0s autopkgtest [23:23:21]: starting date and time: 2024-11-23 23:23:21+0000 0s autopkgtest [23:23:21]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [23:23:21]: host juju-7f2275-prod-proposed-migration-environment-15; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.0z2hwv33/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults --apt-upgrade pyfastx --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-ppc64el --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-15@bos03-ppc64el-10.secgroup --name adt-plucky-ppc64el-pyfastx-20241123-224623-juju-7f2275-prod-proposed-migration-environment-15-2b813c41-122b-4b6d-9d8d-a177a6881390 --image adt/ubuntu-plucky-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-15 --net-id=net_prod-proposed-migration-ppc64el -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 112s autopkgtest [23:25:13]: testbed dpkg architecture: ppc64el 112s autopkgtest [23:25:13]: testbed apt version: 2.9.8 112s autopkgtest [23:25:13]: @@@@@@@@@@@@@@@@@@@@ test bed setup 113s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 113s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [9704 B] 113s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [50.6 kB] 114s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [13.6 kB] 114s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [906 kB] 114s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el Packages [62.6 kB] 114s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/restricted ppc64el Packages [756 B] 114s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/universe ppc64el Packages [756 kB] 114s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse ppc64el Packages [9468 B] 114s Fetched 1883 kB in 1s (1588 kB/s) 114s Reading package lists... 117s Reading package lists... 118s Building dependency tree... 118s Reading state information... 118s Calculating upgrade... 118s The following package was automatically installed and is no longer required: 118s libsgutils2-1.46-2 118s Use 'sudo apt autoremove' to remove it. 118s The following NEW packages will be installed: 118s libsgutils2-1.48 118s The following packages will be upgraded: 118s bash bpftrace curl debconf debconf-i18n distro-info dracut-install 118s gir1.2-girepository-2.0 gir1.2-glib-2.0 hostname init init-system-helpers 118s libaudit-common libaudit1 libcurl3t64-gnutls libcurl4t64 118s libgirepository-1.0-1 libglib2.0-0t64 libglib2.0-data liblzma5 118s libpam-modules libpam-modules-bin libpam-runtime libpam0g libplymouth5 118s libpython3-stdlib libselinux1 libsemanage-common libsemanage2 linux-base 118s lsvpd lxd-installer openssh-client openssh-server openssh-sftp-server 118s pinentry-curses plymouth plymouth-theme-ubuntu-text python3 python3-blinker 118s python3-dbus python3-debconf python3-gi python3-jsonschema-specifications 118s python3-minimal python3-rpds-py python3-yaml sg3-utils sg3-utils-udev 118s vim-common vim-tiny xxd xz-utils 119s 53 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 119s Need to get 14.1 MB of archives. 119s After this operation, 3675 kB of additional disk space will be used. 119s Get:1 http://ftpmaster.internal/ubuntu plucky/main ppc64el bash ppc64el 5.2.32-1ubuntu2 [979 kB] 119s Get:2 http://ftpmaster.internal/ubuntu plucky/main ppc64el hostname ppc64el 3.25 [11.3 kB] 119s Get:3 http://ftpmaster.internal/ubuntu plucky/main ppc64el init-system-helpers all 1.67ubuntu1 [39.1 kB] 119s Get:4 http://ftpmaster.internal/ubuntu plucky/main ppc64el libaudit-common all 1:4.0.2-2ubuntu1 [6578 B] 119s Get:5 http://ftpmaster.internal/ubuntu plucky/main ppc64el libaudit1 ppc64el 1:4.0.2-2ubuntu1 [59.6 kB] 119s Get:6 http://ftpmaster.internal/ubuntu plucky/main ppc64el debconf-i18n all 1.5.87ubuntu1 [204 kB] 119s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3-minimal ppc64el 3.12.7-1 [27.4 kB] 119s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3 ppc64el 3.12.7-1 [24.0 kB] 119s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el libpython3-stdlib ppc64el 3.12.7-1 [10.0 kB] 119s Get:10 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-debconf all 1.5.87ubuntu1 [4156 B] 119s Get:11 http://ftpmaster.internal/ubuntu plucky/main ppc64el debconf all 1.5.87ubuntu1 [124 kB] 119s Get:12 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam0g ppc64el 1.5.3-7ubuntu4 [76.2 kB] 119s Get:13 http://ftpmaster.internal/ubuntu plucky/main ppc64el libselinux1 ppc64el 3.7-3ubuntu1 [100 kB] 119s Get:14 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-modules-bin ppc64el 1.5.3-7ubuntu4 [57.6 kB] 119s Get:15 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-modules ppc64el 1.5.3-7ubuntu4 [325 kB] 119s Get:16 http://ftpmaster.internal/ubuntu plucky/main ppc64el init ppc64el 1.67ubuntu1 [6432 B] 119s Get:17 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-sftp-server ppc64el 1:9.9p1-3ubuntu2 [43.4 kB] 119s Get:18 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-server ppc64el 1:9.9p1-3ubuntu2 [680 kB] 119s Get:19 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-client ppc64el 1:9.9p1-3ubuntu2 [1169 kB] 119s Get:20 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-runtime all 1.5.3-7ubuntu4 [40.8 kB] 119s Get:21 http://ftpmaster.internal/ubuntu plucky/main ppc64el liblzma5 ppc64el 5.6.3-1 [172 kB] 119s Get:22 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsemanage-common all 3.7-2build1 [7186 B] 119s Get:23 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsemanage2 ppc64el 3.7-2build1 [115 kB] 119s Get:24 http://ftpmaster.internal/ubuntu plucky/main ppc64el distro-info ppc64el 1.12 [20.0 kB] 119s Get:25 http://ftpmaster.internal/ubuntu plucky/main ppc64el gir1.2-girepository-2.0 ppc64el 1.82.0-2 [25.3 kB] 119s Get:26 http://ftpmaster.internal/ubuntu plucky/main ppc64el gir1.2-glib-2.0 ppc64el 2.82.2-3 [182 kB] 119s Get:27 http://ftpmaster.internal/ubuntu plucky/main ppc64el libglib2.0-0t64 ppc64el 2.82.2-3 [1787 kB] 119s Get:28 http://ftpmaster.internal/ubuntu plucky/main ppc64el libgirepository-1.0-1 ppc64el 1.82.0-2 [95.5 kB] 119s Get:29 http://ftpmaster.internal/ubuntu plucky/main ppc64el libglib2.0-data all 2.82.2-3 [51.7 kB] 119s Get:30 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-dbus ppc64el 1.3.2-5build4 [117 kB] 119s Get:31 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-gi ppc64el 3.50.0-3build1 [308 kB] 119s Get:32 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-yaml ppc64el 6.0.2-1build1 [180 kB] 119s Get:33 http://ftpmaster.internal/ubuntu plucky/main ppc64el vim-tiny ppc64el 2:9.1.0861-1ubuntu1 [1078 kB] 120s Get:34 http://ftpmaster.internal/ubuntu plucky/main ppc64el vim-common all 2:9.1.0861-1ubuntu1 [395 kB] 120s Get:35 http://ftpmaster.internal/ubuntu plucky/main ppc64el xxd ppc64el 2:9.1.0861-1ubuntu1 [67.9 kB] 120s Get:36 http://ftpmaster.internal/ubuntu plucky/main ppc64el libplymouth5 ppc64el 24.004.60-2ubuntu3 [169 kB] 120s Get:37 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsgutils2-1.48 ppc64el 1.48-0ubuntu1 [133 kB] 120s Get:38 http://ftpmaster.internal/ubuntu plucky/main ppc64el lsvpd ppc64el 1.7.14-1ubuntu3 [162 kB] 120s Get:39 http://ftpmaster.internal/ubuntu plucky/main ppc64el plymouth-theme-ubuntu-text ppc64el 24.004.60-2ubuntu3 [11.1 kB] 120s Get:40 http://ftpmaster.internal/ubuntu plucky/main ppc64el plymouth ppc64el 24.004.60-2ubuntu3 [152 kB] 120s Get:41 http://ftpmaster.internal/ubuntu plucky/main ppc64el xz-utils ppc64el 5.6.3-1 [280 kB] 120s Get:42 http://ftpmaster.internal/ubuntu plucky/main ppc64el bpftrace ppc64el 0.21.2-2ubuntu3 [1898 kB] 120s Get:43 http://ftpmaster.internal/ubuntu plucky/main ppc64el curl ppc64el 8.9.1-2ubuntu3 [247 kB] 120s Get:44 http://ftpmaster.internal/ubuntu plucky/main ppc64el libcurl4t64 ppc64el 8.9.1-2ubuntu3 [464 kB] 120s Get:45 http://ftpmaster.internal/ubuntu plucky/main ppc64el dracut-install ppc64el 105-2ubuntu2 [38.5 kB] 120s Get:46 http://ftpmaster.internal/ubuntu plucky/main ppc64el libcurl3t64-gnutls ppc64el 8.9.1-2ubuntu3 [461 kB] 120s Get:47 http://ftpmaster.internal/ubuntu plucky/main ppc64el linux-base all 4.10.1ubuntu1 [34.8 kB] 120s Get:48 http://ftpmaster.internal/ubuntu plucky/main ppc64el lxd-installer all 10 [5264 B] 120s Get:49 http://ftpmaster.internal/ubuntu plucky/main ppc64el pinentry-curses ppc64el 1.3.1-0ubuntu2 [43.5 kB] 120s Get:50 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-blinker all 1.9.0-1 [10.7 kB] 120s Get:51 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-rpds-py ppc64el 0.21.0-2ubuntu1 [338 kB] 120s Get:52 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-jsonschema-specifications all 2023.12.1-2 [9116 B] 120s Get:53 http://ftpmaster.internal/ubuntu plucky/main ppc64el sg3-utils ppc64el 1.48-0ubuntu1 [1070 kB] 121s Get:54 http://ftpmaster.internal/ubuntu plucky/main ppc64el sg3-utils-udev all 1.48-0ubuntu1 [6608 B] 121s Preconfiguring packages ... 121s Fetched 14.1 MB in 1s (10.3 MB/s) 121s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 121s Preparing to unpack .../bash_5.2.32-1ubuntu2_ppc64el.deb ... 121s Unpacking bash (5.2.32-1ubuntu2) over (5.2.32-1ubuntu1) ... 121s Setting up bash (5.2.32-1ubuntu2) ... 121s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 122s Preparing to unpack .../hostname_3.25_ppc64el.deb ... 122s Unpacking hostname (3.25) over (3.23+nmu2ubuntu2) ... 122s Setting up hostname (3.25) ... 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 122s Preparing to unpack .../init-system-helpers_1.67ubuntu1_all.deb ... 122s Unpacking init-system-helpers (1.67ubuntu1) over (1.66ubuntu1) ... 122s Setting up init-system-helpers (1.67ubuntu1) ... 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 122s Preparing to unpack .../libaudit-common_1%3a4.0.2-2ubuntu1_all.deb ... 122s Unpacking libaudit-common (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 122s Setting up libaudit-common (1:4.0.2-2ubuntu1) ... 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 122s Preparing to unpack .../libaudit1_1%3a4.0.2-2ubuntu1_ppc64el.deb ... 122s Unpacking libaudit1:ppc64el (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 122s Setting up libaudit1:ppc64el (1:4.0.2-2ubuntu1) ... 122s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 122s Preparing to unpack .../debconf-i18n_1.5.87ubuntu1_all.deb ... 122s Unpacking debconf-i18n (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 122s Preparing to unpack .../python3-minimal_3.12.7-1_ppc64el.deb ... 122s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 122s Setting up python3-minimal (3.12.7-1) ... 123s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 123s Preparing to unpack .../python3_3.12.7-1_ppc64el.deb ... 123s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 123s Preparing to unpack .../libpython3-stdlib_3.12.7-1_ppc64el.deb ... 123s Unpacking libpython3-stdlib:ppc64el (3.12.7-1) over (3.12.6-0ubuntu1) ... 123s Preparing to unpack .../python3-debconf_1.5.87ubuntu1_all.deb ... 123s Unpacking python3-debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 123s Preparing to unpack .../debconf_1.5.87ubuntu1_all.deb ... 123s Unpacking debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 123s Setting up debconf (1.5.87ubuntu1) ... 123s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 123s Preparing to unpack .../libpam0g_1.5.3-7ubuntu4_ppc64el.deb ... 123s Unpacking libpam0g:ppc64el (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 124s Setting up libpam0g:ppc64el (1.5.3-7ubuntu4) ... 124s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 124s Preparing to unpack .../libselinux1_3.7-3ubuntu1_ppc64el.deb ... 124s Unpacking libselinux1:ppc64el (3.7-3ubuntu1) over (3.5-2ubuntu5) ... 124s Setting up libselinux1:ppc64el (3.7-3ubuntu1) ... 124s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 124s Preparing to unpack .../libpam-modules-bin_1.5.3-7ubuntu4_ppc64el.deb ... 124s Unpacking libpam-modules-bin (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 124s Setting up libpam-modules-bin (1.5.3-7ubuntu4) ... 125s pam_namespace.service is a disabled or a static unit not running, not starting it. 125s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 125s Preparing to unpack .../libpam-modules_1.5.3-7ubuntu4_ppc64el.deb ... 125s Unpacking libpam-modules:ppc64el (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 125s Setting up libpam-modules:ppc64el (1.5.3-7ubuntu4) ... 125s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 125s Preparing to unpack .../init_1.67ubuntu1_ppc64el.deb ... 125s Unpacking init (1.67ubuntu1) over (1.66ubuntu1) ... 125s Preparing to unpack .../openssh-sftp-server_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 125s Unpacking openssh-sftp-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 125s Preparing to unpack .../openssh-server_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 126s Unpacking openssh-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 126s Preparing to unpack .../openssh-client_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 126s Unpacking openssh-client (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 126s Preparing to unpack .../libpam-runtime_1.5.3-7ubuntu4_all.deb ... 126s Unpacking libpam-runtime (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 126s Setting up libpam-runtime (1.5.3-7ubuntu4) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73849 files and directories currently installed.) 127s Preparing to unpack .../liblzma5_5.6.3-1_ppc64el.deb ... 127s Unpacking liblzma5:ppc64el (5.6.3-1) over (5.6.2-2) ... 127s Setting up liblzma5:ppc64el (5.6.3-1) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73849 files and directories currently installed.) 127s Preparing to unpack .../libsemanage-common_3.7-2build1_all.deb ... 127s Unpacking libsemanage-common (3.7-2build1) over (3.5-1build6) ... 127s Setting up libsemanage-common (3.7-2build1) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73848 files and directories currently installed.) 127s Preparing to unpack .../libsemanage2_3.7-2build1_ppc64el.deb ... 127s Unpacking libsemanage2:ppc64el (3.7-2build1) over (3.5-1build6) ... 127s Setting up libsemanage2:ppc64el (3.7-2build1) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73848 files and directories currently installed.) 127s Preparing to unpack .../00-distro-info_1.12_ppc64el.deb ... 127s Unpacking distro-info (1.12) over (1.9) ... 127s Preparing to unpack .../01-gir1.2-girepository-2.0_1.82.0-2_ppc64el.deb ... 127s Unpacking gir1.2-girepository-2.0:ppc64el (1.82.0-2) over (1.80.1-4) ... 127s Preparing to unpack .../02-gir1.2-glib-2.0_2.82.2-3_ppc64el.deb ... 127s Unpacking gir1.2-glib-2.0:ppc64el (2.82.2-3) over (2.82.1-0ubuntu1) ... 127s Preparing to unpack .../03-libglib2.0-0t64_2.82.2-3_ppc64el.deb ... 127s Unpacking libglib2.0-0t64:ppc64el (2.82.2-3) over (2.82.1-0ubuntu1) ... 127s Preparing to unpack .../04-libgirepository-1.0-1_1.82.0-2_ppc64el.deb ... 127s Unpacking libgirepository-1.0-1:ppc64el (1.82.0-2) over (1.80.1-4) ... 127s Preparing to unpack .../05-libglib2.0-data_2.82.2-3_all.deb ... 127s Unpacking libglib2.0-data (2.82.2-3) over (2.82.1-0ubuntu1) ... 127s Preparing to unpack .../06-python3-dbus_1.3.2-5build4_ppc64el.deb ... 127s Unpacking python3-dbus (1.3.2-5build4) over (1.3.2-5build3) ... 127s Preparing to unpack .../07-python3-gi_3.50.0-3build1_ppc64el.deb ... 128s Unpacking python3-gi (3.50.0-3build1) over (3.50.0-3) ... 128s Preparing to unpack .../08-python3-yaml_6.0.2-1build1_ppc64el.deb ... 128s Unpacking python3-yaml (6.0.2-1build1) over (6.0.2-1) ... 128s Preparing to unpack .../09-vim-tiny_2%3a9.1.0861-1ubuntu1_ppc64el.deb ... 128s Unpacking vim-tiny (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 128s Preparing to unpack .../10-vim-common_2%3a9.1.0861-1ubuntu1_all.deb ... 128s Unpacking vim-common (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 128s Preparing to unpack .../11-xxd_2%3a9.1.0861-1ubuntu1_ppc64el.deb ... 128s Unpacking xxd (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 128s Preparing to unpack .../12-libplymouth5_24.004.60-2ubuntu3_ppc64el.deb ... 128s Unpacking libplymouth5:ppc64el (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 128s Selecting previously unselected package libsgutils2-1.48:ppc64el. 128s Preparing to unpack .../13-libsgutils2-1.48_1.48-0ubuntu1_ppc64el.deb ... 128s Unpacking libsgutils2-1.48:ppc64el (1.48-0ubuntu1) ... 128s Preparing to unpack .../14-lsvpd_1.7.14-1ubuntu3_ppc64el.deb ... 128s Unpacking lsvpd (1.7.14-1ubuntu3) over (1.7.14-1ubuntu2) ... 128s Preparing to unpack .../15-plymouth-theme-ubuntu-text_24.004.60-2ubuntu3_ppc64el.deb ... 128s Unpacking plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 128s Preparing to unpack .../16-plymouth_24.004.60-2ubuntu3_ppc64el.deb ... 129s Unpacking plymouth (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 129s Preparing to unpack .../17-xz-utils_5.6.3-1_ppc64el.deb ... 129s Unpacking xz-utils (5.6.3-1) over (5.6.2-2) ... 129s Preparing to unpack .../18-bpftrace_0.21.2-2ubuntu3_ppc64el.deb ... 129s Unpacking bpftrace (0.21.2-2ubuntu3) over (0.21.2-2ubuntu2) ... 129s Preparing to unpack .../19-curl_8.9.1-2ubuntu3_ppc64el.deb ... 129s Unpacking curl (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 129s Preparing to unpack .../20-libcurl4t64_8.9.1-2ubuntu3_ppc64el.deb ... 129s Unpacking libcurl4t64:ppc64el (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 129s Preparing to unpack .../21-dracut-install_105-2ubuntu2_ppc64el.deb ... 129s Unpacking dracut-install (105-2ubuntu2) over (105-1ubuntu1) ... 129s Preparing to unpack .../22-libcurl3t64-gnutls_8.9.1-2ubuntu3_ppc64el.deb ... 129s Unpacking libcurl3t64-gnutls:ppc64el (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 129s Preparing to unpack .../23-linux-base_4.10.1ubuntu1_all.deb ... 129s Unpacking linux-base (4.10.1ubuntu1) over (4.5ubuntu9) ... 129s Preparing to unpack .../24-lxd-installer_10_all.deb ... 129s Unpacking lxd-installer (10) over (9) ... 129s Preparing to unpack .../25-pinentry-curses_1.3.1-0ubuntu2_ppc64el.deb ... 129s Unpacking pinentry-curses (1.3.1-0ubuntu2) over (1.2.1-3ubuntu5) ... 129s Preparing to unpack .../26-python3-blinker_1.9.0-1_all.deb ... 129s Unpacking python3-blinker (1.9.0-1) over (1.8.2-1) ... 129s Preparing to unpack .../27-python3-rpds-py_0.21.0-2ubuntu1_ppc64el.deb ... 129s Unpacking python3-rpds-py (0.21.0-2ubuntu1) over (0.20.0-0ubuntu3) ... 129s Preparing to unpack .../28-python3-jsonschema-specifications_2023.12.1-2_all.deb ... 130s Unpacking python3-jsonschema-specifications (2023.12.1-2) over (2023.12.1-1ubuntu1) ... 130s Preparing to unpack .../29-sg3-utils_1.48-0ubuntu1_ppc64el.deb ... 130s Unpacking sg3-utils (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 130s Preparing to unpack .../30-sg3-utils-udev_1.48-0ubuntu1_all.deb ... 130s Unpacking sg3-utils-udev (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 130s Setting up pinentry-curses (1.3.1-0ubuntu2) ... 130s Setting up distro-info (1.12) ... 130s Setting up linux-base (4.10.1ubuntu1) ... 130s Setting up init (1.67ubuntu1) ... 130s Setting up libcurl4t64:ppc64el (8.9.1-2ubuntu3) ... 130s Setting up bpftrace (0.21.2-2ubuntu3) ... 130s Setting up openssh-client (1:9.9p1-3ubuntu2) ... 130s Setting up libcurl3t64-gnutls:ppc64el (8.9.1-2ubuntu3) ... 130s Setting up libsgutils2-1.48:ppc64el (1.48-0ubuntu1) ... 130s Setting up debconf-i18n (1.5.87ubuntu1) ... 130s Setting up xxd (2:9.1.0861-1ubuntu1) ... 130s Setting up libglib2.0-0t64:ppc64el (2.82.2-3) ... 130s No schema files found: doing nothing. 130s Setting up libglib2.0-data (2.82.2-3) ... 130s Setting up vim-common (2:9.1.0861-1ubuntu1) ... 130s Setting up xz-utils (5.6.3-1) ... 130s Setting up gir1.2-glib-2.0:ppc64el (2.82.2-3) ... 130s Setting up lxd-installer (10) ... 131s Setting up dracut-install (105-2ubuntu2) ... 131s Setting up libplymouth5:ppc64el (24.004.60-2ubuntu3) ... 131s Setting up libgirepository-1.0-1:ppc64el (1.82.0-2) ... 131s Setting up curl (8.9.1-2ubuntu3) ... 131s Setting up libpython3-stdlib:ppc64el (3.12.7-1) ... 131s Setting up sg3-utils (1.48-0ubuntu1) ... 131s Setting up openssh-sftp-server (1:9.9p1-3ubuntu2) ... 131s Setting up openssh-server (1:9.9p1-3ubuntu2) ... 131s Installing new version of config file /etc/ssh/moduli ... 131s Replacing config file /etc/ssh/sshd_config with new version 133s Setting up plymouth (24.004.60-2ubuntu3) ... 133s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 133s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 148s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 148s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 149s Setting up lsvpd (1.7.14-1ubuntu3) ... 149s Setting up python3 (3.12.7-1) ... 149s Setting up vim-tiny (2:9.1.0861-1ubuntu1) ... 149s Setting up sg3-utils-udev (1.48-0ubuntu1) ... 150s update-initramfs: deferring update (trigger activated) 150s Setting up plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) ... 150s update-initramfs: deferring update (trigger activated) 150s Setting up gir1.2-girepository-2.0:ppc64el (1.82.0-2) ... 150s Setting up python3-gi (3.50.0-3build1) ... 150s Setting up python3-rpds-py (0.21.0-2ubuntu1) ... 150s Setting up python3-jsonschema-specifications (2023.12.1-2) ... 150s Setting up python3-blinker (1.9.0-1) ... 151s Setting up python3-dbus (1.3.2-5build4) ... 151s Setting up python3-debconf (1.5.87ubuntu1) ... 151s Setting up python3-yaml (6.0.2-1build1) ... 151s Processing triggers for man-db (2.13.0-1) ... 154s Processing triggers for debianutils (5.21) ... 154s Processing triggers for install-info (7.1.1-1) ... 154s Processing triggers for initramfs-tools (0.142ubuntu35) ... 155s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 155s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 165s Processing triggers for libc-bin (2.40-1ubuntu3) ... 165s Processing triggers for ufw (0.36.2-8) ... 166s Reading package lists... 166s Building dependency tree... 166s Reading state information... 166s The following packages will be REMOVED: 166s libsgutils2-1.46-2* 166s 0 upgraded, 0 newly installed, 1 to remove and 0 not upgraded. 166s After this operation, 380 kB disk space will be freed. 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73882 files and directories currently installed.) 167s Removing libsgutils2-1.46-2:ppc64el (1.46-3ubuntu5) ... 167s Processing triggers for libc-bin (2.40-1ubuntu3) ... 167s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 167s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 167s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 168s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 169s Reading package lists... 169s Reading package lists... 169s Building dependency tree... 169s Reading state information... 170s Calculating upgrade... 170s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 170s Reading package lists... 171s Building dependency tree... 171s Reading state information... 171s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 172s autopkgtest [23:26:13]: rebooting testbed after setup commands that affected boot 175s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 208s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 215s autopkgtest [23:26:56]: testbed running kernel: Linux 6.11.0-8-generic #8-Ubuntu SMP Mon Sep 16 13:49:23 UTC 2024 218s autopkgtest [23:26:59]: @@@@@@@@@@@@@@@@@@@@ apt-source pyfastx 221s Get:1 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (dsc) [2289 B] 221s Get:2 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (tar) [230 kB] 221s Get:3 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (diff) [7412 B] 221s gpgv: Signature made Fri Aug 30 18:49:12 2024 UTC 221s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 221s gpgv: issuer "emollier@debian.org" 221s gpgv: Can't check signature: No public key 221s dpkg-source: warning: cannot verify inline signature for ./pyfastx_2.1.0-2.dsc: no acceptable signature found 221s autopkgtest [23:27:02]: testing package pyfastx version 2.1.0-2 221s autopkgtest [23:27:02]: build not needed 222s autopkgtest [23:27:03]: test run-unit-test: preparing testbed 224s Reading package lists... 224s Building dependency tree... 224s Reading state information... 224s Starting pkgProblemResolver with broken count: 0 224s Starting 2 pkgProblemResolver with broken count: 0 224s Done 224s The following additional packages will be installed: 224s libpython3.13-minimal libpython3.13-stdlib pyfastx python3-all 224s python3-importlib-metadata python3-packaging python3-pyfaidx python3-pyfastx 224s python3.13 python3.13-minimal 224s Suggested packages: 224s python3.13-venv python3.13-doc binfmt-support 224s Recommended packages: 224s python3-biopython 224s The following NEW packages will be installed: 224s autopkgtest-satdep libpython3.13-minimal libpython3.13-stdlib pyfastx 224s python3-all python3-importlib-metadata python3-packaging python3-pyfaidx 224s python3-pyfastx python3.13 python3.13-minimal 224s 0 upgraded, 11 newly installed, 0 to remove and 0 not upgraded. 224s Need to get 6338 kB/6338 kB of archives. 224s After this operation, 26.6 MB of additional disk space will be used. 224s Get:1 /tmp/autopkgtest.4iVlaK/1-autopkgtest-satdep.deb autopkgtest-satdep ppc64el 0 [720 B] 225s Get:2 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpython3.13-minimal ppc64el 3.13.0-2 [881 kB] 225s Get:3 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3.13-minimal ppc64el 3.13.0-2 [2302 kB] 225s Get:4 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpython3.13-stdlib ppc64el 3.13.0-2 [2148 kB] 225s Get:5 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-importlib-metadata all 8.5.0-1 [20.7 kB] 225s Get:6 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-packaging all 24.2-1 [51.5 kB] 225s Get:7 http://ftpmaster.internal/ubuntu plucky/universe ppc64el python3-pyfaidx all 0.8.1.3-1 [29.7 kB] 225s Get:8 http://ftpmaster.internal/ubuntu plucky/universe ppc64el python3-pyfastx ppc64el 2.1.0-2 [63.1 kB] 225s Get:9 http://ftpmaster.internal/ubuntu plucky/universe ppc64el pyfastx ppc64el 2.1.0-2 [122 kB] 225s Get:10 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3.13 ppc64el 3.13.0-2 [719 kB] 225s Get:11 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3-all ppc64el 3.12.7-1 [888 B] 226s Fetched 6338 kB in 1s (7457 kB/s) 226s Selecting previously unselected package libpython3.13-minimal:ppc64el. 226s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73877 files and directories currently installed.) 226s Preparing to unpack .../00-libpython3.13-minimal_3.13.0-2_ppc64el.deb ... 226s Unpacking libpython3.13-minimal:ppc64el (3.13.0-2) ... 226s Selecting previously unselected package python3.13-minimal. 226s Preparing to unpack .../01-python3.13-minimal_3.13.0-2_ppc64el.deb ... 226s Unpacking python3.13-minimal (3.13.0-2) ... 226s Selecting previously unselected package libpython3.13-stdlib:ppc64el. 226s Preparing to unpack .../02-libpython3.13-stdlib_3.13.0-2_ppc64el.deb ... 226s Unpacking libpython3.13-stdlib:ppc64el (3.13.0-2) ... 226s Selecting previously unselected package python3-importlib-metadata. 226s Preparing to unpack .../03-python3-importlib-metadata_8.5.0-1_all.deb ... 226s Unpacking python3-importlib-metadata (8.5.0-1) ... 226s Selecting previously unselected package python3-packaging. 226s Preparing to unpack .../04-python3-packaging_24.2-1_all.deb ... 226s Unpacking python3-packaging (24.2-1) ... 226s Selecting previously unselected package python3-pyfaidx. 226s Preparing to unpack .../05-python3-pyfaidx_0.8.1.3-1_all.deb ... 226s Unpacking python3-pyfaidx (0.8.1.3-1) ... 226s Selecting previously unselected package python3-pyfastx. 226s Preparing to unpack .../06-python3-pyfastx_2.1.0-2_ppc64el.deb ... 226s Unpacking python3-pyfastx (2.1.0-2) ... 226s Selecting previously unselected package pyfastx. 226s Preparing to unpack .../07-pyfastx_2.1.0-2_ppc64el.deb ... 226s Unpacking pyfastx (2.1.0-2) ... 226s Selecting previously unselected package python3.13. 226s Preparing to unpack .../08-python3.13_3.13.0-2_ppc64el.deb ... 226s Unpacking python3.13 (3.13.0-2) ... 226s Selecting previously unselected package python3-all. 226s Preparing to unpack .../09-python3-all_3.12.7-1_ppc64el.deb ... 226s Unpacking python3-all (3.12.7-1) ... 226s Selecting previously unselected package autopkgtest-satdep. 226s Preparing to unpack .../10-1-autopkgtest-satdep.deb ... 226s Unpacking autopkgtest-satdep (0) ... 227s Setting up python3-importlib-metadata (8.5.0-1) ... 227s Setting up libpython3.13-minimal:ppc64el (3.13.0-2) ... 227s Setting up python3-packaging (24.2-1) ... 227s Setting up python3.13-minimal (3.13.0-2) ... 229s Setting up libpython3.13-stdlib:ppc64el (3.13.0-2) ... 229s Setting up python3-pyfaidx (0.8.1.3-1) ... 229s Setting up python3.13 (3.13.0-2) ... 230s Setting up python3-pyfastx (2.1.0-2) ... 230s Setting up python3-all (3.12.7-1) ... 230s Setting up pyfastx (2.1.0-2) ... 230s Setting up autopkgtest-satdep (0) ... 230s Processing triggers for man-db (2.13.0-1) ... 231s Processing triggers for systemd (256.5-2ubuntu4) ... 235s (Reading database ... 74712 files and directories currently installed.) 235s Removing autopkgtest-satdep (0) ... 236s autopkgtest [23:27:17]: test run-unit-test: [----------------------- 236s tests.test_fakeys (unittest.loader._FailedTest.tests.test_fakeys) ... ERROR 236s tests.test_fasta (unittest.loader._FailedTest.tests.test_fasta) ... ERROR 236s tests.test_fastq (unittest.loader._FailedTest.tests.test_fastq) ... ERROR 236s tests.test_fastx (unittest.loader._FailedTest.tests.test_fastx) ... ERROR 236s tests.test_fqkeys (unittest.loader._FailedTest.tests.test_fqkeys) ... ERROR 236s tests.test_read (unittest.loader._FailedTest.tests.test_read) ... ERROR 236s tests.test_sequence (unittest.loader._FailedTest.tests.test_sequence) ... ERROR 236s tests.test_sequence_error (unittest.loader._FailedTest.tests.test_sequence_error) ... ERROR 236s 236s ====================================================================== 236s ERROR: tests.test_fakeys (unittest.loader._FailedTest.tests.test_fakeys) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_fakeys 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_fakeys.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_fasta (unittest.loader._FailedTest.tests.test_fasta) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_fasta 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_fasta.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_fastq (unittest.loader._FailedTest.tests.test_fastq) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_fastq 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_fastq.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_fastx (unittest.loader._FailedTest.tests.test_fastx) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_fastx 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_fastx.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_fqkeys (unittest.loader._FailedTest.tests.test_fqkeys) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_fqkeys 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_fqkeys.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_read (unittest.loader._FailedTest.tests.test_read) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_read 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_read.py", line 4, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_sequence (unittest.loader._FailedTest.tests.test_sequence) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_sequence 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_sequence.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ====================================================================== 236s ERROR: tests.test_sequence_error (unittest.loader._FailedTest.tests.test_sequence_error) 236s ---------------------------------------------------------------------- 236s ImportError: Failed to import test module: tests.test_sequence_error 236s Traceback (most recent call last): 236s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 236s module = self._get_module_from_name(name) 236s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 236s __import__(name) 236s ~~~~~~~~~~^^^^^^ 236s File "/tmp/autopkgtest.4iVlaK/build.joN/src/tests/test_sequence_error.py", line 3, in 236s import pyfastx 236s ModuleNotFoundError: No module named 'pyfastx' 236s 236s 236s ---------------------------------------------------------------------- 236s Ran 8 tests in 0.001s 236s 236s FAILED (errors=8) 237s autopkgtest [23:27:18]: test run-unit-test: -----------------------] 237s run-unit-test FAIL non-zero exit status 1 237s autopkgtest [23:27:18]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 237s autopkgtest [23:27:18]: test test-cli: preparing testbed 323s autopkgtest [23:28:44]: testbed dpkg architecture: ppc64el 323s autopkgtest [23:28:44]: testbed apt version: 2.9.8 323s autopkgtest [23:28:44]: @@@@@@@@@@@@@@@@@@@@ test bed setup 324s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 324s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [13.6 kB] 325s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [50.6 kB] 325s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [906 kB] 325s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [9704 B] 325s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el Packages [62.6 kB] 325s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/restricted ppc64el Packages [756 B] 325s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/universe ppc64el Packages [756 kB] 325s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse ppc64el Packages [9468 B] 325s Fetched 1883 kB in 1s (1987 kB/s) 325s Reading package lists... 327s Reading package lists... 328s Building dependency tree... 328s Reading state information... 328s Calculating upgrade... 328s The following package was automatically installed and is no longer required: 328s libsgutils2-1.46-2 328s Use 'sudo apt autoremove' to remove it. 328s The following NEW packages will be installed: 328s libsgutils2-1.48 328s The following packages will be upgraded: 328s bash bpftrace curl debconf debconf-i18n distro-info dracut-install 328s gir1.2-girepository-2.0 gir1.2-glib-2.0 hostname init init-system-helpers 328s libaudit-common libaudit1 libcurl3t64-gnutls libcurl4t64 328s libgirepository-1.0-1 libglib2.0-0t64 libglib2.0-data liblzma5 328s libpam-modules libpam-modules-bin libpam-runtime libpam0g libplymouth5 328s libpython3-stdlib libselinux1 libsemanage-common libsemanage2 linux-base 328s lsvpd lxd-installer openssh-client openssh-server openssh-sftp-server 328s pinentry-curses plymouth plymouth-theme-ubuntu-text python3 python3-blinker 328s python3-dbus python3-debconf python3-gi python3-jsonschema-specifications 328s python3-minimal python3-rpds-py python3-yaml sg3-utils sg3-utils-udev 328s vim-common vim-tiny xxd xz-utils 328s 53 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 328s Need to get 14.1 MB of archives. 328s After this operation, 3675 kB of additional disk space will be used. 328s Get:1 http://ftpmaster.internal/ubuntu plucky/main ppc64el bash ppc64el 5.2.32-1ubuntu2 [979 kB] 329s Get:2 http://ftpmaster.internal/ubuntu plucky/main ppc64el hostname ppc64el 3.25 [11.3 kB] 329s Get:3 http://ftpmaster.internal/ubuntu plucky/main ppc64el init-system-helpers all 1.67ubuntu1 [39.1 kB] 329s Get:4 http://ftpmaster.internal/ubuntu plucky/main ppc64el libaudit-common all 1:4.0.2-2ubuntu1 [6578 B] 329s Get:5 http://ftpmaster.internal/ubuntu plucky/main ppc64el libaudit1 ppc64el 1:4.0.2-2ubuntu1 [59.6 kB] 329s Get:6 http://ftpmaster.internal/ubuntu plucky/main ppc64el debconf-i18n all 1.5.87ubuntu1 [204 kB] 329s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3-minimal ppc64el 3.12.7-1 [27.4 kB] 329s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3 ppc64el 3.12.7-1 [24.0 kB] 329s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el libpython3-stdlib ppc64el 3.12.7-1 [10.0 kB] 329s Get:10 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-debconf all 1.5.87ubuntu1 [4156 B] 329s Get:11 http://ftpmaster.internal/ubuntu plucky/main ppc64el debconf all 1.5.87ubuntu1 [124 kB] 329s Get:12 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam0g ppc64el 1.5.3-7ubuntu4 [76.2 kB] 329s Get:13 http://ftpmaster.internal/ubuntu plucky/main ppc64el libselinux1 ppc64el 3.7-3ubuntu1 [100 kB] 329s Get:14 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-modules-bin ppc64el 1.5.3-7ubuntu4 [57.6 kB] 329s Get:15 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-modules ppc64el 1.5.3-7ubuntu4 [325 kB] 329s Get:16 http://ftpmaster.internal/ubuntu plucky/main ppc64el init ppc64el 1.67ubuntu1 [6432 B] 329s Get:17 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-sftp-server ppc64el 1:9.9p1-3ubuntu2 [43.4 kB] 329s Get:18 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-server ppc64el 1:9.9p1-3ubuntu2 [680 kB] 329s Get:19 http://ftpmaster.internal/ubuntu plucky/main ppc64el openssh-client ppc64el 1:9.9p1-3ubuntu2 [1169 kB] 329s Get:20 http://ftpmaster.internal/ubuntu plucky/main ppc64el libpam-runtime all 1.5.3-7ubuntu4 [40.8 kB] 329s Get:21 http://ftpmaster.internal/ubuntu plucky/main ppc64el liblzma5 ppc64el 5.6.3-1 [172 kB] 329s Get:22 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsemanage-common all 3.7-2build1 [7186 B] 329s Get:23 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsemanage2 ppc64el 3.7-2build1 [115 kB] 329s Get:24 http://ftpmaster.internal/ubuntu plucky/main ppc64el distro-info ppc64el 1.12 [20.0 kB] 329s Get:25 http://ftpmaster.internal/ubuntu plucky/main ppc64el gir1.2-girepository-2.0 ppc64el 1.82.0-2 [25.3 kB] 329s Get:26 http://ftpmaster.internal/ubuntu plucky/main ppc64el gir1.2-glib-2.0 ppc64el 2.82.2-3 [182 kB] 329s Get:27 http://ftpmaster.internal/ubuntu plucky/main ppc64el libglib2.0-0t64 ppc64el 2.82.2-3 [1787 kB] 329s Get:28 http://ftpmaster.internal/ubuntu plucky/main ppc64el libgirepository-1.0-1 ppc64el 1.82.0-2 [95.5 kB] 329s Get:29 http://ftpmaster.internal/ubuntu plucky/main ppc64el libglib2.0-data all 2.82.2-3 [51.7 kB] 329s Get:30 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-dbus ppc64el 1.3.2-5build4 [117 kB] 329s Get:31 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-gi ppc64el 3.50.0-3build1 [308 kB] 329s Get:32 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-yaml ppc64el 6.0.2-1build1 [180 kB] 329s Get:33 http://ftpmaster.internal/ubuntu plucky/main ppc64el vim-tiny ppc64el 2:9.1.0861-1ubuntu1 [1078 kB] 329s Get:34 http://ftpmaster.internal/ubuntu plucky/main ppc64el vim-common all 2:9.1.0861-1ubuntu1 [395 kB] 329s Get:35 http://ftpmaster.internal/ubuntu plucky/main ppc64el xxd ppc64el 2:9.1.0861-1ubuntu1 [67.9 kB] 329s Get:36 http://ftpmaster.internal/ubuntu plucky/main ppc64el libplymouth5 ppc64el 24.004.60-2ubuntu3 [169 kB] 329s Get:37 http://ftpmaster.internal/ubuntu plucky/main ppc64el libsgutils2-1.48 ppc64el 1.48-0ubuntu1 [133 kB] 329s Get:38 http://ftpmaster.internal/ubuntu plucky/main ppc64el lsvpd ppc64el 1.7.14-1ubuntu3 [162 kB] 329s Get:39 http://ftpmaster.internal/ubuntu plucky/main ppc64el plymouth-theme-ubuntu-text ppc64el 24.004.60-2ubuntu3 [11.1 kB] 329s Get:40 http://ftpmaster.internal/ubuntu plucky/main ppc64el plymouth ppc64el 24.004.60-2ubuntu3 [152 kB] 329s Get:41 http://ftpmaster.internal/ubuntu plucky/main ppc64el xz-utils ppc64el 5.6.3-1 [280 kB] 329s Get:42 http://ftpmaster.internal/ubuntu plucky/main ppc64el bpftrace ppc64el 0.21.2-2ubuntu3 [1898 kB] 330s Get:43 http://ftpmaster.internal/ubuntu plucky/main ppc64el curl ppc64el 8.9.1-2ubuntu3 [247 kB] 330s Get:44 http://ftpmaster.internal/ubuntu plucky/main ppc64el libcurl4t64 ppc64el 8.9.1-2ubuntu3 [464 kB] 330s Get:45 http://ftpmaster.internal/ubuntu plucky/main ppc64el dracut-install ppc64el 105-2ubuntu2 [38.5 kB] 330s Get:46 http://ftpmaster.internal/ubuntu plucky/main ppc64el libcurl3t64-gnutls ppc64el 8.9.1-2ubuntu3 [461 kB] 330s Get:47 http://ftpmaster.internal/ubuntu plucky/main ppc64el linux-base all 4.10.1ubuntu1 [34.8 kB] 330s Get:48 http://ftpmaster.internal/ubuntu plucky/main ppc64el lxd-installer all 10 [5264 B] 330s Get:49 http://ftpmaster.internal/ubuntu plucky/main ppc64el pinentry-curses ppc64el 1.3.1-0ubuntu2 [43.5 kB] 330s Get:50 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-blinker all 1.9.0-1 [10.7 kB] 330s Get:51 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-rpds-py ppc64el 0.21.0-2ubuntu1 [338 kB] 330s Get:52 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-jsonschema-specifications all 2023.12.1-2 [9116 B] 330s Get:53 http://ftpmaster.internal/ubuntu plucky/main ppc64el sg3-utils ppc64el 1.48-0ubuntu1 [1070 kB] 330s Get:54 http://ftpmaster.internal/ubuntu plucky/main ppc64el sg3-utils-udev all 1.48-0ubuntu1 [6608 B] 330s Preconfiguring packages ... 330s Fetched 14.1 MB in 2s (7690 kB/s) 330s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 330s Preparing to unpack .../bash_5.2.32-1ubuntu2_ppc64el.deb ... 330s Unpacking bash (5.2.32-1ubuntu2) over (5.2.32-1ubuntu1) ... 331s Setting up bash (5.2.32-1ubuntu2) ... 331s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 331s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 331s Preparing to unpack .../hostname_3.25_ppc64el.deb ... 331s Unpacking hostname (3.25) over (3.23+nmu2ubuntu2) ... 331s Setting up hostname (3.25) ... 331s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 331s Preparing to unpack .../init-system-helpers_1.67ubuntu1_all.deb ... 331s Unpacking init-system-helpers (1.67ubuntu1) over (1.66ubuntu1) ... 331s Setting up init-system-helpers (1.67ubuntu1) ... 331s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 331s Preparing to unpack .../libaudit-common_1%3a4.0.2-2ubuntu1_all.deb ... 331s Unpacking libaudit-common (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 331s Setting up libaudit-common (1:4.0.2-2ubuntu1) ... 331s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 331s Preparing to unpack .../libaudit1_1%3a4.0.2-2ubuntu1_ppc64el.deb ... 331s Unpacking libaudit1:ppc64el (1:4.0.2-2ubuntu1) over (1:4.0.1-1ubuntu2) ... 331s Setting up libaudit1:ppc64el (1:4.0.2-2ubuntu1) ... 331s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 331s Preparing to unpack .../debconf-i18n_1.5.87ubuntu1_all.deb ... 331s Unpacking debconf-i18n (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 331s Preparing to unpack .../python3-minimal_3.12.7-1_ppc64el.deb ... 331s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 331s Setting up python3-minimal (3.12.7-1) ... 331s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 331s Preparing to unpack .../python3_3.12.7-1_ppc64el.deb ... 331s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 331s Preparing to unpack .../libpython3-stdlib_3.12.7-1_ppc64el.deb ... 331s Unpacking libpython3-stdlib:ppc64el (3.12.7-1) over (3.12.6-0ubuntu1) ... 331s Preparing to unpack .../python3-debconf_1.5.87ubuntu1_all.deb ... 331s Unpacking python3-debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 331s Preparing to unpack .../debconf_1.5.87ubuntu1_all.deb ... 331s Unpacking debconf (1.5.87ubuntu1) over (1.5.86ubuntu1) ... 331s Setting up debconf (1.5.87ubuntu1) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 332s Preparing to unpack .../libpam0g_1.5.3-7ubuntu4_ppc64el.deb ... 332s Unpacking libpam0g:ppc64el (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 332s Setting up libpam0g:ppc64el (1.5.3-7ubuntu4) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 332s Preparing to unpack .../libselinux1_3.7-3ubuntu1_ppc64el.deb ... 332s Unpacking libselinux1:ppc64el (3.7-3ubuntu1) over (3.5-2ubuntu5) ... 332s Setting up libselinux1:ppc64el (3.7-3ubuntu1) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 332s Preparing to unpack .../libpam-modules-bin_1.5.3-7ubuntu4_ppc64el.deb ... 332s Unpacking libpam-modules-bin (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 332s Setting up libpam-modules-bin (1.5.3-7ubuntu4) ... 332s pam_namespace.service is a disabled or a static unit not running, not starting it. 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 332s Preparing to unpack .../libpam-modules_1.5.3-7ubuntu4_ppc64el.deb ... 332s Unpacking libpam-modules:ppc64el (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 332s Setting up libpam-modules:ppc64el (1.5.3-7ubuntu4) ... 332s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73847 files and directories currently installed.) 332s Preparing to unpack .../init_1.67ubuntu1_ppc64el.deb ... 332s Unpacking init (1.67ubuntu1) over (1.66ubuntu1) ... 332s Preparing to unpack .../openssh-sftp-server_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 332s Unpacking openssh-sftp-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 332s Preparing to unpack .../openssh-server_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 332s Unpacking openssh-server (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 333s Preparing to unpack .../openssh-client_1%3a9.9p1-3ubuntu2_ppc64el.deb ... 333s Unpacking openssh-client (1:9.9p1-3ubuntu2) over (1:9.7p1-7ubuntu5) ... 333s Preparing to unpack .../libpam-runtime_1.5.3-7ubuntu4_all.deb ... 333s Unpacking libpam-runtime (1.5.3-7ubuntu4) over (1.5.3-7ubuntu2) ... 333s Setting up libpam-runtime (1.5.3-7ubuntu4) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73849 files and directories currently installed.) 333s Preparing to unpack .../liblzma5_5.6.3-1_ppc64el.deb ... 333s Unpacking liblzma5:ppc64el (5.6.3-1) over (5.6.2-2) ... 333s Setting up liblzma5:ppc64el (5.6.3-1) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73849 files and directories currently installed.) 333s Preparing to unpack .../libsemanage-common_3.7-2build1_all.deb ... 333s Unpacking libsemanage-common (3.7-2build1) over (3.5-1build6) ... 333s Setting up libsemanage-common (3.7-2build1) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73848 files and directories currently installed.) 333s Preparing to unpack .../libsemanage2_3.7-2build1_ppc64el.deb ... 333s Unpacking libsemanage2:ppc64el (3.7-2build1) over (3.5-1build6) ... 333s Setting up libsemanage2:ppc64el (3.7-2build1) ... 333s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73848 files and directories currently installed.) 333s Preparing to unpack .../00-distro-info_1.12_ppc64el.deb ... 333s Unpacking distro-info (1.12) over (1.9) ... 333s Preparing to unpack .../01-gir1.2-girepository-2.0_1.82.0-2_ppc64el.deb ... 333s Unpacking gir1.2-girepository-2.0:ppc64el (1.82.0-2) over (1.80.1-4) ... 333s Preparing to unpack .../02-gir1.2-glib-2.0_2.82.2-3_ppc64el.deb ... 333s Unpacking gir1.2-glib-2.0:ppc64el (2.82.2-3) over (2.82.1-0ubuntu1) ... 333s Preparing to unpack .../03-libglib2.0-0t64_2.82.2-3_ppc64el.deb ... 333s Unpacking libglib2.0-0t64:ppc64el (2.82.2-3) over (2.82.1-0ubuntu1) ... 333s Preparing to unpack .../04-libgirepository-1.0-1_1.82.0-2_ppc64el.deb ... 333s Unpacking libgirepository-1.0-1:ppc64el (1.82.0-2) over (1.80.1-4) ... 333s Preparing to unpack .../05-libglib2.0-data_2.82.2-3_all.deb ... 333s Unpacking libglib2.0-data (2.82.2-3) over (2.82.1-0ubuntu1) ... 333s Preparing to unpack .../06-python3-dbus_1.3.2-5build4_ppc64el.deb ... 333s Unpacking python3-dbus (1.3.2-5build4) over (1.3.2-5build3) ... 333s Preparing to unpack .../07-python3-gi_3.50.0-3build1_ppc64el.deb ... 333s Unpacking python3-gi (3.50.0-3build1) over (3.50.0-3) ... 333s Preparing to unpack .../08-python3-yaml_6.0.2-1build1_ppc64el.deb ... 333s Unpacking python3-yaml (6.0.2-1build1) over (6.0.2-1) ... 333s Preparing to unpack .../09-vim-tiny_2%3a9.1.0861-1ubuntu1_ppc64el.deb ... 333s Unpacking vim-tiny (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 333s Preparing to unpack .../10-vim-common_2%3a9.1.0861-1ubuntu1_all.deb ... 333s Unpacking vim-common (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 333s Preparing to unpack .../11-xxd_2%3a9.1.0861-1ubuntu1_ppc64el.deb ... 333s Unpacking xxd (2:9.1.0861-1ubuntu1) over (2:9.1.0777-1ubuntu1) ... 334s Preparing to unpack .../12-libplymouth5_24.004.60-2ubuntu3_ppc64el.deb ... 334s Unpacking libplymouth5:ppc64el (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 334s Selecting previously unselected package libsgutils2-1.48:ppc64el. 334s Preparing to unpack .../13-libsgutils2-1.48_1.48-0ubuntu1_ppc64el.deb ... 334s Unpacking libsgutils2-1.48:ppc64el (1.48-0ubuntu1) ... 334s Preparing to unpack .../14-lsvpd_1.7.14-1ubuntu3_ppc64el.deb ... 334s Unpacking lsvpd (1.7.14-1ubuntu3) over (1.7.14-1ubuntu2) ... 334s Preparing to unpack .../15-plymouth-theme-ubuntu-text_24.004.60-2ubuntu3_ppc64el.deb ... 334s Unpacking plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 334s Preparing to unpack .../16-plymouth_24.004.60-2ubuntu3_ppc64el.deb ... 334s Unpacking plymouth (24.004.60-2ubuntu3) over (24.004.60-1ubuntu11) ... 334s Preparing to unpack .../17-xz-utils_5.6.3-1_ppc64el.deb ... 334s Unpacking xz-utils (5.6.3-1) over (5.6.2-2) ... 334s Preparing to unpack .../18-bpftrace_0.21.2-2ubuntu3_ppc64el.deb ... 334s Unpacking bpftrace (0.21.2-2ubuntu3) over (0.21.2-2ubuntu2) ... 334s Preparing to unpack .../19-curl_8.9.1-2ubuntu3_ppc64el.deb ... 334s Unpacking curl (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 334s Preparing to unpack .../20-libcurl4t64_8.9.1-2ubuntu3_ppc64el.deb ... 334s Unpacking libcurl4t64:ppc64el (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 334s Preparing to unpack .../21-dracut-install_105-2ubuntu2_ppc64el.deb ... 334s Unpacking dracut-install (105-2ubuntu2) over (105-1ubuntu1) ... 334s Preparing to unpack .../22-libcurl3t64-gnutls_8.9.1-2ubuntu3_ppc64el.deb ... 334s Unpacking libcurl3t64-gnutls:ppc64el (8.9.1-2ubuntu3) over (8.9.1-2ubuntu2) ... 334s Preparing to unpack .../23-linux-base_4.10.1ubuntu1_all.deb ... 334s Unpacking linux-base (4.10.1ubuntu1) over (4.5ubuntu9) ... 334s Preparing to unpack .../24-lxd-installer_10_all.deb ... 334s Unpacking lxd-installer (10) over (9) ... 334s Preparing to unpack .../25-pinentry-curses_1.3.1-0ubuntu2_ppc64el.deb ... 334s Unpacking pinentry-curses (1.3.1-0ubuntu2) over (1.2.1-3ubuntu5) ... 334s Preparing to unpack .../26-python3-blinker_1.9.0-1_all.deb ... 334s Unpacking python3-blinker (1.9.0-1) over (1.8.2-1) ... 334s Preparing to unpack .../27-python3-rpds-py_0.21.0-2ubuntu1_ppc64el.deb ... 334s Unpacking python3-rpds-py (0.21.0-2ubuntu1) over (0.20.0-0ubuntu3) ... 334s Preparing to unpack .../28-python3-jsonschema-specifications_2023.12.1-2_all.deb ... 334s Unpacking python3-jsonschema-specifications (2023.12.1-2) over (2023.12.1-1ubuntu1) ... 334s Preparing to unpack .../29-sg3-utils_1.48-0ubuntu1_ppc64el.deb ... 334s Unpacking sg3-utils (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 334s Preparing to unpack .../30-sg3-utils-udev_1.48-0ubuntu1_all.deb ... 334s Unpacking sg3-utils-udev (1.48-0ubuntu1) over (1.46-3ubuntu5) ... 334s Setting up pinentry-curses (1.3.1-0ubuntu2) ... 334s Setting up distro-info (1.12) ... 334s Setting up linux-base (4.10.1ubuntu1) ... 335s Setting up init (1.67ubuntu1) ... 335s Setting up libcurl4t64:ppc64el (8.9.1-2ubuntu3) ... 335s Setting up bpftrace (0.21.2-2ubuntu3) ... 335s Setting up openssh-client (1:9.9p1-3ubuntu2) ... 335s Setting up libcurl3t64-gnutls:ppc64el (8.9.1-2ubuntu3) ... 335s Setting up libsgutils2-1.48:ppc64el (1.48-0ubuntu1) ... 335s Setting up debconf-i18n (1.5.87ubuntu1) ... 335s Setting up xxd (2:9.1.0861-1ubuntu1) ... 335s Setting up libglib2.0-0t64:ppc64el (2.82.2-3) ... 335s No schema files found: doing nothing. 335s Setting up libglib2.0-data (2.82.2-3) ... 335s Setting up vim-common (2:9.1.0861-1ubuntu1) ... 335s Setting up xz-utils (5.6.3-1) ... 335s Setting up gir1.2-glib-2.0:ppc64el (2.82.2-3) ... 335s Setting up lxd-installer (10) ... 335s Setting up dracut-install (105-2ubuntu2) ... 335s Setting up libplymouth5:ppc64el (24.004.60-2ubuntu3) ... 335s Setting up libgirepository-1.0-1:ppc64el (1.82.0-2) ... 335s Setting up curl (8.9.1-2ubuntu3) ... 335s Setting up libpython3-stdlib:ppc64el (3.12.7-1) ... 335s Setting up sg3-utils (1.48-0ubuntu1) ... 335s Setting up openssh-sftp-server (1:9.9p1-3ubuntu2) ... 335s Setting up openssh-server (1:9.9p1-3ubuntu2) ... 335s Installing new version of config file /etc/ssh/moduli ... 335s Replacing config file /etc/ssh/sshd_config with new version 336s Setting up plymouth (24.004.60-2ubuntu3) ... 336s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 336s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 344s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 344s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 345s Setting up lsvpd (1.7.14-1ubuntu3) ... 345s Setting up python3 (3.12.7-1) ... 345s Setting up vim-tiny (2:9.1.0861-1ubuntu1) ... 345s Setting up sg3-utils-udev (1.48-0ubuntu1) ... 345s update-initramfs: deferring update (trigger activated) 345s Setting up plymouth-theme-ubuntu-text (24.004.60-2ubuntu3) ... 345s update-initramfs: deferring update (trigger activated) 345s Setting up gir1.2-girepository-2.0:ppc64el (1.82.0-2) ... 345s Setting up python3-gi (3.50.0-3build1) ... 345s Setting up python3-rpds-py (0.21.0-2ubuntu1) ... 345s Setting up python3-jsonschema-specifications (2023.12.1-2) ... 346s Setting up python3-blinker (1.9.0-1) ... 346s Setting up python3-dbus (1.3.2-5build4) ... 346s Setting up python3-debconf (1.5.87ubuntu1) ... 346s Setting up python3-yaml (6.0.2-1build1) ... 346s Processing triggers for man-db (2.13.0-1) ... 348s Processing triggers for debianutils (5.21) ... 348s Processing triggers for install-info (7.1.1-1) ... 348s Processing triggers for initramfs-tools (0.142ubuntu35) ... 348s update-initramfs: Generating /boot/initrd.img-6.11.0-8-generic 348s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 355s Processing triggers for libc-bin (2.40-1ubuntu3) ... 355s Processing triggers for ufw (0.36.2-8) ... 355s Reading package lists... 355s Building dependency tree... 355s Reading state information... 356s The following packages will be REMOVED: 356s libsgutils2-1.46-2* 356s 0 upgraded, 0 newly installed, 1 to remove and 0 not upgraded. 356s After this operation, 380 kB disk space will be freed. 356s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73882 files and directories currently installed.) 356s Removing libsgutils2-1.46-2:ppc64el (1.46-3ubuntu5) ... 356s Processing triggers for libc-bin (2.40-1ubuntu3) ... 356s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 356s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 356s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 356s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 357s Reading package lists... 357s Reading package lists... 358s Building dependency tree... 358s Reading state information... 358s Calculating upgrade... 358s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 358s Reading package lists... 358s Building dependency tree... 358s Reading state information... 358s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 359s autopkgtest [23:29:20]: rebooting testbed after setup commands that affected boot 392s Reading package lists... 392s Building dependency tree... 392s Reading state information... 392s Starting pkgProblemResolver with broken count: 0 392s Starting 2 pkgProblemResolver with broken count: 0 392s Done 392s The following additional packages will be installed: 392s pyfastx python3-importlib-metadata python3-packaging python3-pyfaidx 392s python3-pyfastx 392s Recommended packages: 392s python3-biopython 392s The following NEW packages will be installed: 392s autopkgtest-satdep pyfastx python3-importlib-metadata python3-packaging 392s python3-pyfaidx python3-pyfastx 392s 0 upgraded, 6 newly installed, 0 to remove and 0 not upgraded. 392s Need to get 287 kB/287 kB of archives. 392s After this operation, 889 kB of additional disk space will be used. 392s Get:1 /tmp/autopkgtest.4iVlaK/2-autopkgtest-satdep.deb autopkgtest-satdep ppc64el 0 [716 B] 393s Get:2 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-importlib-metadata all 8.5.0-1 [20.7 kB] 393s Get:3 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3-packaging all 24.2-1 [51.5 kB] 393s Get:4 http://ftpmaster.internal/ubuntu plucky/universe ppc64el python3-pyfaidx all 0.8.1.3-1 [29.7 kB] 393s Get:5 http://ftpmaster.internal/ubuntu plucky/universe ppc64el python3-pyfastx ppc64el 2.1.0-2 [63.1 kB] 393s Get:6 http://ftpmaster.internal/ubuntu plucky/universe ppc64el pyfastx ppc64el 2.1.0-2 [122 kB] 393s Fetched 287 kB in 0s (598 kB/s) 393s Selecting previously unselected package python3-importlib-metadata. 394s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 73877 files and directories currently installed.) 394s Preparing to unpack .../0-python3-importlib-metadata_8.5.0-1_all.deb ... 394s Unpacking python3-importlib-metadata (8.5.0-1) ... 394s Selecting previously unselected package python3-packaging. 394s Preparing to unpack .../1-python3-packaging_24.2-1_all.deb ... 394s Unpacking python3-packaging (24.2-1) ... 394s Selecting previously unselected package python3-pyfaidx. 394s Preparing to unpack .../2-python3-pyfaidx_0.8.1.3-1_all.deb ... 394s Unpacking python3-pyfaidx (0.8.1.3-1) ... 394s Selecting previously unselected package python3-pyfastx. 394s Preparing to unpack .../3-python3-pyfastx_2.1.0-2_ppc64el.deb ... 394s Unpacking python3-pyfastx (2.1.0-2) ... 394s Selecting previously unselected package pyfastx. 394s Preparing to unpack .../4-pyfastx_2.1.0-2_ppc64el.deb ... 394s Unpacking pyfastx (2.1.0-2) ... 394s Selecting previously unselected package autopkgtest-satdep. 394s Preparing to unpack .../5-2-autopkgtest-satdep.deb ... 394s Unpacking autopkgtest-satdep (0) ... 394s Setting up python3-importlib-metadata (8.5.0-1) ... 394s Setting up python3-packaging (24.2-1) ... 394s Setting up python3-pyfaidx (0.8.1.3-1) ... 394s Setting up python3-pyfastx (2.1.0-2) ... 394s Setting up pyfastx (2.1.0-2) ... 394s Setting up autopkgtest-satdep (0) ... 394s Processing triggers for man-db (2.13.0-1) ... 398s (Reading database ... 73977 files and directories currently installed.) 398s Removing autopkgtest-satdep (0) ... 399s autopkgtest [23:30:00]: test test-cli: [----------------------- 400s $ pyfastx --help 400s usage: pyfastx COMMAND [OPTIONS] 400s 400s A command line tool for FASTA/Q file manipulation 400s 400s options: 400s -h, --help show this help message and exit 400s -v, --version show program's version number and exit 400s 400s Commands: 400s 400s index build index for fasta/q file 400s stat show detailed statistics information of fasta/q file 400s split split fasta/q file into multiple files 400s fq2fa convert fastq file to fasta file 400s subseq get subsequences from fasta file by region 400s sample randomly sample sequences from fasta or fastq file 400s extract extract full sequences or reads from fasta/q file 400s $ # Found pyfastx commands: 'index stat split fq2fa subseq sample extract' 400s $ pyfastx index --help 400s usage: pyfastx index [-h] [-f] fastx [fastx ...] 400s 400s positional arguments: 400s fastx fasta or fastq file, gzip support 400s 400s options: 400s -h, --help show this help message and exit 400s -f, --full build full index, base composition will be calculated 400s $ pyfastx stat --help 400s usage: pyfastx stat [-h] fastx [fastx ...] 400s 400s positional arguments: 400s fastx fasta or fastq file, gzip support 400s 400s options: 400s -h, --help show this help message and exit 400s $ pyfastx split --help 400s usage: pyfastx split [-h] (-n int | -c int) [-o str] fastx 400s 400s positional arguments: 400s fastx fasta or fastq file, gzip support 400s 400s options: 400s -h, --help show this help message and exit 400s -n int split a fasta/q file into N new files with even size 400s -c int split a fasta/q file into multiple files containing 400s the same sequence counts 400s -o str, --out-dir str 400s output directory, default is current folder 400s $ pyfastx fq2fa --help 400s usage: pyfastx fq2fa [-h] [-o str] fastx 400s 400s positional arguments: 400s fastx fastq file, gzip support 400s 400s options: 400s -h, --help show this help message and exit 400s -o str, --out-file str 400s output file, default: output to stdout 400s $ pyfastx subseq --help 400s usage: pyfastx subseq [-h] [-r str | -b str] [-o str] fastx [region ...] 400s 400s positional arguments: 400s fastx input fasta file, gzip support 400s region format is chr:start-end, start and end position is 400s 1-based, multiple regions were separated by space 400s 400s options: 400s -h, --help show this help message and exit 400s -r str, --region-file str 400s tab-delimited file, one region per line, both start 400s and end position are 1-based 400s -b str, --bed-file str 400s tab-delimited BED file, 0-based start position and 400s 1-based end position 400s -o str, --out-file str 400s output file, default: output to stdout 400s $ pyfastx sample --help 400s usage: pyfastx sample [-h] (-n int | -p float) [-s int] [--sequential-read] 400s [-o str] 400s fastx 400s 400s positional arguments: 400s fastx fasta or fastq file, gzip support 400s 400s options: 400s -h, --help show this help message and exit 400s -n int number of sequences to be sampled 400s -p float proportion of sequences to be sampled, 0~1 400s -s int, --seed int random seed, default is the current system time 400s --sequential-read start sequential reading, particularly suitable for 400s sampling large numbers of sequences 400s -o str, --out-file str 400s output file, default: output to stdout 400s $ pyfastx extract --help 400s usage: pyfastx extract [-h] [-l str] [--reverse-complement] [--out-fasta] 400s [-o str] [--sequential-read] 400s fastx [name ...] 400s 400s positional arguments: 400s fastx fasta or fastq file, gzip support 400s name sequence name or read name, multiple names were 400s separated by space 400s 400s options: 400s -h, --help show this help message and exit 400s -l str, --list-file str 400s a file containing sequence or read names, one name per 400s line 400s --reverse-complement output reverse complement sequence 400s --out-fasta output fasta format when extract reads from fastq, 400s default output fastq format 400s -o str, --out-file str 400s output file, default: output to stdout 400s --sequential-read start sequential reading, particularly suitable for 400s extracting large numbers of sequences 400s $ pyfastx --version 401s pyfastx version 2.1.0 401s $ pyfastx index protein.fa 401s $ pyfastx index rna.fa 401s $ pyfastx index test.fa 401s $ pyfastx index test.fq 401s $ pyfastx index test.fa.gz 401s $ pyfastx index test.fq.gz 401s $ pyfastx stat protein.fa 401s fileName seqType seqCounts totalBases GC% avgLen medianLen maxLen minLen N50 L50 401s protein.fa protein 17 2265 - 133.235 80.0 419 23 263 4 401s $ pyfastx split -n 2 protein.fa 402s $ pyfastx fq2fa test.fq -o test.fa 402s $ pyfastx subseq protein.fa UPI0000000011:1-4 402s >UPI0000000011:1-4 402s MVDA 402s $ pyfastx sample -n 1 test.fq.gz -o sample.fq 402s $ pyfastx extract protein.fa UPI0000000011 402s >UPI0000000011 status=active 402s MVDAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIY 402s IPGTIILYATYVKSLLMKS 402s autopkgtest [23:30:03]: test test-cli: -----------------------] 403s autopkgtest [23:30:04]: test test-cli: - - - - - - - - - - results - - - - - - - - - - 403s test-cli PASS 403s autopkgtest [23:30:04]: @@@@@@@@@@@@@@@@@@@@ summary 403s run-unit-test FAIL non-zero exit status 1 403s test-cli PASS 408s nova [W] Using flock in prodstack6-ppc64el 408s Creating nova instance adt-plucky-ppc64el-pyfastx-20241123-224623-juju-7f2275-prod-proposed-migration-environment-15-2b813c41-122b-4b6d-9d8d-a177a6881390 from image adt/ubuntu-plucky-ppc64el-server-20241119.img (UUID dcc6a44c-21fb-45bb-821a-d64a8784c175)... 408s nova [W] Using flock in prodstack6-ppc64el 408s Creating nova instance adt-plucky-ppc64el-pyfastx-20241123-224623-juju-7f2275-prod-proposed-migration-environment-15-2b813c41-122b-4b6d-9d8d-a177a6881390 from image adt/ubuntu-plucky-ppc64el-server-20241119.img (UUID dcc6a44c-21fb-45bb-821a-d64a8784c175)...