0s autopkgtest [07:49:01]: starting date and time: 2024-11-24 07:49:01+0000 0s autopkgtest [07:49:01]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [07:49:01]: host juju-7f2275-prod-proposed-migration-environment-20; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.us9trt18/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:tm-align --apt-upgrade tm-align --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=tm-align/20190822+dfsg-3 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-ppc64el --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-20@bos03-ppc64el-30.secgroup --name adt-plucky-ppc64el-tm-align-20241124-072506-juju-7f2275-prod-proposed-migration-environment-20-72242cbe-b129-4d54-b0df-e6fbc7f8700e --image adt/ubuntu-plucky-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-20 --net-id=net_prod-proposed-migration-ppc64el -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 109s autopkgtest [07:50:50]: testbed dpkg architecture: ppc64el 109s autopkgtest [07:50:50]: testbed apt version: 2.9.8 109s autopkgtest [07:50:50]: @@@@@@@@@@@@@@@@@@@@ test bed setup 110s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 110s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [13.6 kB] 110s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [48.9 kB] 110s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [928 kB] 110s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [9704 B] 110s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el Packages [60.4 kB] 110s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/restricted ppc64el Packages [756 B] 110s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/universe ppc64el Packages [782 kB] 110s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse ppc64el Packages [9468 B] 111s Fetched 1927 kB in 1s (2058 kB/s) 111s Reading package lists... 113s Reading package lists... 113s Building dependency tree... 113s Reading state information... 114s Calculating upgrade... 114s The following package was automatically installed and is no longer required: 114s libsgutils2-1.46-2 114s Use 'sudo apt autoremove' to remove it. 114s The following NEW packages will be installed: 114s libsgutils2-1.48 114s The following packages will be upgraded: 114s bash bpftrace curl debconf debconf-i18n distro-info dracut-install 114s gir1.2-girepository-2.0 gir1.2-glib-2.0 hostname init init-system-helpers 114s libaudit-common libaudit1 libcurl3t64-gnutls libcurl4t64 114s libgirepository-1.0-1 libglib2.0-0t64 libglib2.0-data liblzma5 114s libpam-modules libpam-modules-bin libpam-runtime libpam0g libplymouth5 114s libselinux1 libsemanage-common libsemanage2 linux-base lsvpd lxd-installer 114s openssh-client openssh-server openssh-sftp-server pinentry-curses plymouth 114s plymouth-theme-ubuntu-text python3-blinker python3-dbus python3-debconf 114s python3-gi python3-jsonschema-specifications python3-rpds-py python3-yaml 114s sg3-utils sg3-utils-udev vim-common vim-tiny xxd xz-utils 114s 50 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 114s Need to get 14.1 MB of archives. 114s After this operation, 3452 kB of additional disk space will be used. 114s Get:1 http://ftpmaster.internal/ubuntu plucky/main ppc64el bash ppc64el 5.2.32-1ubuntu2 [979 kB] 115s Get:2 http://ftpmaster.internal/ubuntu plucky/main ppc64el hostname ppc64el 3.25 [11.3 kB] 115s Get:3 http://ftpmaster.internal/ubuntu plucky/main ppc64el init-system-helpers all 1.67ubuntu1 [39.1 kB] 115s Get:4 http://ftpmaster.internal/ubuntu plucky/main ppc64el libaudit-common all 1:4.0.2-2ubuntu1 [6578 B] 115s Get:5 http://ftpmaster.internal/ubuntu plucky/main ppc64el libaudit1 ppc64el 1:4.0.2-2ubuntu1 [59.6 kB] 115s Get:6 http://ftpmaster.internal/ubuntu plucky/main ppc64el debconf-i18n all 1.5.87ubuntu1 [204 kB] 115s Get:7 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-debconf all 1.5.87ubuntu1 [4156 B] 115s Get:8 http://ftpmaster.internal/ubuntu plucky/main ppc64el debconf all 1.5.87ubuntu1 [124 kB] 115s Get:9 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam0g ppc64el 1.5.3-7ubuntu4 [76.2 kB] 115s Get:10 http://ftpmaster.internal/ubuntu plucky/main ppc64el libselinux1 ppc64el 3.7-3ubuntu1 [100 kB] 115s Get:11 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-modules-bin ppc64el 1.5.3-7ubuntu4 [57.6 kB] 115s Get:12 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-modules ppc64el 1.5.3-7ubuntu4 [325 kB] 115s Get:13 http://ftpmaster.internal/ubuntu plucky/main ppc64el init ppc64el 1.67ubuntu1 [6432 B] 115s Get:14 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-sftp-server ppc64el 1:9.9p1-3ubuntu2 [43.4 kB] 115s Get:15 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-server ppc64el 1:9.9p1-3ubuntu2 [680 kB] 115s Get:16 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-client ppc64el 1:9.9p1-3ubuntu2 [1169 kB] 115s Get:17 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-runtime all 1.5.3-7ubuntu4 [40.8 kB] 115s Get:18 http://ftpmaster.internal/ubuntu plucky/main ppc64el liblzma5 ppc64el 5.6.3-1 [172 kB] 115s Get:19 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsemanage-common all 3.7-2build1 [7186 B] 115s Get:20 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsemanage2 ppc64el 3.7-2build1 [115 kB] 115s Get:21 http://ftpmaster.internal/ubuntu plucky/main ppc64el distro-info ppc64el 1.12 [20.0 kB] 115s Get:22 http://ftpmaster.internal/ubuntu plucky/main ppc64el gir1.2-girepository-2.0 ppc64el 1.82.0-2 [25.3 kB] 115s Get:23 http://ftpmaster.internal/ubuntu plucky/main ppc64el gir1.2-glib-2.0 ppc64el 2.82.2-3 [182 kB] 115s Get:24 http://ftpmaster.internal/ubuntu plucky/main ppc64el libglib2.0-0t64 ppc64el 2.82.2-3 [1787 kB] 115s Get:25 http://ftpmaster.internal/ubuntu plucky/main ppc64el libgirepository-1.0-1 ppc64el 1.82.0-2 [95.5 kB] 115s Get:26 http://ftpmaster.internal/ubuntu plucky/main ppc64el libglib2.0-data all 2.82.2-3 [51.7 kB] 115s Get:27 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-dbus ppc64el 1.3.2-5build4 [117 kB] 115s Get:28 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-gi ppc64el 3.50.0-3build1 [308 kB] 115s Get:29 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-yaml ppc64el 6.0.2-1build1 [180 kB] 115s Get:30 http://ftpmaster.internal/ubuntu plucky/main ppc64el vim-tiny ppc64el 2:9.1.0861-1ubuntu1 [1078 kB] 115s Get:31 http://ftpmaster.internal/ubuntu plucky/main ppc64el vim-common all 2:9.1.0861-1ubuntu1 [395 kB] 115s Get:32 http://ftpmaster.internal/ubuntu plucky/main ppc64el xxd ppc64el 2:9.1.0861-1ubuntu1 [67.9 kB] 115s Get:33 http://ftpmaster.internal/ubuntu plucky/main ppc64el libplymouth5 ppc64el 24.004.60-2ubuntu3 [169 kB] 115s Get:34 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsgutils2-1.48 ppc64el 1.48-0ubuntu1 [133 kB] 115s Get:35 http://ftpmaster.internal/ubuntu plucky/main ppc64el lsvpd ppc64el 1.7.14-1ubuntu3 [162 kB] 115s Get:36 http://ftpmaster.internal/ubuntu plucky/main ppc64el plymouth-theme-ubuntu-text ppc64el 24.004.60-2ubuntu3 [11.1 kB] 115s Get:37 http://ftpmaster.internal/ubuntu plucky/main ppc64el plymouth ppc64el 24.004.60-2ubuntu3 [152 kB] 115s Get:38 http://ftpmaster.internal/ubuntu plucky/main ppc64el xz-utils ppc64el 5.6.3-1 [280 kB] 115s Get:39 http://ftpmaster.internal/ubuntu plucky/main ppc64el bpftrace ppc64el 0.21.2-2ubuntu3 [1898 kB] 115s Get:40 http://ftpmaster.internal/ubuntu plucky/main ppc64el curl ppc64el 8.11.0-1ubuntu2 [256 kB] 115s Get:41 http://ftpmaster.internal/ubuntu plucky/main ppc64el libcurl4t64 ppc64el 8.11.0-1ubuntu2 [476 kB] 115s Get:42 http://ftpmaster.internal/ubuntu plucky/main ppc64el dracut-install ppc64el 105-2ubuntu2 [38.5 kB] 115s Get:43 http://ftpmaster.internal/ubuntu plucky/main ppc64el libcurl3t64-gnutls ppc64el 8.11.0-1ubuntu2 [474 kB] 115s Get:44 http://ftpmaster.internal/ubuntu plucky/main ppc64el linux-base all 4.10.1ubuntu1 [34.8 kB] 115s Get:45 http://ftpmaster.internal/ubuntu plucky/main ppc64el lxd-installer all 10 [5264 B] 115s Get:46 http://ftpmaster.internal/ubuntu plucky/main ppc64el pinentry-curses ppc64el 1.3.1-0ubuntu2 [43.5 kB] 115s Get:47 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-blinker all 1.9.0-1 [10.7 kB] 115s Get:48 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-rpds-py ppc64el 0.21.0-2ubuntu1 [338 kB] 115s Get:49 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-jsonschema-specifications all 2023.12.1-2 [9116 B] 116s Get:50 http://ftpmaster.internal/ubuntu plucky/main ppc64el sg3-utils ppc64el 1.48-0ubuntu1 [1070 kB] 116s Get:51 http://ftpmaster.internal/ubuntu plucky/main ppc64el sg3-utils-udev all 1.48-0ubuntu1 [6608 B] 116s Preconfiguring packages ... 117s Fetched 14.1 MB in 2s (6296 kB/s) 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 117s Preparing to unpack .../bash_5.2.32-1ubuntu2_ppc64el.deb ... 117s Unpacking bash (5.2.32-1ubuntu2) over (5.2.32-1ubuntu1) ... 117s Setting up bash (5.2.32-1ubuntu2) ... 117s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 117s Preparing to unpack .../hostname_3.25_ppc64el.deb ... 117s Unpacking hostname (3.25) over (3.23+nmu2ubuntu2) ... 117s Setting up hostname (3.25) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 117s Preparing to unpack .../init-system-helpers_1.67ubuntu1_all.deb ... 117s Unpacking init-system-helpers (1.67ubuntu1) over (1.66ubuntu1) ... 117s Setting up init-system-helpers (1.67ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 117s Preparing to unpack .../libaudit-common_1%3a4.0.2-2ubuntu1_all.deb ... 117s Unpacking libaudit-common (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 117s Setting up libaudit-common (1:4.0.2-2ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 117s Preparing to unpack .../libaudit1_1%3a4.0.2-2ubuntu1_ppc64el.deb ... 117s Unpacking libaudit1:ppc64el (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 117s Setting up libaudit1:ppc64el (1:4.0.2-2ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 117s Preparing to unpack .../debconf-i18n_1.5.87ubuntu1_all.deb ... 117s Unpacking debconf-i18n (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 117s Preparing to unpack .../python3-debconf_1.5.87ubuntu1_all.deb ... 118s Unpacking python3-debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 118s Preparing to unpack .../debconf_1.5.87ubuntu1_all.deb ... 118s Unpacking debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 118s Setting up debconf (1.5.87ubuntu1) ... 118s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 118s Preparing to unpack .../libpam0g_1.5.3-7ubuntu4_ppc64el.deb ... 118s Unpacking libpam0g:ppc64el (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 118s Setting up libpam0g:ppc64el (1.5.3-7ubuntu4) ... 118s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 118s Preparing to unpack .../libselinux1_3.7-3ubuntu1_ppc64el.deb ... 118s Unpacking libselinux1:ppc64el (3.7-3ubuntu1) over (3.5-2ubuntu5) ... 118s Setting up libselinux1:ppc64el (3.7-3ubuntu1) ... 118s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 118s Preparing to unpack .../libpam-modules-bin_1.5.3-7ubuntu4_ppc64el.deb ... 118s Unpacking libpam-modules-bin (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 118s Setting up libpam-modules-bin (1.5.3-7ubuntu4) ... 118s pam_namespace.service is a disabled or a static unit not running, not starting it. 118s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 118s Preparing to unpack .../libpam-modules_1.5.3-7ubuntu4_ppc64el.deb ... 119s Unpacking libpam-modules:ppc64el (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 119s Setting up libpam-modules:ppc64el (1.5.3-7ubuntu4) ... 119s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 119s Preparing to unpack .../init_1.67ubuntu1_ppc64el.deb ... 119s Unpacking init (1.67ubuntu1) over (1.66ubuntu1) ... 119s Preparing to unpack .../openssh-sftp-server_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 119s Unpacking openssh-sftp-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 119s Preparing to unpack .../openssh-server_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 119s Unpacking openssh-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 119s Preparing to unpack .../openssh-client_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 119s Unpacking openssh-client (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 119s Preparing to unpack .../libpam-runtime_1.5.3-7ubuntu4_all.deb ... 119s Unpacking libpam-runtime (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 119s Setting up libpam-runtime (1.5.3-7ubuntu4) ... 119s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73849 files and directories currently installed.) 119s Preparing to unpack .../liblzma5_5.6.3-1_ppc64el.deb ... 119s Unpacking liblzma5:ppc64el (5.6.3-1) over (5.6.2-2) ... 119s Setting up liblzma5:ppc64el (5.6.3-1) ... 119s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73849 files and directories currently installed.) 119s Preparing to unpack .../libsemanage-common_3.7-2build1_all.deb ... 119s Unpacking libsemanage-common (3.7-2build1) over (3.5-1build6) ... 119s Setting up libsemanage-common (3.7-2build1) ... 119s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73848 files and directories currently installed.) 119s Preparing to unpack .../libsemanage2_3.7-2build1_ppc64el.deb ... 119s Unpacking libsemanage2:ppc64el (3.7-2build1) over (3.5-1build6) ... 119s Setting up libsemanage2:ppc64el (3.7-2build1) ... 119s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73848 files and directories currently installed.) 119s Preparing to unpack .../00-distro-info_1.12_ppc64el.deb ... 119s Unpacking distro-info (1.12) over (1.9) ... 119s Preparing to unpack .../01-gir1.2-girepository-2.0_1.82.0-2_ppc64el.deb ... 119s Unpacking gir1.2-girepository-2.0:ppc64el (1.82.0-2) over (1.80.1-4) ... 119s Preparing to unpack .../02-gir1.2-glib-2.0_2.82.2-3_ppc64el.deb ... 119s Unpacking gir1.2-glib-2.0:ppc64el (2.82.2-3) over (2.82.1-0ubuntu1) ... 119s Preparing to unpack .../03-libglib2.0-0t64_2.82.2-3_ppc64el.deb ... 119s Unpacking libglib2.0-0t64:ppc64el (2.82.2-3) over (2.82.1-0ubuntu1) ... 119s Preparing to unpack .../04-libgirepository-1.0-1_1.82.0-2_ppc64el.deb ... 119s Unpacking libgirepository-1.0-1:ppc64el (1.82.0-2) over (1.80.1-4) ... 119s Preparing to unpack .../05-libglib2.0-data_2.82.2-3_all.deb ... 119s Unpacking libglib2.0-data (2.82.2-3) over (2.82.1-0ubuntu1) ... 119s Preparing to unpack .../06-python3-dbus_1.3.2-5build4_ppc64el.deb ... 120s Unpacking python3-dbus (1.3.2-5build4) over (1.3.2-5build3) ... 120s Preparing to unpack .../07-python3-gi_3.50.0-3build1_ppc64el.deb ... 120s Unpacking python3-gi (3.50.0-3build1) over (3.50.0-3) ... 120s Preparing to unpack .../08-python3-yaml_6.0.2-1build1_ppc64el.deb ... 120s Unpacking python3-yaml (6.0.2-1build1) over (6.0.2-1) ... 120s Preparing to unpack .../09-vim-tiny_2%3a9.1.0861-1ubuntu1_ppc64el.deb ... 120s Unpacking vim-tiny (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 120s Preparing to unpack .../10-vim-common_2%3a9.1.0861-1ubuntu1_all.deb ... 120s Unpacking vim-common (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 120s Preparing to unpack .../11-xxd_2%3a9.1.0861-1ubuntu1_ppc64el.deb ... 120s Unpacking xxd (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 120s Preparing to unpack .../12-libplymouth5_24.004.60-2ubuntu3_ppc64el.deb ... 120s Unpacking libplymouth5:ppc64el (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 120s Selecting previously unselected package libsgutils2-1.48:ppc64el. 120s Preparing to unpack .../13-libsgutils2-1.48_1.48-0ubuntu1_ppc64el.deb ... 120s Unpacking libsgutils2-1.48:ppc64el (1.48-0ubuntu1) ... 120s Preparing to unpack .../14-lsvpd_1.7.14-1ubuntu3_ppc64el.deb ... 120s Unpacking lsvpd (1.7.14-1ubuntu3) over (1.7.14-1ubuntu2) ... 120s Preparing to unpack .../15-plymouth-theme-ubuntu-text_24.004.60-2ubuntu3_ppc64el.deb ... 120s Unpacking plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 120s Preparing to unpack .../16-plymouth_24.004.60-2ubuntu3_ppc64el.deb ... 120s Unpacking plymouth (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 120s Preparing to unpack .../17-xz-utils_5.6.3-1_ppc64el.deb ... 120s Unpacking xz-utils (5.6.3-1) over (5.6.2-2) ... 120s Preparing to unpack .../18-bpftrace_0.21.2-2ubuntu3_ppc64el.deb ... 120s Unpacking bpftrace (0.21.2-2ubuntu3) over (0.21.2-2ubuntu2) ... 120s Preparing to unpack .../19-curl_8.11.0-1ubuntu2_ppc64el.deb ... 120s Unpacking curl (8.11.0-1ubuntu2) over (8.9.1-2ubuntu2) ... 120s Preparing to unpack .../20-libcurl4t64_8.11.0-1ubuntu2_ppc64el.deb ... 120s Unpacking libcurl4t64:ppc64el (8.11.0-1ubuntu2) over (8.9.1-2ubuntu2) ... 120s Preparing to unpack .../21-dracut-install_105-2ubuntu2_ppc64el.deb ... 120s Unpacking dracut-install (105-2ubuntu2) over (105-1ubuntu1) ... 120s Preparing to unpack .../22-libcurl3t64-gnutls_8.11.0-1ubuntu2_ppc64el.deb ... 120s Unpacking libcurl3t64-gnutls:ppc64el (8.11.0-1ubuntu2) over (8.9.1-2ubuntu2) ... 120s Preparing to unpack .../23-linux-base_4.10.1ubuntu1_all.deb ... 120s Unpacking linux-base (4.10.1ubuntu1) over (4.5ubuntu9) ... 120s Preparing to unpack .../24-lxd-installer_10_all.deb ... 120s Unpacking lxd-installer (10) over (9) ... 120s Preparing to unpack .../25-pinentry-curses_1.3.1-0ubuntu2_ppc64el.deb ... 120s Unpacking pinentry-curses (1.3.1-0ubuntu2) over (1.2.1-3ubuntu5) ... 120s Preparing to unpack .../26-python3-blinker_1.9.0-1_all.deb ... 120s Unpacking python3-blinker (1.9.0-1) over (1.8.2-1) ... 120s Preparing to unpack .../27-python3-rpds-py_0.21.0-2ubuntu1_ppc64el.deb ... 121s Unpacking python3-rpds-py (0.21.0-2ubuntu1) over (0.20.0-0ubuntu3) ... 121s Preparing to unpack .../28-python3-jsonschema-specifications_2023.12.1-2_all.deb ... 121s Unpacking python3-jsonschema-specifications (2023.12.1-2) over (2023.12.1-1ubuntu1) ... 121s Preparing to unpack .../29-sg3-utils_1.48-0ubuntu1_ppc64el.deb ... 121s Unpacking sg3-utils (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 121s Preparing to unpack .../30-sg3-utils-udev_1.48-0ubuntu1_all.deb ... 121s Unpacking sg3-utils-udev (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 121s Setting up pinentry-curses (1.3.1-0ubuntu2) ... 121s Setting up distro-info (1.12) ... 121s Setting up linux-base (4.10.1ubuntu1) ... 121s Setting up init (1.67ubuntu1) ... 121s Setting up libcurl4t64:ppc64el (8.11.0-1ubuntu2) ... 121s Setting up bpftrace (0.21.2-2ubuntu3) ... 121s Setting up openssh-client (1:9.9p1-3ubuntu2) ... 121s Setting up python3-debconf (1.5.87ubuntu1) ... 121s Setting up libcurl3t64-gnutls:ppc64el (8.11.0-1ubuntu2) ... 121s Setting up libsgutils2-1.48:ppc64el (1.48-0ubuntu1) ... 121s Setting up python3-yaml (6.0.2-1build1) ... 121s Setting up debconf-i18n (1.5.87ubuntu1) ... 121s Setting up xxd (2:9.1.0861-1ubuntu1) ... 121s Setting up libglib2.0-0t64:ppc64el (2.82.2-3) ... 121s No schema files found: doing nothing. 121s Setting up libglib2.0-data (2.82.2-3) ... 121s Setting up vim-common (2:9.1.0861-1ubuntu1) ... 121s Setting up xz-utils (5.6.3-1) ... 121s Setting up gir1.2-glib-2.0:ppc64el (2.82.2-3) ... 121s Setting up lxd-installer (10) ... 122s Setting up python3-rpds-py (0.21.0-2ubuntu1) ... 122s Setting up dracut-install (105-2ubuntu2) ... 122s Setting up libplymouth5:ppc64el (24.004.60-2ubuntu3) ... 122s Setting up libgirepository-1.0-1:ppc64el (1.82.0-2) ... 122s Setting up curl (8.11.0-1ubuntu2) ... 122s Setting up python3-jsonschema-specifications (2023.12.1-2) ... 122s Setting up sg3-utils (1.48-0ubuntu1) ... 122s Setting up python3-blinker (1.9.0-1) ... 122s Setting up openssh-sftp-server (1:9.9p1-3ubuntu2) ... 122s Setting up python3-dbus (1.3.2-5build4) ... 122s Setting up openssh-server (1:9.9p1-3ubuntu2) ... 122s Installing new version of config file /etc/ssh/moduli ... 122s Replacing config file /etc/ssh/sshd_config with new version 123s Setting up plymouth (24.004.60-2ubuntu3) ... 123s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 123s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 131s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 131s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 131s Setting up lsvpd (1.7.14-1ubuntu3) ... 131s Setting up vim-tiny (2:9.1.0861-1ubuntu1) ... 131s Setting up sg3-utils-udev (1.48-0ubuntu1) ... 131s update-initramfs: deferring update (trigger activated) 131s Setting up plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) ... 132s update-initramfs: deferring update (trigger activated) 132s Setting up gir1.2-girepository-2.0:ppc64el (1.82.0-2) ... 132s Setting up python3-gi (3.50.0-3build1) ... 132s Processing triggers for install-info (7.1.1-1) ... 132s Processing triggers for initramfs-tools (0.142ubuntu35) ... 132s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 132s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 138s Processing triggers for libc-bin (2.40-1ubuntu3) ... 138s Processing triggers for ufw (0.36.2-8) ... 138s Processing triggers for man-db (2.13.0-1) ... 140s Processing triggers for debianutils (5.21) ... 141s Reading package lists... 141s Building dependency tree... 141s Reading state information... 141s The following packages will be REMOVED: 141s libsgutils2-1.46-2* 141s 0 upgraded, 0 newly installed, 1 to remove and 0 not upgraded. 141s After this operation, 380 kB disk space will be freed. 141s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73881 files and directories currently installed.) 141s Removing libsgutils2-1.46-2:ppc64el (1.46-3ubuntu5) ... 141s Processing triggers for libc-bin (2.40-1ubuntu3) ... 142s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 142s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 142s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 142s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 143s Reading package lists... 143s Reading package lists... 143s Building dependency tree... 143s Reading state information... 144s Calculating upgrade... 144s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 144s Reading package lists... 144s Building dependency tree... 144s Reading state information... 144s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 144s autopkgtest [07:51:25]: rebooting testbed after setup commands that affected boot 178s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 183s autopkgtest [07:52:04]: testbed running kernel: Linux 6.11.0-8-generic #8-Ubuntu SMP Mon Sep 16 13:49:23 UTC 2024 186s autopkgtest [07:52:07]: @@@@@@@@@@@@@@@@@@@@ apt-source tm-align 188s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed/universe tm-align 20190822+dfsg-3 (dsc) [2077 B] 188s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/universe tm-align 20190822+dfsg-3 (tar) [52.8 kB] 188s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/universe tm-align 20190822+dfsg-3 (diff) [818 kB] 188s gpgv: Signature made Mon Sep 16 11:21:36 2024 UTC 188s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 188s gpgv: issuer "tille@debian.org" 188s gpgv: Can't check signature: No public key 188s dpkg-source: warning: cannot verify inline signature for ./tm-align_20190822+dfsg-3.dsc: no acceptable signature found 188s autopkgtest [07:52:09]: testing package tm-align version 20190822+dfsg-3 189s autopkgtest [07:52:10]: build not needed 189s autopkgtest [07:52:10]: test run-unit-test: preparing testbed 192s Reading package lists... 192s Building dependency tree... 192s Reading state information... 192s Starting pkgProblemResolver with broken count: 0 192s Starting 2 pkgProblemResolver with broken count: 0 192s Done 192s The following additional packages will be installed: 192s libgfortran5 tm-align 192s Suggested packages: 192s pymol rasmol 192s The following NEW packages will be installed: 192s autopkgtest-satdep libgfortran5 tm-align 192s 0 upgraded, 3 newly installed, 0 to remove and 0 not upgraded. 192s Need to get 1464 kB/1465 kB of archives. 192s After this operation, 3633 kB of additional disk space will be used. 192s Get:1 /tmp/autopkgtest.awhCG9/1-autopkgtest-satdep.deb autopkgtest-satdep ppc64el 0 [708 B] 193s Get:2 http://ftpmaster.internal/ubuntu plucky/main ppc64el libgfortran5 ppc64el 14.2.0-8ubuntu1 [571 kB] 193s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/universe ppc64el tm-align ppc64el 20190822+dfsg-3 [893 kB] 193s Fetched 1464 kB in 1s (2343 kB/s) 193s Selecting previously unselected package libgfortran5:ppc64el. 194s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73876 files and directories currently installed.) 194s Preparing to unpack .../libgfortran5_14.2.0-8ubuntu1_ppc64el.deb ... 194s Unpacking libgfortran5:ppc64el (14.2.0-8ubuntu1) ... 194s Selecting previously unselected package tm-align. 194s Preparing to unpack .../tm-align_20190822+dfsg-3_ppc64el.deb ... 194s Unpacking tm-align (20190822+dfsg-3) ... 194s Selecting previously unselected package autopkgtest-satdep. 194s Preparing to unpack .../1-autopkgtest-satdep.deb ... 194s Unpacking autopkgtest-satdep (0) ... 194s Setting up libgfortran5:ppc64el (14.2.0-8ubuntu1) ... 194s Setting up tm-align (20190822+dfsg-3) ... 194s Setting up autopkgtest-satdep (0) ... 194s Processing triggers for man-db (2.13.0-1) ... 194s Processing triggers for libc-bin (2.40-1ubuntu3) ... 197s (Reading database ... 73892 files and directories currently installed.) 197s Removing autopkgtest-satdep (0) ... 197s autopkgtest [07:52:18]: test run-unit-test: [----------------------- 197s Run TMalign... 198s 198s ************************************************************************** 198s * TM-align (Version 20190822) * 198s * An algorithm for protein structure alignment and comparison * 198s * Based on statistics: * 198s * 0.0 < TM-score < 0.30, random structural similarity * 198s * 0.5 < TM-score < 1.00, in about the same fold * 198s * Reference: Y Zhang and J Skolnick, Nucl Acids Res 33, 2302-9 (2005) * 198s * Please email your comments and suggestions to: zhng@umich.edu * 198s ************************************************************************** 198s 198s Name of Chain_1: 1ni7.pdb 198s Name of Chain_2: 5eep.pdb 198s Length of Chain_1: 149 residues 198s Length of Chain_2: 140 residues 198s 198s Aligned length= 140, RMSD= 1.60, Seq_ID=n_identical/n_aligned= 0.986 198s TM-score= 0.85044 (if normalized by length of Chain_1) 198s TM-score= 0.90009 (if normalized by length of Chain_2) 198s (You should use TM-score normalized by length of the reference protein) 198s 198s (":" denotes aligned residue pairs of d < 5.0 A, "." denotes other aligned residues) 198s MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE 198s : ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 198s ------G-HPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV-- 198s 198s Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 198s Run TMscore... 198s 198s ***************************************************************************** 198s * TM-SCORE * 198s * A scoring function to assess the similarity of protein structures * 198s * Based on statistics: * 198s * 0.0 < TM-score < 0.17, random structural similarity * 198s * 0.5 < TM-score < 1.00, in about the same fold * 198s * Reference: Yang Zhang and Jeffrey Skolnick, Proteins 2004 57: 702-710 * 198s * For comments, please email to: zhng@umich.edu * 198s ***************************************************************************** 198s 198s Structure1: 1ni7.pdb Length= 149 198s Structure2: 5eep.pdb Length= 140 (by which all scores are normalized) 198s Number of residues in common= 140 198s RMSD of the common residues= 1.616 198s 198s TM-score = 0.8987 (d0= 4.40) 198s MaxSub-score= 0.8459 (d0= 3.50) 198s GDT-TS-score= 0.8321 %(d<1)=0.4786 %(d<2)=0.8571 %(d<4)=0.9929 %(d<8)=1.0000 198s GDT-HA-score= 0.6214 %(d<0.5)=0.1571 %(d<1)=0.4786 %(d<2)=0.8571 %(d<4)=0.9929 198s 198s -------- rotation matrix to rotate Chain-1 to Chain-2 ------ 198s i t(i) u(i,1) u(i,2) u(i,3) 198s 1 0.9977278941 -0.2584957318 -0.9156232244 -0.3079189302 198s 2 13.5083713477 -0.8848339137 0.0965207762 0.4557989522 198s 3 45.5856492856 -0.3876195322 0.3902791958 -0.8351246898 198s 198s Superposition in the TM-score: Length(d<5.0)=140 RMSD= 1.62 198s (":" denotes the residue pairs of distance < 5.0 Angstrom) 198s MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE 198s :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 198s -------GHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV-- 198s 12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789 198s 198s autopkgtest [07:52:19]: test run-unit-test: -----------------------] 198s autopkgtest [07:52:19]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 198s run-unit-test FAIL stderr: Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 199s autopkgtest [07:52:20]: test run-unit-test: - - - - - - - - - - stderr - - - - - - - - - - 199s Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 199s autopkgtest [07:52:20]: @@@@@@@@@@@@@@@@@@@@ summary 199s run-unit-test FAIL stderr: Note: The following floating-point exceptions are signalling: IEEE_INVALID_FLAG 210s nova [W] Using flock in prodstack6-ppc64el 210s Creating nova instance adt-plucky-ppc64el-tm-align-20241124-072506-juju-7f2275-prod-proposed-migration-environment-20-72242cbe-b129-4d54-b0df-e6fbc7f8700e from image adt/ubuntu-plucky-ppc64el-server-20241119.img (UUID dcc6a44c-21fb-45bb-821a-d64a8784c175)...