0s autopkgtest [11:42:16]: starting date and time: 2024-11-13 11:42:16+0000 0s autopkgtest [11:42:16]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [11:42:16]: host juju-7f2275-prod-proposed-migration-environment-15; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.7j_tuh1m/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults,src:python3-stdlib-extensions --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 python3-stdlib-extensions/3.12.7-1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-s390x --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-15@bos03-s390x-10.secgroup --name adt-plucky-s390x-libedlib-20241113-114216-juju-7f2275-prod-proposed-migration-environment-15-3eba4c04-2a5e-4238-b9c5-e4964b8b1ffb --image adt/ubuntu-plucky-s390x-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-15 --net-id=net_prod-proposed-migration-s390x -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 98s autopkgtest [11:43:54]: testbed dpkg architecture: s390x 98s autopkgtest [11:43:54]: testbed apt version: 2.9.8 98s autopkgtest [11:43:54]: @@@@@@@@@@@@@@@@@@@@ test bed setup 99s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 99s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [76.4 kB] 99s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [849 kB] 99s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 99s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [15.3 kB] 99s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x Packages [85.8 kB] 99s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe s390x Packages [565 kB] 99s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse s390x Packages [16.6 kB] 99s Fetched 1689 kB in 1s (2315 kB/s) 99s Reading package lists... 101s Reading package lists... 101s Building dependency tree... 101s Reading state information... 101s Calculating upgrade... 102s The following NEW packages will be installed: 102s python3.13-gdbm 102s The following packages will be upgraded: 102s libgpgme11t64 libpython3-stdlib python3 python3-gdbm python3-minimal 102s 5 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 102s Need to get 252 kB of archives. 102s After this operation, 98.3 kB of additional disk space will be used. 102s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3-minimal s390x 3.12.7-1 [27.4 kB] 102s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3 s390x 3.12.7-1 [24.0 kB] 102s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x libpython3-stdlib s390x 3.12.7-1 [10.0 kB] 102s Get:4 http://ftpmaster.internal/ubuntu plucky/main s390x python3.13-gdbm s390x 3.13.0-2 [31.0 kB] 102s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/main s390x python3-gdbm s390x 3.12.7-1 [8642 B] 102s Get:6 http://ftpmaster.internal/ubuntu plucky/main s390x libgpgme11t64 s390x 1.23.2-5ubuntu4 [151 kB] 102s Fetched 252 kB in 0s (579 kB/s) 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55510 files and directories currently installed.) 102s Preparing to unpack .../python3-minimal_3.12.7-1_s390x.deb ... 102s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 102s Setting up python3-minimal (3.12.7-1) ... 103s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55510 files and directories currently installed.) 103s Preparing to unpack .../python3_3.12.7-1_s390x.deb ... 103s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 103s Preparing to unpack .../libpython3-stdlib_3.12.7-1_s390x.deb ... 103s Unpacking libpython3-stdlib:s390x (3.12.7-1) over (3.12.6-0ubuntu1) ... 103s Selecting previously unselected package python3.13-gdbm. 103s Preparing to unpack .../python3.13-gdbm_3.13.0-2_s390x.deb ... 103s Unpacking python3.13-gdbm (3.13.0-2) ... 103s Preparing to unpack .../python3-gdbm_3.12.7-1_s390x.deb ... 103s Unpacking python3-gdbm:s390x (3.12.7-1) over (3.12.6-1ubuntu1) ... 103s Preparing to unpack .../libgpgme11t64_1.23.2-5ubuntu4_s390x.deb ... 103s Unpacking libgpgme11t64:s390x (1.23.2-5ubuntu4) over (1.18.0-4.1ubuntu4) ... 103s Setting up libgpgme11t64:s390x (1.23.2-5ubuntu4) ... 103s Setting up python3.13-gdbm (3.13.0-2) ... 103s Setting up libpython3-stdlib:s390x (3.12.7-1) ... 103s Setting up python3 (3.12.7-1) ... 103s Setting up python3-gdbm:s390x (3.12.7-1) ... 103s Processing triggers for man-db (2.12.1-3) ... 103s Processing triggers for libc-bin (2.40-1ubuntu3) ... 104s Reading package lists... 104s Building dependency tree... 104s Reading state information... 104s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 104s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 104s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 104s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 104s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 105s Reading package lists... 105s Reading package lists... 105s Building dependency tree... 105s Reading state information... 105s Calculating upgrade... 106s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 106s Reading package lists... 106s Building dependency tree... 106s Reading state information... 106s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 108s autopkgtest [11:44:04]: testbed running kernel: Linux 6.11.0-8-generic #8-Ubuntu SMP Mon Sep 16 12:49:35 UTC 2024 108s autopkgtest [11:44:04]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 112s Get:1 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (dsc) [2389 B] 112s Get:2 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (tar) [4319 kB] 112s Get:3 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (diff) [7604 B] 112s gpgv: Signature made Sat Jul 13 18:52:01 2024 UTC 112s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 112s gpgv: issuer "emollier@debian.org" 112s gpgv: Can't check signature: No public key 112s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6.dsc: no acceptable signature found 112s autopkgtest [11:44:08]: testing package libedlib version 1.2.7-6 112s autopkgtest [11:44:08]: build not needed 113s autopkgtest [11:44:09]: test run-unit-test: preparing testbed 115s Reading package lists... 115s Building dependency tree... 115s Reading state information... 116s Starting pkgProblemResolver with broken count: 0 116s Starting 2 pkgProblemResolver with broken count: 0 116s Done 116s The following additional packages will be installed: 116s edlib-aligner libedlib-dev libedlib1 python3-edlib 116s The following NEW packages will be installed: 116s autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib 116s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 116s Need to get 163 kB/164 kB of archives. 116s After this operation, 439 kB of additional disk space will be used. 116s Get:1 /tmp/autopkgtest.hx4syV/1-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [728 B] 116s Get:2 http://ftpmaster.internal/ubuntu plucky/universe s390x libedlib1 s390x 1.2.7-6 [25.3 kB] 116s Get:3 http://ftpmaster.internal/ubuntu plucky/universe s390x edlib-aligner s390x 1.2.7-6 [31.9 kB] 116s Get:4 http://ftpmaster.internal/ubuntu plucky/universe s390x libedlib-dev s390x 1.2.7-6 [29.1 kB] 116s Get:5 http://ftpmaster.internal/ubuntu plucky/universe s390x python3-edlib s390x 1.2.7-6 [77.0 kB] 117s Fetched 163 kB in 0s (354 kB/s) 117s Selecting previously unselected package libedlib1:s390x. 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 55517 files and directories currently installed.) 117s Preparing to unpack .../libedlib1_1.2.7-6_s390x.deb ... 117s Unpacking libedlib1:s390x (1.2.7-6) ... 117s Selecting previously unselected package edlib-aligner. 117s Preparing to unpack .../edlib-aligner_1.2.7-6_s390x.deb ... 117s Unpacking edlib-aligner (1.2.7-6) ... 117s Selecting previously unselected package libedlib-dev:s390x. 117s Preparing to unpack .../libedlib-dev_1.2.7-6_s390x.deb ... 117s Unpacking libedlib-dev:s390x (1.2.7-6) ... 117s Selecting previously unselected package python3-edlib:s390x. 117s Preparing to unpack .../python3-edlib_1.2.7-6_s390x.deb ... 117s Unpacking python3-edlib:s390x (1.2.7-6) ... 117s Selecting previously unselected package autopkgtest-satdep. 117s Preparing to unpack .../1-autopkgtest-satdep.deb ... 117s Unpacking autopkgtest-satdep (0) ... 117s Setting up libedlib1:s390x (1.2.7-6) ... 117s Setting up python3-edlib:s390x (1.2.7-6) ... 117s Setting up edlib-aligner (1.2.7-6) ... 117s Setting up libedlib-dev:s390x (1.2.7-6) ... 117s Setting up autopkgtest-satdep (0) ... 117s Processing triggers for man-db (2.12.1-3) ... 117s Processing triggers for libc-bin (2.40-1ubuntu3) ... 119s (Reading database ... 55553 files and directories currently installed.) 119s Removing autopkgtest-satdep (0) ... 120s autopkgtest [11:44:16]: test run-unit-test: [----------------------- 120s Using NW alignment mode. 120s Reading queries... 120s Read 1 queries, 110 residues total. 120s Reading target fasta file... 120s Read target, 109 residues. 120s 120s Comparing queries to target... 120s 120s Query #0 (110 residues): score = 17 120s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 120s ||||||| | |||||||||| ||||||||||||||||||||||||||| 120s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 120s 120s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 120s | |||||||||||| || |||||||||| ||||||||| |||||| | 120s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 120s 120s T: AESIKSKKKKKE-STTB (93 - 108) 120s ||||||||||| ||| 120s Q: -ESIKSKKKKKENSTT- (94 - 109) 120s 120s 120s Cpu time of searching: 0.000055 120s autopkgtest [11:44:16]: test run-unit-test: -----------------------] 121s autopkgtest [11:44:17]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 121s run-unit-test PASS 122s autopkgtest [11:44:18]: @@@@@@@@@@@@@@@@@@@@ summary 122s run-unit-test PASS 133s nova [W] Using flock in prodstack6-s390x 133s Creating nova instance adt-plucky-s390x-libedlib-20241113-114216-juju-7f2275-prod-proposed-migration-environment-15-3eba4c04-2a5e-4238-b9c5-e4964b8b1ffb from image adt/ubuntu-plucky-s390x-server-20241113.img (UUID e740277e-1f72-40ae-bfbe-46030537c71c)...