9.0-1) over (1.8.2-1) ... 110s Preparing to unpack .../21-python3-rpds-py_0.21.0-2ubuntu1_s390x.deb ... 110s Unpacking python3-rpds-py (0.21.0-2ubuntu1) over (0.20.0-0ubuntu3) ... 110s Preparing to unpack .../22-python3-jsonschema-specifications_2023.12.1-2_all.deb ... 110s Unpacking python3-jsonschema-specifications (2023.12.1-2) over (2023.12.1-1ubuntu1) ... 110s Preparing to unpack .../23-sg3-utils_1.48-0ubuntu1_s390x.deb ... 110s Unpacking sg3-utils (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 110s Preparing to unpack .../24-sg3-utils-udev_1.48-0ubuntu1_all.deb ... 110s Unpacking sg3-utils-udev (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 110s Setting up distro-info (1.12) ... 110s Setting up linux-base (4.10.1ubuntu1) ... 111s Setting up libcurl4t64:s390x (8.9.1-2ubuntu3) ... 111s Setting up bpftrace (0.21.2-2ubuntu3) ... 111s Setting up openssh-client (1:9.9p1-3ubuntu2) ... 111s Setting up libcurl3t64-gnutls:s390x (8.9.1-2ubuntu3) ... 111s Setting up libsgutils2-1.48:s390x (1.48-0ubuntu1) ... 111s Setting up debconf-i18n (1.5.87ubuntu1) ... 111s Setting up xxd (2:9.1.0861-1ubuntu1) ... 111s Setting up libglib2.0-0t64:s390x (2.82.2-3) ... 111s No schema files found: doing nothing. 111s Setting up libglib2.0-data (2.82.2-3) ... 111s Setting up vim-common (2:9.1.0861-1ubuntu1) ... 111s Setting up gir1.2-glib-2.0:s390x (2.82.2-3) ... 111s Setting up lxd-installer (10) ... 111s Setting up libplymouth5:s390x (24.004.60-2ubuntu3) ... 111s Setting up libgirepository-1.0-1:s390x (1.82.0-2) ... 111s Setting up curl (8.9.1-2ubuntu3) ... 111s Setting up libpython3-stdlib:s390x (3.12.7-1) ... 111s Setting up sg3-utils (1.48-0ubuntu1) ... 111s Setting up openssh-sftp-server (1:9.9p1-3ubuntu2) ... 111s Setting up openssh-server (1:9.9p1-3ubuntu2) ... 111s Installing new version of config file /etc/ssh/moduli ... 111s Replacing config file /etc/ssh/sshd_config with new version 112s Setting up plymouth (24.004.60-2ubuntu3) ... 112s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 112s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 114s Using config file '/etc/zipl.conf' 114s Building bootmap in '/boot' 114s Adding IPL section 'ubuntu' (default) 114s Preparing boot device for LD-IPL: vda (0000). 114s Done. 114s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 114s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 114s Setting up python3 (3.12.7-1) ... 115s Setting up vim-tiny (2:9.1.0861-1ubuntu1) ... 115s Setting up sg3-utils-udev (1.48-0ubuntu1) ... 115s update-initramfs: deferring update (trigger activated) 115s Setting up plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) ... 115s update-initramfs: deferring update (trigger activated) 115s Setting up gir1.2-girepository-2.0:s390x (1.82.0-2) ... 115s Setting up python3-rpds-py (0.21.0-2ubuntu1) ... 115s Setting up python3-jsonschema-specifications (2023.12.1-2) ... 115s Setting up python3-blinker (1.9.0-1) ... 115s Setting up python3-debconf (1.5.87ubuntu1) ... 115s Setting up python3-yaml (6.0.2-1build1) ... 115s Processing triggers for man-db (2.13.0-1) ... 116s Processing triggers for debianutils (5.21) ... 116s Processing triggers for install-info (7.1.1-1) ... 116s Processing triggers for initramfs-tools (0.142ubuntu35) ... 116s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 116s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 118s Using config file '/etc/zipl.conf' 118s Building bootmap in '/boot' 118s Adding IPL section 'ubuntu' (default) 118s Preparing boot device for LD-IPL: vda (0000). 118s Done. 118s Processing triggers for libc-bin (2.40-1ubuntu3) ... 118s Processing triggers for ufw (0.36.2-8) ... 118s Reading package lists... 119s Building dependency tree... 119s Reading state information... 119s The following packages will be REMOVED: 119s libsgutils2-1.46-2* 119s 0 upgraded, 0 newly installed, 1 to remove and 0 not upgraded. 119s After this operation, 294 kB disk space will be freed. 119s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55573 files and directories currently installed.) 119s Removing libsgutils2-1.46-2:s390x (1.46-3ubuntu5) ... 119s Processing triggers for libc-bin (2.40-1ubuntu3) ... 119s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 120s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 120s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 120s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 121s Reading package lists... 121s Reading package lists... 121s Building dependency tree... 121s Reading state information... 121s Calculating upgrade... 121s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 121s Reading package lists... 121s Building dependency tree... 121s Reading state information... 121s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 122s autopkgtest [20:37:27]: rebooting testbed after setup commands that affected boot 125s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 140s autopkgtest [20:37:45]: testbed running kernel: Linux 6.11.0-8-generic #8-Ubuntu SMP Mon Sep 16 12:49:35 UTC 2024 143s autopkgtest [20:37:48]: @@@@@@@@@@@@@@@@@@@@ apt-source pyfastx 146s Get:1 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (dsc) [2289 B] 146s Get:2 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (tar) [230 kB] 146s Get:3 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (diff) [7412 B] 146s gpgv: Signature made Fri Aug 30 18:49:12 2024 UTC 146s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 146s gpgv: issuer "emollier@debian.org" 146s gpgv: Can't check signature: No public key 146s dpkg-source: warning: cannot verify inline signature for ./pyfastx_2.1.0-2.dsc: no acceptable signature found 146s autopkgtest [20:37:51]: testing package pyfastx version 2.1.0-2 146s autopkgtest [20:37:51]: build not needed 147s autopkgtest [20:37:52]: test run-unit-test: preparing testbed 148s Reading package lists... 148s Building dependency tree... 148s Reading state information... 148s Starting pkgProblemResolver with broken count: 0 148s Starting 2 pkgProblemResolver with broken count: 0 148s Done 148s The following additional packages will be installed: 148s libpython3.13-minimal libpython3.13-stdlib pyfastx python3-all 148s python3-importlib-metadata python3-packaging python3-pyfaidx python3-pyfastx 148s python3.13 python3.13-minimal 148s Suggested packages: 148s python3.13-venv python3.13-doc binfmt-support 148s Recommended packages: 148s python3-biopython 148s The following NEW packages will be installed: 148s autopkgtest-satdep libpython3.13-minimal libpython3.13-stdlib pyfastx 148s python3-all python3-importlib-metadata python3-packaging python3-pyfaidx 148s python3-pyfastx python3.13 python3.13-minimal 148s 0 upgraded, 11 newly installed, 0 to remove and 0 not upgraded. 148s Need to get 6138 kB/6139 kB of archives. 148s After this operation, 23.3 MB of additional disk space will be used. 148s Get:1 /tmp/autopkgtest.2u5MfP/1-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [716 B] 148s Get:2 http://ftpmaster.internal/ubuntu plucky/main s390x libpython3.13-minimal s390x 3.13.0-2 [877 kB] 149s Get:3 http://ftpmaster.internal/ubuntu plucky/main s390x python3.13-minimal s390x 3.13.0-2 [2172 kB] 150s Get:4 http://ftpmaster.internal/ubuntu plucky/main s390x libpython3.13-stdlib s390x 3.13.0-2 [2086 kB] 151s Get:5 http://ftpmaster.internal/ubuntu plucky/main s390x python3-importlib-metadata all 8.5.0-1 [20.7 kB] 151s Get:6 http://ftpmaster.internal/ubuntu plucky/main s390x python3-packaging all 24.2-1 [51.5 kB] 151s Get:7 http://ftpmaster.internal/ubuntu plucky/universe s390x python3-pyfaidx all 0.8.1.3-1 [29.7 kB] 151s Get:8 http://ftpmaster.internal/ubuntu plucky/universe s390x python3-pyfastx s390x 2.1.0-2 [58.8 kB] 151s Get:9 http://ftpmaster.internal/ubuntu plucky/universe s390x pyfastx s390x 2.1.0-2 [122 kB] 151s Get:10 http://ftpmaster.internal/ubuntu plucky/main s390x python3.13 s390x 3.13.0-2 [719 kB] 151s Get:11 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3-all s390x 3.12.7-1 [890 B] 151s Fetched 6138 kB in 2s (2471 kB/s) 151s Selecting previously unselected package libpython3.13-minimal:s390x. 151s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55568 files and directories currently installed.) 151s Preparing to unpack .../00-libpython3.13-minimal_3.13.0-2_s390x.deb ... 151s Unpacking libpython3.13-minimal:s390x (3.13.0-2) ... 151s Selecting previously unselected package python3.13-minimal. 151s Preparing to unpack .../01-python3.13-minimal_3.13.0-2_s390x.deb ... 151s Unpacking python3.13-minimal (3.13.0-2) ... 151s Selecting previously unselected package libpython3.13-stdlib:s390x. 151s Preparing to unpack .../02-libpython3.13-stdlib_3.13.0-2_s390x.deb ... 151s Unpacking libpython3.13-stdlib:s390x (3.13.0-2) ... 151s Selecting previously unselected package python3-importlib-metadata. 151s Preparing to unpack .../03-python3-importlib-metadata_8.5.0-1_all.deb ... 151s Unpacking python3-importlib-metadata (8.5.0-1) ... 151s Selecting previously unselected package python3-packaging. 151s Preparing to unpack .../04-python3-packaging_24.2-1_all.deb ... 151s Unpacking python3-packaging (24.2-1) ... 151s Selecting previously unselected package python3-pyfaidx. 151s Preparing to unpack .../05-python3-pyfaidx_0.8.1.3-1_all.deb ... 151s Unpacking python3-pyfaidx (0.8.1.3-1) ... 151s Selecting previously unselected package python3-pyfastx. 151s Preparing to unpack .../06-python3-pyfastx_2.1.0-2_s390x.deb ... 151s Unpacking python3-pyfastx (2.1.0-2) ... 151s Selecting previously unselected package pyfastx. 151s Preparing to unpack .../07-pyfastx_2.1.0-2_s390x.deb ... 151s Unpacking pyfastx (2.1.0-2) ... 151s Selecting previously unselected package python3.13. 151s Preparing to unpack .../08-python3.13_3.13.0-2_s390x.deb ... 151s Unpacking python3.13 (3.13.0-2) ... 151s Selecting previously unselected package python3-all. 151s Preparing to unpack .../09-python3-all_3.12.7-1_s390x.deb ... 151s Unpacking python3-all (3.12.7-1) ... 151s Selecting previously unselected package autopkgtest-satdep. 151s Preparing to unpack .../10-1-autopkgtest-satdep.deb ... 151s Unpacking autopkgtest-satdep (0) ... 151s Setting up python3-importlib-metadata (8.5.0-1) ... 152s Setting up libpython3.13-minimal:s390x (3.13.0-2) ... 152s Setting up python3-packaging (24.2-1) ... 152s Setting up python3.13-minimal (3.13.0-2) ... 153s Setting up libpython3.13-stdlib:s390x (3.13.0-2) ... 153s Setting up python3-pyfaidx (0.8.1.3-1) ... 153s Setting up python3.13 (3.13.0-2) ... 154s Setting up python3-pyfastx (2.1.0-2) ... 154s Setting up python3-all (3.12.7-1) ... 154s Setting up pyfastx (2.1.0-2) ... 154s Setting up autopkgtest-satdep (0) ... 154s Processing triggers for man-db (2.13.0-1) ... 154s Processing triggers for systemd (256.5-2ubuntu4) ... 156s (Reading database ... 56403 files and directories currently installed.) 156s Removing autopkgtest-satdep (0) ... 157s autopkgtest [20:38:02]: test run-unit-test: [----------------------- 157s tests.test_fakeys (unittest.loader._FailedTest.tests.test_fakeys) ... ERROR 157s tests.test_fasta (unittest.loader._FailedTest.tests.test_fasta) ... ERROR 157s tests.test_fastq (unittest.loader._FailedTest.tests.test_fastq) ... ERROR 157s tests.test_fastx (unittest.loader._FailedTest.tests.test_fastx) ... ERROR 157s tests.test_fqkeys (unittest.loader._FailedTest.tests.test_fqkeys) ... ERROR 157s tests.test_read (unittest.loader._FailedTest.tests.test_read) ... ERROR 157s tests.test_sequence (unittest.loader._FailedTest.tests.test_sequence) ... ERROR 157s tests.test_sequence_error (unittest.loader._FailedTest.tests.test_sequence_error) ... ERROR 157s 157s ====================================================================== 157s ERROR: tests.test_fakeys (unittest.loader._FailedTest.tests.test_fakeys) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_fakeys 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_fakeys.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_fasta (unittest.loader._FailedTest.tests.test_fasta) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_fasta 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_fasta.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_fastq (unittest.loader._FailedTest.tests.test_fastq) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_fastq 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_fastq.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_fastx (unittest.loader._FailedTest.tests.test_fastx) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_fastx 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_fastx.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_fqkeys (unittest.loader._FailedTest.tests.test_fqkeys) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_fqkeys 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_fqkeys.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_read (unittest.loader._FailedTest.tests.test_read) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_read 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_read.py", line 4, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_sequence (unittest.loader._FailedTest.tests.test_sequence) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_sequence 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_sequence.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ====================================================================== 157s ERROR: tests.test_sequence_error (unittest.loader._FailedTest.tests.test_sequence_error) 157s ---------------------------------------------------------------------- 157s ImportError: Failed to import test module: tests.test_sequence_error 157s Traceback (most recent call last): 157s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 157s module = self._get_module_from_name(name) 157s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 157s __import__(name) 157s ~~~~~~~~~~^^^^^^ 157s File "/tmp/autopkgtest.2u5MfP/build.V6d/src/tests/test_sequence_error.py", line 3, in 157s import pyfastx 157s ModuleNotFoundError: No module named 'pyfastx' 157s 157s 157s ---------------------------------------------------------------------- 157s Ran 8 tests in 0.000s 157s 157s FAILED (errors=8) 157s autopkgtest [20:38:02]: test run-unit-test: -----------------------] 158s autopkgtest [20:38:03]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 158s run-unit-test FAIL non-zero exit status 1 158s autopkgtest [20:38:03]: test test-cli: preparing testbed 326s autopkgtest [20:40:51]: testbed dpkg architecture: s390x 326s autopkgtest [20:40:51]: testbed apt version: 2.9.8 326s autopkgtest [20:40:51]: @@@@@@@@@@@@@@@@@@@@ test bed setup 327s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 327s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [930 kB] 328s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [9704 B] 328s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [54.8 kB] 328s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [13.6 kB] 328s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x Packages [70.6 kB] 328s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/restricted s390x Packages [756 B] 328s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/universe s390x Packages [760 kB] 328s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse s390x Packages [6452 B] 328s Fetched 1920 kB in 1s (2491 kB/s) 328s Reading package lists... 330s Reading package lists... 330s Building dependency tree... 330s Reading state information... 330s Calculating upgrade... 330s The following package was automatically installed and is no longer required: 330s libsgutils2-1.46-2 330s Use 'sudo apt autoremove' to remove it. 330s The following NEW packages will be installed: 330s libsgutils2-1.48 330s The following packages will be upgraded: 330s bash bpftrace curl debconf debconf-i18n distro-info gir1.2-girepository-2.0 330s gir1.2-glib-2.0 hostname libaudit-common libaudit1 libcurl3t64-gnutls 330s libcurl4t64 libgirepository-1.0-1 libglib2.0-0t64 libglib2.0-data 330s libpam-modules libpam-modules-bin libpam-runtime libpam0g libplymouth5 330s libpython3-stdlib libselinux1 libsemanage-common libsemanage2 linux-base 330s lxd-installer openssh-client openssh-server openssh-sftp-server plymouth 330s plymouth-theme-ubuntu-text python3 python3-blinker python3-debconf 330s python3-jsonschema-specifications python3-minimal python3-rpds-py 330s python3-yaml sg3-utils sg3-utils-udev vim-common vim-tiny xxd 330s 44 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 330s Need to get 11.4 MB of archives. 330s After this operation, 2418 kB of additional disk space will be used. 330s Get:1 http://ftpmaster.internal/ubuntu plucky/main s390x bash s390x 5.2.32-1ubuntu2 [845 kB] 331s Get:2 http://ftpmaster.internal/ubuntu plucky/main s390x hostname s390x 3.25 [11.2 kB] 331s Get:3 http://ftpmaster.internal/ubuntu plucky/main s390x libaudit-common all 1:4.0.2-2ubuntu1 [6578 B] 331s Get:4 http://ftpmaster.internal/ubuntu plucky/main s390x libaudit1 s390x 1:4.0.2-2ubuntu1 [52.5 kB] 331s Get:5 http://ftpmaster.internal/ubuntu plucky/main s390x debconf-i18n all 1.5.87ubuntu1 [204 kB] 331s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3-minimal s390x 3.12.7-1 [27.4 kB] 331s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3 s390x 3.12.7-1 [24.0 kB] 331s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x libpython3-stdlib s390x 3.12.7-1 [10.0 kB] 331s Get:9 http://ftpmaster.internal/ubuntu plucky/main s390x python3-debconf all 1.5.87ubuntu1 [4156 B] 331s Get:10 http://ftpmaster.internal/ubuntu plucky/main s390x debconf all 1.5.87ubuntu1 [124 kB] 331s Get:11 http://ftpmaster.internal/ubuntu plucky/main s390x libpam0g s390x 1.5.3-7ubuntu4 [70.0 kB] 331s Get:12 http://ftpmaster.internal/ubuntu plucky/main s390x libselinux1 s390x 3.7-3ubuntu1 [85.2 kB] 331s Get:13 http://ftpmaster.internal/ubuntu plucky/main s390x libpam-modules-bin s390x 1.5.3-7ubuntu4 [56.2 kB] 331s Get:14 http://ftpmaster.internal/ubuntu plucky/main s390x libpam-modules s390x 1.5.3-7ubuntu4 [294 kB] 331s Get:15 http://ftpmaster.internal/ubuntu plucky/main s390x openssh-sftp-server s390x 1:9.9p1-3ubuntu2 [38.2 kB] 331s Get:16 http://ftpmaster.internal/ubuntu plucky/main s390x openssh-server s390x 1:9.9p1-3ubuntu2 [552 kB] 331s Get:17 http://ftpmaster.internal/ubuntu plucky/main s390x openssh-client s390x 1:9.9p1-3ubuntu2 [955 kB] 331s Get:18 http://ftpmaster.internal/ubuntu plucky/main s390x libpam-runtime all 1.5.3-7ubuntu4 [40.8 kB] 331s Get:19 http://ftpmaster.internal/ubuntu plucky/main s390x libsemanage-common all 3.7-2build1 [7186 B] 331s Get:20 http://ftpmaster.internal/ubuntu plucky/main s390x libsemanage2 s390x 3.7-2build1 [97.1 kB] 331s Get:21 http://ftpmaster.internal/ubuntu plucky/main s390x distro-info s390x 1.12 [20.0 kB] 331s Get:22 http://ftpmaster.internal/ubuntu plucky/main s390x gir1.2-girepository-2.0 s390x 1.82.0-2 [25.0 kB] 331s Get:23 http://ftpmaster.internal/ubuntu plucky/main s390x gir1.2-glib-2.0 s390x 2.82.2-3 [180 kB] 331s Get:24 http://ftpmaster.internal/ubuntu plucky/main s390x libglib2.0-0t64 s390x 2.82.2-3 [1575 kB] 331s Get:25 http://ftpmaster.internal/ubuntu plucky/main s390x libgirepository-1.0-1 s390x 1.82.0-2 [84.9 kB] 331s Get:26 http://ftpmaster.internal/ubuntu plucky/main s390x libglib2.0-data all 2.82.2-3 [51.7 kB] 331s Get:27 http://ftpmaster.internal/ubuntu plucky/main s390x python3-yaml s390x 6.0.2-1build1 [188 kB] 331s Get:28 http://ftpmaster.internal/ubuntu plucky/main s390x vim-tiny s390x 2:9.1.0861-1ubuntu1 [664 kB] 331s Get:29 http://ftpmaster.internal/ubuntu plucky/main s390x vim-common all 2:9.1.0861-1ubuntu1 [395 kB] 331s Get:30 http://ftpmaster.internal/ubuntu plucky/main s390x xxd s390x 2:9.1.0861-1ubuntu1 [66.6 kB] 331s Get:31 http://ftpmaster.internal/ubuntu plucky/main s390x libplymouth5 s390x 24.004.60-2ubuntu3 [150 kB] 331s Get:32 http://ftpmaster.internal/ubuntu plucky/main s390x plymouth-theme-ubuntu-text s390x 24.004.60-2ubuntu3 [10.1 kB] 331s Get:33 http://ftpmaster.internal/ubuntu plucky/main s390x plymouth s390x 24.004.60-2ubuntu3 [144 kB] 331s Get:34 http://ftpmaster.internal/ubuntu plucky/main s390x bpftrace s390x 0.21.2-2ubuntu3 [1718 kB] 331s Get:35 http://ftpmaster.internal/ubuntu plucky/main s390x curl s390x 8.9.1-2ubuntu3 [241 kB] 331s Get:36 http://ftpmaster.internal/ubuntu plucky/main s390x libcurl4t64 s390x 8.9.1-2ubuntu3 [386 kB] 331s Get:37 http://ftpmaster.internal/ubuntu plucky/main s390x libcurl3t64-gnutls s390x 8.9.1-2ubuntu3 [379 kB] 331s Get:38 http://ftpmaster.internal/ubuntu plucky/main s390x libsgutils2-1.48 s390x 1.48-0ubuntu1 [120 kB] 331s Get:39 http://ftpmaster.internal/ubuntu plucky/main s390x linux-base all 4.10.1ubuntu1 [34.8 kB] 331s Get:40 http://ftpmaster.internal/ubuntu plucky/main s390x lxd-installer all 10 [5264 B] 331s Get:41 http://ftpmaster.internal/ubuntu plucky/main s390x python3-blinker all 1.9.0-1 [10.7 kB] 331s Get:42 http://ftpmaster.internal/ubuntu plucky/main s390x python3-rpds-py s390x 0.21.0-2ubuntu1 [368 kB] 331s Get:43 http://ftpmaster.internal/ubuntu plucky/main s390x python3-jsonschema-specifications all 2023.12.1-2 [9116 B] 331s Get:44 http://ftpmaster.internal/ubuntu plucky/main s390x sg3-utils s390x 1.48-0ubuntu1 [1027 kB] 332s Get:45 http://ftpmaster.internal/ubuntu plucky/main s390x sg3-utils-udev all 1.48-0ubuntu1 [6608 B] 332s Preconfiguring packages ... 332s Fetched 11.4 MB in 1s (9827 kB/s) 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 332s Preparing to unpack .../bash_5.2.32-1ubuntu2_s390x.deb ... 332s Unpacking bash (5.2.32-1ubuntu2) over (5.2.32-1ubuntu1) ... 332s Setting up bash (5.2.32-1ubuntu2) ... 332s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 332s Preparing to unpack .../hostname_3.25_s390x.deb ... 332s Unpacking hostname (3.25) over (3.23+nmu2ubuntu2) ... 332s Setting up hostname (3.25) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 332s Preparing to unpack .../libaudit-common_1%3a4.0.2-2ubuntu1_all.deb ... 332s Unpacking libaudit-common (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 332s Setting up libaudit-common (1:4.0.2-2ubuntu1) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 332s Preparing to unpack .../libaudit1_1%3a4.0.2-2ubuntu1_s390x.deb ... 332s Unpacking libaudit1:s390x (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 332s Setting up libaudit1:s390x (1:4.0.2-2ubuntu1) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 332s Preparing to unpack .../debconf-i18n_1.5.87ubuntu1_all.deb ... 332s Unpacking debconf-i18n (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 332s Preparing to unpack .../python3-minimal_3.12.7-1_s390x.deb ... 332s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 332s Setting up python3-minimal (3.12.7-1) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 332s Preparing to unpack .../python3_3.12.7-1_s390x.deb ... 332s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 332s Preparing to unpack .../libpython3-stdlib_3.12.7-1_s390x.deb ... 332s Unpacking libpython3-stdlib:s390x (3.12.7-1) over (3.12.6-0ubuntu1) ... 332s Preparing to unpack .../python3-debconf_1.5.87ubuntu1_all.deb ... 333s Unpacking python3-debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 333s Preparing to unpack .../debconf_1.5.87ubuntu1_all.deb ... 333s Unpacking debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 333s Setting up debconf (1.5.87ubuntu1) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 333s Preparing to unpack .../libpam0g_1.5.3-7ubuntu4_s390x.deb ... 333s Unpacking libpam0g:s390x (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 333s Setting up libpam0g:s390x (1.5.3-7ubuntu4) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 333s Preparing to unpack .../libselinux1_3.7-3ubuntu1_s390x.deb ... 333s Unpacking libselinux1:s390x (3.7-3ubuntu1) over (3.5-2ubuntu5) ... 333s Setting up libselinux1:s390x (3.7-3ubuntu1) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 333s Preparing to unpack .../libpam-modules-bin_1.5.3-7ubuntu4_s390x.deb ... 333s Unpacking libpam-modules-bin (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 333s Setting up libpam-modules-bin (1.5.3-7ubuntu4) ... 333s pam_namespace.service is a disabled or a static unit not running, not starting it. 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 333s Preparing to unpack .../libpam-modules_1.5.3-7ubuntu4_s390x.deb ... 333s Unpacking libpam-modules:s390x (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 333s Setting up libpam-modules:s390x (1.5.3-7ubuntu4) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55541 files and directories currently installed.) 333s Preparing to unpack .../openssh-sftp-server_1%3a9.9p1-3ubuntu2_s390x.deb ... 333s Unpacking openssh-sftp-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 333s Preparing to unpack .../openssh-server_1%3a9.9p1-3ubuntu2_s390x.deb ... 333s Unpacking openssh-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 333s Preparing to unpack .../openssh-client_1%3a9.9p1-3ubuntu2_s390x.deb ... 333s Unpacking openssh-client (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 333s Preparing to unpack .../libpam-runtime_1.5.3-7ubuntu4_all.deb ... 333s Unpacking libpam-runtime (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 333s Setting up libpam-runtime (1.5.3-7ubuntu4) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55543 files and directories currently installed.) 333s Preparing to unpack .../libsemanage-common_3.7-2build1_all.deb ... 333s Unpacking libsemanage-common (3.7-2build1) over (3.5-1build6) ... 334s Setting up libsemanage-common (3.7-2build1) ... 334s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55542 files and directories currently installed.) 334s Preparing to unpack .../libsemanage2_3.7-2build1_s390x.deb ... 334s Unpacking libsemanage2:s390x (3.7-2build1) over (3.5-1build6) ... 334s Setting up libsemanage2:s390x (3.7-2build1) ... 334s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55542 files and directories currently installed.) 334s Preparing to unpack .../00-distro-info_1.12_s390x.deb ... 334s Unpacking distro-info (1.12) over (1.9) ... 334s Preparing to unpack .../01-gir1.2-girepository-2.0_1.82.0-2_s390x.deb ... 334s Unpacking gir1.2-girepository-2.0:s390x (1.82.0-2) over (1.80.1-4) ... 334s Preparing to unpack .../02-gir1.2-glib-2.0_2.82.2-3_s390x.deb ... 334s Unpacking gir1.2-glib-2.0:s390x (2.82.2-3) over (2.82.1-0ubuntu1) ... 334s Preparing to unpack .../03-libglib2.0-0t64_2.82.2-3_s390x.deb ... 334s Unpacking libglib2.0-0t64:s390x (2.82.2-3) over (2.82.1-0ubuntu1) ... 334s Preparing to unpack .../04-libgirepository-1.0-1_1.82.0-2_s390x.deb ... 334s Unpacking libgirepository-1.0-1:s390x (1.82.0-2) over (1.80.1-4) ... 334s Preparing to unpack .../05-libglib2.0-data_2.82.2-3_all.deb ... 334s Unpacking libglib2.0-data (2.82.2-3) over (2.82.1-0ubuntu1) ... 334s Preparing to unpack .../06-python3-yaml_6.0.2-1build1_s390x.deb ... 334s Unpacking python3-yaml (6.0.2-1build1) over (6.0.2-1) ... 334s Preparing to unpack .../07-vim-tiny_2%3a9.1.0861-1ubuntu1_s390x.deb ... 334s Unpacking vim-tiny (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 334s Preparing to unpack .../08-vim-common_2%3a9.1.0861-1ubuntu1_all.deb ... 334s Unpacking vim-common (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 334s Preparing to unpack .../09-xxd_2%3a9.1.0861-1ubuntu1_s390x.deb ... 334s Unpacking xxd (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 334s Preparing to unpack .../10-libplymouth5_24.004.60-2ubuntu3_s390x.deb ... 334s Unpacking libplymouth5:s390x (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 334s Preparing to unpack .../11-plymouth-theme-ubuntu-text_24.004.60-2ubuntu3_s390x.deb ... 334s Unpacking plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 334s Preparing to unpack .../12-plymouth_24.004.60-2ubuntu3_s390x.deb ... 334s Unpacking plymouth (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 334s Preparing to unpack .../13-bpftrace_0.21.2-2ubuntu3_s390x.deb ... 334s Unpacking bpftrace (0.21.2-2ubuntu3) over (0.21.2-2ubuntu2) ... 334s Preparing to unpack .../14-curl_8.9.1-2ubuntu3_s390x.deb ... 334s Unpacking curl (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 334s Preparing to unpack .../15-libcurl4t64_8.9.1-2ubuntu3_s390x.deb ... 334s Unpacking libcurl4t64:s390x (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 334s Preparing to unpack .../16-libcurl3t64-gnutls_8.9.1-2ubuntu3_s390x.deb ... 334s Unpacking libcurl3t64-gnutls:s390x (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 334s Selecting previously unselected package libsgutils2-1.48:s390x. 334s Preparing to unpack .../17-libsgutils2-1.48_1.48-0ubuntu1_s390x.deb ... 334s Unpacking libsgutils2-1.48:s390x (1.48-0ubuntu1) ... 334s Preparing to unpack .../18-linux-base_4.10.1ubuntu1_all.deb ... 334s Unpacking linux-base (4.10.1ubuntu1) over (4.5ubuntu9) ... 334s Preparing to unpack .../19-lxd-installer_10_all.deb ... 334s Unpacking lxd-installer (10) over (9) ... 334s Preparing to unpack .../20-python3-blinker_1.9.0-1_all.deb ... 334s Unpacking python3-blinker (1.9.0-1) over (1.8.2-1) ... 334s Preparing to unpack .../21-python3-rpds-py_0.21.0-2ubuntu1_s390x.deb ... 334s Unpacking python3-rpds-py (0.21.0-2ubuntu1) over (0.20.0-0ubuntu3) ... 334s Preparing to unpack .../22-python3-jsonschema-specifications_2023.12.1-2_all.deb ... 334s Unpacking python3-jsonschema-specifications (2023.12.1-2) over (2023.12.1-1ubuntu1) ... 334s Preparing to unpack .../23-sg3-utils_1.48-0ubuntu1_s390x.deb ... 334s Unpacking sg3-utils (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 334s Preparing to unpack .../24-sg3-utils-udev_1.48-0ubuntu1_all.deb ... 334s Unpacking sg3-utils-udev (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 334s Setting up distro-info (1.12) ... 334s Setting up linux-base (4.10.1ubuntu1) ... 334s Setting up libcurl4t64:s390x (8.9.1-2ubuntu3) ... 334s Setting up bpftrace (0.21.2-2ubuntu3) ... 334s Setting up openssh-client (1:9.9p1-3ubuntu2) ... 334s Setting up libcurl3t64-gnutls:s390x (8.9.1-2ubuntu3) ... 334s Setting up libsgutils2-1.48:s390x (1.48-0ubuntu1) ... 334s Setting up debconf-i18n (1.5.87ubuntu1) ... 334s Setting up xxd (2:9.1.0861-1ubuntu1) ... 334s Setting up libglib2.0-0t64:s390x (2.82.2-3) ... 334s No schema files found: doing nothing. 334s Setting up libglib2.0-data (2.82.2-3) ... 334s Setting up vim-common (2:9.1.0861-1ubuntu1) ... 334s Setting up gir1.2-glib-2.0:s390x (2.82.2-3) ... 334s Setting up lxd-installer (10) ... 335s Setting up libplymouth5:s390x (24.004.60-2ubuntu3) ... 335s Setting up libgirepository-1.0-1:s390x (1.82.0-2) ... 335s Setting up curl (8.9.1-2ubuntu3) ... 335s Setting up libpython3-stdlib:s390x (3.12.7-1) ... 335s Setting up sg3-utils (1.48-0ubuntu1) ... 335s Setting up openssh-sftp-server (1:9.9p1-3ubuntu2) ... 335s Setting up openssh-server (1:9.9p1-3ubuntu2) ... 335s Installing new version of config file /etc/ssh/moduli ... 335s Replacing config file /etc/ssh/sshd_config with new version 336s Setting up plymouth (24.004.60-2ubuntu3) ... 336s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 336s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 338s Using config file '/etc/zipl.conf' 338s Building bootmap in '/boot' 338s Adding IPL section 'ubuntu' (default) 338s Preparing boot device for LD-IPL: vda (0000). 338s Done. 338s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 338s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 338s Setting up python3 (3.12.7-1) ... 338s Setting up vim-tiny (2:9.1.0861-1ubuntu1) ... 338s Setting up sg3-utils-udev (1.48-0ubuntu1) ... 338s update-initramfs: deferring update (trigger activated) 338s Setting up plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) ... 338s update-initramfs: deferring update (trigger activated) 338s Setting up gir1.2-girepository-2.0:s390x (1.82.0-2) ... 338s Setting up python3-rpds-py (0.21.0-2ubuntu1) ... 339s Setting up python3-jsonschema-specifications (2023.12.1-2) ... 339s Setting up python3-blinker (1.9.0-1) ... 339s Setting up python3-debconf (1.5.87ubuntu1) ... 339s Setting up python3-yaml (6.0.2-1build1) ... 339s Processing triggers for man-db (2.13.0-1) ... 340s Processing triggers for debianutils (5.21) ... 340s Processing triggers for install-info (7.1.1-1) ... 340s Processing triggers for initramfs-tools (0.142ubuntu35) ... 340s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 340s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 342s Using config file '/etc/zipl.conf' 342s Building bootmap in '/boot' 342s Adding IPL section 'ubuntu' (default) 342s Preparing boot device for LD-IPL: vda (0000). 342s Done. 342s Processing triggers for libc-bin (2.40-1ubuntu3) ... 342s Processing triggers for ufw (0.36.2-8) ... 342s Reading package lists... 342s Building dependency tree... 342s Reading state information... 342s The following packages will be REMOVED: 342s libsgutils2-1.46-2* 343s 0 upgraded, 0 newly installed, 1 to remove and 0 not upgraded. 343s After this operation, 294 kB disk space will be freed. 343s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55573 files and directories currently installed.) 343s Removing libsgutils2-1.46-2:s390x (1.46-3ubuntu5) ... 343s Processing triggers for libc-bin (2.40-1ubuntu3) ... 343s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 343s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 343s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 343s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 344s Reading package lists... 344s Reading package lists... 344s Building dependency tree... 344s Reading state information... 344s Calculating upgrade... 344s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 344s Reading package lists... 345s Building dependency tree... 345s Reading state information... 345s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 345s autopkgtest [20:41:10]: rebooting testbed after setup commands that affected boot 349s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 367s Reading package lists... 367s Building dependency tree... 367s Reading state information... 368s Starting pkgProblemResolver with broken count: 0 368s Starting 2 pkgProblemResolver with broken count: 0 368s Done 368s The following additional packages will be installed: 368s pyfastx python3-importlib-metadata python3-packaging python3-pyfaidx 368s python3-pyfastx 368s Recommended packages: 368s python3-biopython 368s The following NEW packages will be installed: 368s autopkgtest-satdep pyfastx python3-importlib-metadata python3-packaging 368s python3-pyfaidx python3-pyfastx 368s 0 upgraded, 6 newly installed, 0 to remove and 0 not upgraded. 368s Need to get 282 kB/283 kB of archives. 368s After this operation, 823 kB of additional disk space will be used. 368s Get:1 /tmp/autopkgtest.2u5MfP/2-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [716 B] 368s Get:2 http://ftpmaster.internal/ubuntu plucky/main s390x python3-importlib-metadata all 8.5.0-1 [20.7 kB] 368s Get:3 http://ftpmaster.internal/ubuntu plucky/main s390x python3-packaging all 24.2-1 [51.5 kB] 368s Get:4 http://ftpmaster.internal/ubuntu plucky/universe s390x python3-pyfaidx all 0.8.1.3-1 [29.7 kB] 368s Get:5 http://ftpmaster.internal/ubuntu plucky/universe s390x python3-pyfastx s390x 2.1.0-2 [58.8 kB] 368s Get:6 http://ftpmaster.internal/ubuntu plucky/universe s390x pyfastx s390x 2.1.0-2 [122 kB] 369s Fetched 282 kB in 0s (588 kB/s) 369s Selecting previously unselected package python3-importlib-metadata. 369s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55568 files and directories currently installed.) 369s Preparing to unpack .../0-python3-importlib-metadata_8.5.0-1_all.deb ... 369s Unpacking python3-importlib-metadata (8.5.0-1) ... 369s Selecting previously unselected package python3-packaging. 369s Preparing to unpack .../1-python3-packaging_24.2-1_all.deb ... 369s Unpacking python3-packaging (24.2-1) ... 369s Selecting previously unselected package python3-pyfaidx. 369s Preparing to unpack .../2-python3-pyfaidx_0.8.1.3-1_all.deb ... 369s Unpacking python3-pyfaidx (0.8.1.3-1) ... 369s Selecting previously unselected package python3-pyfastx. 369s Preparing to unpack .../3-python3-pyfastx_2.1.0-2_s390x.deb ... 369s Unpacking python3-pyfastx (2.1.0-2) ... 369s Selecting previously unselected package pyfastx. 369s Preparing to unpack .../4-pyfastx_2.1.0-2_s390x.deb ... 369s Unpacking pyfastx (2.1.0-2) ... 369s Selecting previously unselected package autopkgtest-satdep. 369s Preparing to unpack .../5-2-autopkgtest-satdep.deb ... 369s Unpacking autopkgtest-satdep (0) ... 369s Setting up python3-importlib-metadata (8.5.0-1) ... 369s Setting up python3-packaging (24.2-1) ... 369s Setting up python3-pyfaidx (0.8.1.3-1) ... 369s Setting up python3-pyfastx (2.1.0-2) ... 369s Setting up pyfastx (2.1.0-2) ... 369s Setting up autopkgtest-satdep (0) ... 369s Processing triggers for man-db (2.13.0-1) ... 371s (Reading database ... 55668 files and directories currently installed.) 371s Removing autopkgtest-satdep (0) ... 373s autopkgtest [20:41:38]: test test-cli: [----------------------- 373s $ pyfastx --help 373s usage: pyfastx COMMAND [OPTIONS] 373s 373s A command line tool for FASTA/Q file manipulation 373s 373s options: 373s -h, --help show this help message and exit 373s -v, --version show program's version number and exit 373s 373s Commands: 373s 373s index build index for fasta/q file 373s stat show detailed statistics information of fasta/q file 373s split split fasta/q file into multiple files 373s fq2fa convert fastq file to fasta file 373s subseq get subsequences from fasta file by region 373s sample randomly sample sequences from fasta or fastq file 373s extract extract full sequences or reads from fasta/q file 373s $ # Found pyfastx commands: 'index stat split fq2fa subseq sample extract' 373s $ pyfastx index --help 373s usage: pyfastx index [-h] [-f] fastx [fastx ...] 373s 373s positional arguments: 373s fastx fasta or fastq file, gzip support 373s 373s options: 373s -h, --help show this help message and exit 373s -f, --full build full index, base composition will be calculated 373s $ pyfastx stat --help 373s usage: pyfastx stat [-h] fastx [fastx ...] 373s 373s positional arguments: 373s fastx fasta or fastq file, gzip support 373s 373s options: 373s -h, --help show this help message and exit 373s $ pyfastx split --help 373s usage: pyfastx split [-h] (-n int | -c int) [-o str] fastx 373s 373s positional arguments: 373s fastx fasta or fastq file, gzip support 373s 373s options: 373s -h, --help show this help message and exit 373s -n int split a fasta/q file into N new files with even size 373s -c int split a fasta/q file into multiple files containing 373s the same sequence counts 373s -o str, --out-dir str 373s output directory, default is current folder 373s $ pyfastx fq2fa --help 373s usage: pyfastx fq2fa [-h] [-o str] fastx 373s 373s positional arguments: 373s fastx fastq file, gzip support 373s 373s options: 373s -h, --help show this help message and exit 373s -o str, --out-file str 373s output file, default: output to stdout 373s $ pyfastx subseq --help 373s usage: pyfastx subseq [-h] [-r str | -b str] [-o str] fastx [region ...] 373s 373s positional arguments: 373s fastx input fasta file, gzip support 373s region format is chr:start-end, start and end position is 373s 1-based, multiple regions were separated by space 373s 373s options: 373s -h, --help show this help message and exit 373s -r str, --region-file str 373s tab-delimited file, one region per line, both start 373s and end position are 1-based 373s -b str, --bed-file str 373s tab-delimited BED file, 0-based start position and 373s 1-based end position 373s -o str, --out-file str 373s output file, default: output to stdout 373s $ pyfastx sample --help 373s usage: pyfastx sample [-h] (-n int | -p float) [-s int] [--sequential-read] 373s [-o str] 373s fastx 373s 373s positional arguments: 373s fastx fasta or fastq file, gzip support 373s 373s options: 373s -h, --help show this help message and exit 373s -n int number of sequences to be sampled 373s -p float proportion of sequences to be sampled, 0~1 373s -s int, --seed int random seed, default is the current system time 373s --sequential-read start sequential reading, particularly suitable for 373s sampling large numbers of sequences 373s -o str, --out-file str 373s output file, default: output to stdout 373s $ pyfastx extract --help 374s usage: pyfastx extract [-h] [-l str] [--reverse-complement] [--out-fasta] 374s [-o str] [--sequential-read] 374s fastx [name ...] 374s 374s positional arguments: 374s fastx fasta or fastq file, gzip support 374s name sequence name or read name, multiple names were 374s separated by space 374s 374s options: 374s -h, --help show this help message and exit 374s -l str, --list-file str 374s a file containing sequence or read names, one name per 374s line 374s --reverse-complement output reverse complement sequence 374s --out-fasta output fasta format when extract reads from fastq, 374s default output fastq format 374s -o str, --out-file str 374s output file, default: output to stdout 374s --sequential-read start sequential reading, particularly suitable for 374s extracting large numbers of sequences 374s $ pyfastx --version 374s pyfastx version 2.1.0 374s $ pyfastx index protein.fa 374s $ pyfastx index rna.fa 374s $ pyfastx index test.fa 374s $ pyfastx index test.fq 374s $ pyfastx index test.fa.gz 374s $ pyfastx index test.fq.gz 374s $ pyfastx stat protein.fa 374s fileName seqType seqCounts totalBases GC% avgLen medianLen maxLen minLen N50 L50 374s protein.fa protein 17 2265 - 133.235 80.0 419 23 263 4 374s $ pyfastx split -n 2 protein.fa 374s $ pyfastx fq2fa test.fq -o test.fa 374s $ pyfastx subseq protein.fa UPI0000000011:1-4 374s >UPI0000000011:1-4 374s MVDA 374s $ pyfastx sample -n 1 test.fq.gz -o sample.fq 374s $ pyfastx extract protein.fa UPI0000000011 375s >UPI0000000011 status=active 375s MVDAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIY 375s IPGTIILYATYVKSLLMKS 375s autopkgtest [20:41:40]: test test-cli: -----------------------] 375s test-cli PASS 375s autopkgtest [20:41:40]: test test-cli: - - - - - - - - - - results - - - - - - - - - - 376s autopkgtest [20:41:41]: @@@@@@@@@@@@@@@@@@@@ summary 376s run-unit-test FAIL non-zero exit status 1 376s test-cli PASS 387s virt: nova [W] Using flock in prodstack6-s390x 387s virt: flock: timeout while waiting to get lock 387s virt: Creating nova instance adt-plucky-s390x-pyfastx-20241123-203525-juju-7f2275-prod-proposed-migration-environment-2-21cc0129-1ff6-4532-987b-16d883910cf4 from image adt/ubuntu-plucky-s390x-server-20241119.img (UUID 0efe7a44-24e0-44d8-af6e-8997f14b87bd)... 387s virt: nova [W] Using flock in prodstack6-s390x 387s virt: Creating nova instance adt-plucky-s390x-pyfastx-20241123-203525-juju-7f2275-prod-proposed-migration-environment-2-21cc0129-1ff6-4532-987b-16d883910cf4 from image adt/ubuntu-plucky-s390x-server-20241119.img (UUID 0efe7a44-24e0-44d8-af6e-8997f14b87bd)...