0s autopkgtest [16:38:35]: starting date and time: 2024-11-13 16:38:35+0000
  0s autopkgtest [16:38:35]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky
  0s autopkgtest [16:38:35]: host juju-7f2275-prod-proposed-migration-environment-15; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.fzqhsh4f/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults,src:python3-stdlib-extensions --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 python3-stdlib-extensions/3.12.7-1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-ppc64el --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-15@bos03-ppc64el-4.secgroup --name adt-plucky-ppc64el-libedlib-20241113-163835-juju-7f2275-prod-proposed-migration-environment-15-1d9a1538-964d-43d2-abad-c8aa53177a73 --image adt/ubuntu-plucky-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-15 --net-id=net_prod-proposed-migration-ppc64el -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/
146s autopkgtest [16:41:01]: testbed dpkg architecture: ppc64el
147s autopkgtest [16:41:02]: testbed apt version: 2.9.8
147s autopkgtest [16:41:02]: @@@@@@@@@@@@@@@@@@@@ test bed setup
148s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB]
148s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [104 kB]
148s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [950 kB]
148s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [17.2 kB]
148s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B]
148s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el Packages [111 kB]
148s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe ppc64el Packages [660 kB]
148s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse ppc64el Packages [20.8 kB]
149s Fetched 1944 kB in 1s (1857 kB/s)
149s Reading package lists...
151s Reading package lists...
152s Building dependency tree...
152s Reading state information...
152s Calculating upgrade...
152s The following NEW packages will be installed:
152s   python3.13-gdbm
152s The following packages will be upgraded:
152s   libgnutls30t64 libjson-glib-1.0-0 libjson-glib-1.0-common libpython3-stdlib
152s   libutempter0 python3 python3-gdbm python3-minimal
153s 8 upgraded, 1 newly installed, 0 to remove and 0 not upgraded.
153s Need to get 1265 kB of archives.
153s After this operation, 141 kB of additional disk space will be used.
153s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3-minimal ppc64el 3.12.7-1 [27.4 kB]
153s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3 ppc64el 3.12.7-1 [24.0 kB]
153s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el libpython3-stdlib ppc64el 3.12.7-1 [10.0 kB]
153s Get:4 http://ftpmaster.internal/ubuntu plucky/main ppc64el libgnutls30t64 ppc64el 3.8.8-2ubuntu1 [1072 kB]
153s Get:5 http://ftpmaster.internal/ubuntu plucky/main ppc64el python3.13-gdbm ppc64el 3.13.0-2 [31.5 kB]
153s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main ppc64el python3-gdbm ppc64el 3.12.7-1 [8640 B]
153s Get:7 http://ftpmaster.internal/ubuntu plucky/main ppc64el libjson-glib-1.0-common all 1.10.0+ds-3 [5586 B]
153s Get:8 http://ftpmaster.internal/ubuntu plucky/main ppc64el libjson-glib-1.0-0 ppc64el 1.10.0+ds-3 [76.0 kB]
153s Get:9 http://ftpmaster.internal/ubuntu plucky/main ppc64el libutempter0 ppc64el 1.2.1-4 [9850 B]
154s Fetched 1265 kB in 1s (2135 kB/s)
154s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 73767 files and directories currently installed.)
154s Preparing to unpack .../python3-minimal_3.12.7-1_ppc64el.deb ...
154s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ...
154s Setting up python3-minimal (3.12.7-1) ...
154s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 73767 files and directories currently installed.)
154s Preparing to unpack .../python3_3.12.7-1_ppc64el.deb ...
154s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ...
155s Preparing to unpack .../libpython3-stdlib_3.12.7-1_ppc64el.deb ...
155s Unpacking libpython3-stdlib:ppc64el (3.12.7-1) over (3.12.6-0ubuntu1) ...
155s Preparing to unpack .../libgnutls30t64_3.8.8-2ubuntu1_ppc64el.deb ...
155s Unpacking libgnutls30t64:ppc64el (3.8.8-2ubuntu1) over (3.8.6-2ubuntu1) ...
155s Setting up libgnutls30t64:ppc64el (3.8.8-2ubuntu1) ...
155s Selecting previously unselected package python3.13-gdbm.
155s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 73767 files and directories currently installed.)
155s Preparing to unpack .../python3.13-gdbm_3.13.0-2_ppc64el.deb ...
155s Unpacking python3.13-gdbm (3.13.0-2) ...
155s Preparing to unpack .../python3-gdbm_3.12.7-1_ppc64el.deb ...
155s Unpacking python3-gdbm:ppc64el (3.12.7-1) over (3.12.6-1ubuntu1) ...
155s Preparing to unpack .../libjson-glib-1.0-common_1.10.0+ds-3_all.deb ...
155s Unpacking libjson-glib-1.0-common (1.10.0+ds-3) over (1.10.0+ds-2) ...
155s Preparing to unpack .../libjson-glib-1.0-0_1.10.0+ds-3_ppc64el.deb ...
155s Unpacking libjson-glib-1.0-0:ppc64el (1.10.0+ds-3) over (1.10.0+ds-2) ...
155s Preparing to unpack .../libutempter0_1.2.1-4_ppc64el.deb ...
155s Unpacking libutempter0:ppc64el (1.2.1-4) over (1.2.1-3build1) ...
155s Setting up libutempter0:ppc64el (1.2.1-4) ...
155s Setting up libjson-glib-1.0-common (1.10.0+ds-3) ...
155s Setting up python3.13-gdbm (3.13.0-2) ...
155s Setting up libpython3-stdlib:ppc64el (3.12.7-1) ...
155s Setting up python3 (3.12.7-1) ...
155s Setting up libjson-glib-1.0-0:ppc64el (1.10.0+ds-3) ...
155s Setting up python3-gdbm:ppc64el (3.12.7-1) ...
155s Processing triggers for man-db (2.12.1-3) ...
157s Processing triggers for libc-bin (2.40-1ubuntu3) ...
157s Reading package lists...
158s Building dependency tree...
158s Reading state information...
158s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
158s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease
159s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease
159s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease
159s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease
160s Reading package lists...
160s Reading package lists...
160s Building dependency tree...
160s Reading state information...
161s Calculating upgrade...
161s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
161s Reading package lists...
161s Building dependency tree...
161s Reading state information...
162s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
164s autopkgtest [16:41:19]: testbed running kernel: Linux 6.11.0-8-generic #8-Ubuntu SMP Mon Sep 16 13:49:23 UTC 2024
165s autopkgtest [16:41:20]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib
169s Get:1 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (dsc) [2389 B]
169s Get:2 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (tar) [4319 kB]
169s Get:3 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (diff) [7604 B]
169s gpgv: Signature made Sat Jul 13 18:52:01 2024 UTC
169s gpgv:                using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA
169s gpgv:                issuer "emollier@debian.org"
169s gpgv: Can't check signature: No public key
169s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6.dsc: no acceptable signature found
169s autopkgtest [16:41:24]: testing package libedlib version 1.2.7-6
170s autopkgtest [16:41:25]: build not needed
179s autopkgtest [16:41:34]: test run-unit-test: preparing testbed
180s Reading package lists...
181s Building dependency tree...
181s Reading state information...
181s Starting pkgProblemResolver with broken count: 0
181s Starting 2 pkgProblemResolver with broken count: 0
181s Done
181s The following additional packages will be installed:
181s   edlib-aligner libedlib-dev libedlib1 python3-edlib
181s The following NEW packages will be installed:
181s   autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib
181s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded.
181s Need to get 154 kB/155 kB of archives.
181s After this operation, 481 kB of additional disk space will be used.
181s Get:1 /tmp/autopkgtest.a4mX0s/1-autopkgtest-satdep.deb autopkgtest-satdep ppc64el 0 [736 B]
182s Get:2 http://ftpmaster.internal/ubuntu plucky/universe ppc64el libedlib1 ppc64el 1.2.7-6 [22.7 kB]
182s Get:3 http://ftpmaster.internal/ubuntu plucky/universe ppc64el edlib-aligner ppc64el 1.2.7-6 [29.2 kB]
182s Get:4 http://ftpmaster.internal/ubuntu plucky/universe ppc64el libedlib-dev ppc64el 1.2.7-6 [26.9 kB]
182s Get:5 http://ftpmaster.internal/ubuntu plucky/universe ppc64el python3-edlib ppc64el 1.2.7-6 [75.2 kB]
182s Fetched 154 kB in 0s (358 kB/s)
182s Selecting previously unselected package libedlib1:ppc64el.
182s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 73774 files and directories currently installed.)
182s Preparing to unpack .../libedlib1_1.2.7-6_ppc64el.deb ...
182s Unpacking libedlib1:ppc64el (1.2.7-6) ...
182s Selecting previously unselected package edlib-aligner.
182s Preparing to unpack .../edlib-aligner_1.2.7-6_ppc64el.deb ...
182s Unpacking edlib-aligner (1.2.7-6) ...
182s Selecting previously unselected package libedlib-dev:ppc64el.
182s Preparing to unpack .../libedlib-dev_1.2.7-6_ppc64el.deb ...
182s Unpacking libedlib-dev:ppc64el (1.2.7-6) ...
182s Selecting previously unselected package python3-edlib:ppc64el.
182s Preparing to unpack .../python3-edlib_1.2.7-6_ppc64el.deb ...
182s Unpacking python3-edlib:ppc64el (1.2.7-6) ...
182s Selecting previously unselected package autopkgtest-satdep.
182s Preparing to unpack .../1-autopkgtest-satdep.deb ...
182s Unpacking autopkgtest-satdep (0) ...
183s Setting up libedlib1:ppc64el (1.2.7-6) ...
183s Setting up python3-edlib:ppc64el (1.2.7-6) ...
183s Setting up edlib-aligner (1.2.7-6) ...
183s Setting up libedlib-dev:ppc64el (1.2.7-6) ...
183s Setting up autopkgtest-satdep (0) ...
183s Processing triggers for man-db (2.12.1-3) ...
183s Processing triggers for libc-bin (2.40-1ubuntu3) ...
186s (Reading database ... 73810 files and directories currently installed.)
186s Removing autopkgtest-satdep (0) ...
187s autopkgtest [16:41:42]: test run-unit-test: [-----------------------
187s Using NW alignment mode.
187s Reading queries...
187s Read 1 queries, 110 residues total.
187s Reading target fasta file...
187s Read target, 109 residues.
187s 
187s Comparing queries to target...
187s 
187s Query #0 (110 residues): score = 17
187s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48)
187s    ||||||| |   |||||||||| |||||||||||||||||||||||||||
187s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46)
187s 
187s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92)
187s    | ||||||||||||   || ||||||||||  ||||||||| |||||| |
187s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94)
187s 
187s T: AESIKSKKKKKE-STTB (93 - 108)
187s     ||||||||||| ||| 
187s Q: -ESIKSKKKKKENSTT- (94 - 109)
187s 
187s 
187s Cpu time of searching: 0.000074
187s autopkgtest [16:41:42]: test run-unit-test: -----------------------]
188s run-unit-test        PASS
188s autopkgtest [16:41:43]: test run-unit-test:  - - - - - - - - - - results - - - - - - - - - -
188s autopkgtest [16:41:43]: @@@@@@@@@@@@@@@@@@@@ summary
188s run-unit-test        PASS
199s nova [W] Using flock in prodstack6-ppc64el
199s Creating nova instance adt-plucky-ppc64el-libedlib-20241113-163835-juju-7f2275-prod-proposed-migration-environment-15-1d9a1538-964d-43d2-abad-c8aa53177a73 from image adt/ubuntu-plucky-ppc64el-server-20241113.img (UUID 0c5715b6-5cca-4485-b8bf-b85dfd917a5f)...