0s autopkgtest [19:31:54]: starting date and time: 2024-11-13 19:31:54+0000 0s autopkgtest [19:31:54]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [19:31:54]: host juju-7f2275-prod-proposed-migration-environment-9; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.ti070qqd/out --timeout-copy=6000 --setup-commands 'ln -s /dev/null /etc/systemd/system/bluetooth.service; printf "http_proxy=http://squid.internal:3128\nhttps_proxy=http://squid.internal:3128\nno_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com\n" >> /etc/environment' --apt-pocket=proposed=src:python3-defaults,src:python3-stdlib-extensions --apt-upgrade pyfastx --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 python3-stdlib-extensions/3.12.7-1' -- lxd -r lxd-armhf-10.145.243.234 lxd-armhf-10.145.243.234:autopkgtest/ubuntu/plucky/armhf 51s autopkgtest [19:32:45]: testbed dpkg architecture: armhf 53s autopkgtest [19:32:47]: testbed apt version: 2.9.8 53s autopkgtest [19:32:47]: @@@@@@@@@@@@@@@@@@@@ test bed setup 61s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 62s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [17.2 kB] 62s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [958 kB] 62s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 62s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [98.3 kB] 62s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Packages [101 kB] 62s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Packages [647 kB] 62s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Packages [17.2 kB] 62s Fetched 1919 kB in 1s (1916 kB/s) 62s Reading package lists... 80s tee: /proc/self/fd/2: Permission denied 101s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 101s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 102s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 102s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 103s Reading package lists... 103s Reading package lists... 104s Building dependency tree... 104s Reading state information... 105s Calculating upgrade... 107s The following packages were automatically installed and are no longer required: 107s libperl5.38t64 perl-modules-5.38 python3-netifaces 107s Use 'apt autoremove' to remove them. 107s The following NEW packages will be installed: 107s libperl5.40 perl-modules-5.40 python3.13-gdbm systemd-cryptsetup 107s The following packages will be upgraded: 107s apport apport-core-dump-handler base-files base-passwd bash-completion 107s dhcpcd-base distro-info-data dpkg dpkg-dev fwupd gcc-14-base info 107s install-info iproute2 libarchive13t64 libatomic1 libattr1 107s libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 libblockdev-mdraid3 107s libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 libblockdev-utils3 107s libblockdev3 libbpf1 libbsd0 libbytesize-common libbytesize1 libdb5.3t64 107s libdpkg-perl libdrm-common libdrm2 libdw1t64 libedit2 libelf1t64 libevdev2 107s libfastjson4 libflashrom1 libftdi1-2 libfwupd2 libgcc-s1 libgnutls30t64 107s libgpgme11t64 libinih1 libjson-c5 libjson-glib-1.0-0 libjson-glib-1.0-common 107s libkeyutils1 libldap-common libldap2 liblocale-gettext-perl libmaxminddb0 107s libmnl0 libnetfilter-conntrack3 libnetplan1 libnewt0.52 libnghttp2-14 107s libnspr4 libnss-systemd libnvme1t64 libpam-systemd libpipeline1 libplymouth5 107s libpng16-16t64 libpopt0 libpython3-stdlib libpython3.12-minimal 107s libpython3.12-stdlib libsgutils2-1.46-2 libssh2-1t64 libstdc++6 107s libsystemd-shared libsystemd0 libtext-charwidth-perl libtext-iconv-perl 107s libtraceevent1 libtraceevent1-plugin libudev1 libudisks2-0 liburcu8t64 107s libutempter0 libuv1t64 libx11-6 libx11-data libxau6 libxmlb2 mawk 107s motd-news-config nano netplan-generator netplan.io openssh-client 107s openssh-server openssh-sftp-server pci.ids perl perl-base plymouth 107s plymouth-theme-ubuntu-text python3 python3-apport python3-certifi 107s python3-cffi-backend python3-configobj python3-gdbm python3-gi python3-idna 107s python3-jaraco.functools python3-json-pointer python3-jsonpatch 107s python3-lazr.restfulclient python3-lazr.uri python3-minimal 107s python3-more-itertools python3-netplan python3-newt python3-oauthlib 107s python3-problem-report python3-typeguard python3-urllib3 python3-wadllib 107s python3-zipp python3.12 python3.12-gdbm python3.12-minimal sg3-utils 107s sg3-utils-udev ssh-import-id systemd systemd-resolved systemd-sysv 107s systemd-timesyncd tzdata udev udisks2 ufw usbutils vim-common vim-tiny 107s whiptail xxd 107s 143 upgraded, 4 newly installed, 0 to remove and 0 not upgraded. 107s Need to get 45.5 MB of archives. 107s After this operation, 43.2 MB of additional disk space will be used. 107s Get:1 http://ftpmaster.internal/ubuntu plucky/main armhf motd-news-config all 13.5ubuntu3 [5190 B] 107s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf base-files armhf 13.5ubuntu3 [75.1 kB] 107s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg armhf 1.22.11ubuntu3 [1247 kB] 107s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf perl-modules-5.40 all 5.40.0-7 [3214 kB] 107s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libperl5.40 armhf 5.40.0-7 [4139 kB] 108s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf perl armhf 5.40.0-7 [263 kB] 108s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf perl-base armhf 5.40.0-7 [1674 kB] 108s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf liblocale-gettext-perl armhf 1.07-7build1 [15.0 kB] 108s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-iconv-perl armhf 1.7-8build4 [12.8 kB] 108s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-charwidth-perl armhf 0.04-11build4 [9128 B] 108s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf libdb5.3t64 armhf 5.3.28+dfsg2-9 [655 kB] 108s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf base-passwd armhf 3.6.5 [53.2 kB] 108s Get:13 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-minimal armhf 3.12.7-1 [27.4 kB] 108s Get:14 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3 armhf 3.12.7-1 [24.0 kB] 108s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf tzdata all 2024b-1ubuntu2 [274 kB] 108s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12 armhf 3.12.7-3 [661 kB] 108s Get:17 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-stdlib armhf 3.12.7-3 [1934 kB] 108s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-minimal armhf 3.12.7-3 [2012 kB] 108s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-minimal armhf 3.12.7-3 [822 kB] 108s Get:20 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libpython3-stdlib armhf 3.12.7-1 [10.0 kB] 108s Get:21 http://ftpmaster.internal/ubuntu plucky/main armhf libnss-systemd armhf 256.5-2ubuntu4 [155 kB] 108s Get:22 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-timesyncd armhf 256.5-2ubuntu4 [40.7 kB] 108s Get:23 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-resolved armhf 256.5-2ubuntu4 [309 kB] 108s Get:24 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd-shared armhf 256.5-2ubuntu4 [2129 kB] 108s Get:25 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd0 armhf 256.5-2ubuntu4 [428 kB] 108s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-sysv armhf 256.5-2ubuntu4 [11.9 kB] 108s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf libpam-systemd armhf 256.5-2ubuntu4 [226 kB] 108s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf systemd armhf 256.5-2ubuntu4 [3442 kB] 108s Get:29 http://ftpmaster.internal/ubuntu plucky/main armhf udev armhf 256.5-2ubuntu4 [1949 kB] 108s Get:30 http://ftpmaster.internal/ubuntu plucky/main armhf libudev1 armhf 256.5-2ubuntu4 [188 kB] 108s Get:31 http://ftpmaster.internal/ubuntu plucky/main armhf python3-problem-report all 2.30.0-0ubuntu5 [25.0 kB] 108s Get:32 http://ftpmaster.internal/ubuntu plucky/main armhf python3-apport all 2.30.0-0ubuntu5 [93.2 kB] 108s Get:33 http://ftpmaster.internal/ubuntu plucky/main armhf python3-gi armhf 3.50.0-3 [227 kB] 108s Get:34 http://ftpmaster.internal/ubuntu plucky/main armhf apport-core-dump-handler all 2.30.0-0ubuntu5 [17.9 kB] 108s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf apport all 2.30.0-0ubuntu5 [83.0 kB] 108s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf libbsd0 armhf 0.12.2-2 [36.8 kB] 108s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf libedit2 armhf 3.1-20240808-1 [79.0 kB] 108s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-sftp-server armhf 1:9.7p1-7ubuntu5 [35.4 kB] 108s Get:39 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-server armhf 1:9.7p1-7ubuntu5 [505 kB] 108s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-client armhf 1:9.7p1-7ubuntu5 [889 kB] 108s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf libatomic1 armhf 14.2.0-8ubuntu1 [7846 B] 108s Get:42 http://ftpmaster.internal/ubuntu plucky/main armhf gcc-14-base armhf 14.2.0-8ubuntu1 [51.5 kB] 108s Get:43 http://ftpmaster.internal/ubuntu plucky/main armhf libstdc++6 armhf 14.2.0-8ubuntu1 [711 kB] 108s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf libgcc-s1 armhf 14.2.0-8ubuntu1 [40.8 kB] 108s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf libattr1 armhf 1:2.5.2-2 [10.5 kB] 108s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf libgnutls30t64 armhf 3.8.8-2ubuntu1 [955 kB] 108s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf install-info armhf 7.1.1-1 [61.4 kB] 108s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf mawk armhf 1.3.4.20240905-1 [116 kB] 108s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf dhcpcd-base armhf 1:10.1.0-2 [188 kB] 108s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf distro-info-data all 0.63 [6588 B] 108s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf libdw1t64 armhf 0.192-4 [243 kB] 108s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf libelf1t64 armhf 0.192-4 [50.2 kB] 108s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libbpf1 armhf 1:1.5.0-1 [158 kB] 108s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libmnl0 armhf 1.0.5-3 [10.7 kB] 108s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf iproute2 armhf 6.10.0-2ubuntu1 [1082 kB] 108s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf libfastjson4 armhf 1.2304.0-2 [20.2 kB] 108s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-c5 armhf 0.18+ds-1 [33.2 kB] 108s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf libkeyutils1 armhf 1.6.3-4ubuntu2 [8712 B] 108s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf netplan-generator armhf 1.1.1-1 [60.4 kB] 108s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf python3-cffi-backend armhf 1.17.1-2 [68.7 kB] 108s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf python3-netplan armhf 1.1.1-1 [24.1 kB] 108s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf netplan.io armhf 1.1.1-1 [66.4 kB] 108s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libnetplan1 armhf 1.1.1-1 [122 kB] 108s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf python3-newt armhf 0.52.24-2ubuntu4 [19.7 kB] 108s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf libnewt0.52 armhf 0.52.24-2ubuntu4 [39.2 kB] 108s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf libpopt0 armhf 1.19+dfsg-2 [25.4 kB] 108s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf vim-tiny armhf 2:9.1.0777-1ubuntu1 [693 kB] 108s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf vim-common all 2:9.1.0777-1ubuntu1 [394 kB] 109s Get:69 http://ftpmaster.internal/ubuntu plucky/main armhf whiptail armhf 0.52.24-2ubuntu4 [17.2 kB] 109s Get:70 http://ftpmaster.internal/ubuntu plucky/main armhf xxd armhf 2:9.1.0777-1ubuntu1 [66.8 kB] 109s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf bash-completion all 1:2.14.0-2 [210 kB] 109s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf info armhf 7.1.1-1 [126 kB] 109s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-common all 2.4.123-1 [8436 B] 109s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm2 armhf 2.4.123-1 [36.5 kB] 109s Get:75 http://ftpmaster.internal/ubuntu plucky/main armhf libevdev2 armhf 1.13.3+dfsg-1 [29.7 kB] 109s Get:76 http://ftpmaster.internal/ubuntu plucky/main armhf libmaxminddb0 armhf 1.11.0-1 [16.8 kB] 109s Get:77 http://ftpmaster.internal/ubuntu plucky/main armhf libnetfilter-conntrack3 armhf 1.1.0-1 [38.4 kB] 109s Get:78 http://ftpmaster.internal/ubuntu plucky/main armhf libnghttp2-14 armhf 1.64.0-1 [68.9 kB] 109s Get:79 http://ftpmaster.internal/ubuntu plucky/main armhf libpipeline1 armhf 1.5.8-1 [26.9 kB] 109s Get:80 http://ftpmaster.internal/ubuntu plucky/main armhf libpng16-16t64 armhf 1.6.44-2 [168 kB] 109s Get:81 http://ftpmaster.internal/ubuntu plucky/main armhf libplymouth5 armhf 24.004.60-1ubuntu11 [140 kB] 109s Get:82 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1-plugin armhf 1:1.8.3-1ubuntu1 [18.1 kB] 109s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1 armhf 1:1.8.3-1ubuntu1 [52.1 kB] 109s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf liburcu8t64 armhf 0.14.1-1 [56.6 kB] 109s Get:85 http://ftpmaster.internal/ubuntu plucky/main armhf libuv1t64 armhf 1.48.0-7 [83.3 kB] 109s Get:86 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-data all 2:1.8.10-2 [116 kB] 109s Get:87 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-6 armhf 2:1.8.10-2 [587 kB] 109s Get:88 http://ftpmaster.internal/ubuntu plucky/main armhf libxau6 armhf 1:1.0.11-1 [6558 B] 109s Get:89 http://ftpmaster.internal/ubuntu plucky/main armhf nano armhf 8.2-1 [276 kB] 109s Get:90 http://ftpmaster.internal/ubuntu plucky/main armhf pci.ids all 0.0~2024.10.24-1 [279 kB] 109s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-1ubuntu11 [9920 B] 109s Get:92 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth armhf 24.004.60-1ubuntu11 [142 kB] 109s Get:93 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-gdbm armhf 3.12.7-3 [28.7 kB] 109s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-gdbm armhf 3.13.0-2 [29.5 kB] 109s Get:95 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-gdbm armhf 3.12.7-1 [8642 B] 109s Get:96 http://ftpmaster.internal/ubuntu plucky/main armhf ufw all 0.36.2-8 [170 kB] 109s Get:97 http://ftpmaster.internal/ubuntu plucky/main armhf usbutils armhf 1:018-1 [76.1 kB] 109s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg-dev all 1.22.11ubuntu3 [1088 kB] 109s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libdpkg-perl all 1.22.11ubuntu3 [279 kB] 109s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libarchive13t64 armhf 3.7.4-1.1 [331 kB] 109s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libftdi1-2 armhf 1.5-7 [25.7 kB] 109s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libflashrom1 armhf 1.4.0-3ubuntu1 [141 kB] 109s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-common all 1.10.0+ds-3 [5586 B] 109s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-0 armhf 1.10.0+ds-3 [61.7 kB] 109s Get:105 http://ftpmaster.internal/ubuntu plucky/main armhf libfwupd2 armhf 1.9.26-2 [125 kB] 109s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf libxmlb2 armhf 0.3.21-1 [57.7 kB] 109s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf fwupd armhf 1.9.26-2 [4404 kB] 110s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-utils3 armhf 3.2.1-1 [17.4 kB] 110s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-crypto3 armhf 3.2.1-1 [22.4 kB] 110s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-fs3 armhf 3.2.1-1 [34.3 kB] 110s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-loop3 armhf 3.2.1-1 [6552 B] 110s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize1 armhf 2.11-1ubuntu1 [12.0 kB] 110s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize-common all 2.11-1ubuntu1 [3584 B] 110s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-mdraid3 armhf 3.2.1-1 [13.4 kB] 110s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf libnvme1t64 armhf 1.11-1 [73.8 kB] 110s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-nvme3 armhf 3.2.1-1 [17.6 kB] 110s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-part3 armhf 3.2.1-1 [16.5 kB] 110s Get:118 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-swap3 armhf 3.2.1-1 [8952 B] 110s Get:119 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev3 armhf 3.2.1-1 [44.2 kB] 110s Get:120 http://ftpmaster.internal/ubuntu plucky/main armhf libgpgme11t64 armhf 1.23.2-5ubuntu4 [123 kB] 110s Get:121 http://ftpmaster.internal/ubuntu plucky/main armhf libinih1 armhf 58-1ubuntu1 [6750 B] 110s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf libldap-common all 2.6.8+dfsg-1~exp4ubuntu3 [32.3 kB] 110s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf libldap2 armhf 2.6.8+dfsg-1~exp4ubuntu3 [173 kB] 110s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf libnspr4 armhf 2:4.35-1.1ubuntu2 [94.1 kB] 110s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf libsgutils2-1.46-2 armhf 1.46-3ubuntu5 [82.5 kB] 110s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf libssh2-1t64 armhf 1.11.1-1 [116 kB] 110s Get:127 http://ftpmaster.internal/ubuntu plucky/main armhf udisks2 armhf 2.10.1-11ubuntu1 [278 kB] 110s Get:128 http://ftpmaster.internal/ubuntu plucky/main armhf libudisks2-0 armhf 2.10.1-11ubuntu1 [142 kB] 110s Get:129 http://ftpmaster.internal/ubuntu plucky/main armhf libutempter0 armhf 1.2.1-4 [9062 B] 110s Get:130 http://ftpmaster.internal/ubuntu plucky/main armhf python3-certifi all 2024.8.30+dfsg-1 [9742 B] 110s Get:131 http://ftpmaster.internal/ubuntu plucky/main armhf python3-configobj all 5.0.9-1 [33.9 kB] 110s Get:132 http://ftpmaster.internal/ubuntu plucky/main armhf python3-idna all 3.8-2 [47.0 kB] 110s Get:133 http://ftpmaster.internal/ubuntu plucky/main armhf python3-more-itertools all 10.5.0-1 [56.2 kB] 110s Get:134 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jaraco.functools all 4.1.0-1 [11.8 kB] 110s Get:135 http://ftpmaster.internal/ubuntu plucky/main armhf python3-json-pointer all 2.4-2 [8396 B] 110s Get:136 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jsonpatch all 1.32-4 [12.2 kB] 110s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.uri all 1.0.6-4 [13.6 kB] 110s Get:138 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wadllib all 2.0.0-1 [36.7 kB] 110s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf python3-oauthlib all 3.2.2-2 [89.8 kB] 110s Get:140 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.restfulclient all 0.14.6-2 [50.9 kB] 110s Get:141 http://ftpmaster.internal/ubuntu plucky/main armhf python3-typeguard all 4.4.1-1 [29.0 kB] 110s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf python3-urllib3 all 2.0.7-2ubuntu0.1 [93.1 kB] 110s Get:143 http://ftpmaster.internal/ubuntu plucky/main armhf python3-zipp all 3.21.0-1 [10.2 kB] 110s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils armhf 1.46-3ubuntu5 [816 kB] 110s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils-udev all 1.46-3ubuntu5 [5916 B] 110s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-cryptsetup armhf 256.5-2ubuntu4 [122 kB] 110s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf ssh-import-id all 5.11-0ubuntu3 [10.1 kB] 111s Preconfiguring packages ... 111s Fetched 45.5 MB in 3s (13.3 MB/s) 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 111s Preparing to unpack .../motd-news-config_13.5ubuntu3_all.deb ... 111s Unpacking motd-news-config (13.5ubuntu3) over (13.3ubuntu6) ... 111s Preparing to unpack .../base-files_13.5ubuntu3_armhf.deb ... 111s Unpacking base-files (13.5ubuntu3) over (13.3ubuntu6) ... 111s Setting up base-files (13.5ubuntu3) ... 111s Installing new version of config file /etc/issue ... 111s Installing new version of config file /etc/issue.net ... 111s Installing new version of config file /etc/lsb-release ... 112s motd-news.service is a disabled or a static unit not running, not starting it. 112s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 112s Preparing to unpack .../dpkg_1.22.11ubuntu3_armhf.deb ... 112s Unpacking dpkg (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 112s Setting up dpkg (1.22.11ubuntu3) ... 113s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 113s Preparing to unpack .../perl_5.40.0-7_armhf.deb ... 113s Unpacking perl (5.40.0-7) over (5.38.2-5) ... 113s Selecting previously unselected package perl-modules-5.40. 113s Preparing to unpack .../perl-modules-5.40_5.40.0-7_all.deb ... 113s Unpacking perl-modules-5.40 (5.40.0-7) ... 113s Selecting previously unselected package libperl5.40:armhf. 113s Preparing to unpack .../libperl5.40_5.40.0-7_armhf.deb ... 113s Unpacking libperl5.40:armhf (5.40.0-7) ... 113s Preparing to unpack .../perl-base_5.40.0-7_armhf.deb ... 113s Unpacking perl-base (5.40.0-7) over (5.38.2-5) ... 113s Setting up perl-base (5.40.0-7) ... 113s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 113s Preparing to unpack .../liblocale-gettext-perl_1.07-7build1_armhf.deb ... 113s Unpacking liblocale-gettext-perl (1.07-7build1) over (1.07-7) ... 113s Preparing to unpack .../libtext-iconv-perl_1.7-8build4_armhf.deb ... 113s Unpacking libtext-iconv-perl:armhf (1.7-8build4) over (1.7-8build3) ... 114s Preparing to unpack .../libtext-charwidth-perl_0.04-11build4_armhf.deb ... 114s Unpacking libtext-charwidth-perl:armhf (0.04-11build4) over (0.04-11build3) ... 114s Preparing to unpack .../libdb5.3t64_5.3.28+dfsg2-9_armhf.deb ... 114s Unpacking libdb5.3t64:armhf (5.3.28+dfsg2-9) over (5.3.28+dfsg2-7) ... 114s Setting up libdb5.3t64:armhf (5.3.28+dfsg2-9) ... 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 114s Preparing to unpack .../base-passwd_3.6.5_armhf.deb ... 114s Unpacking base-passwd (3.6.5) over (3.6.4) ... 114s Setting up base-passwd (3.6.5) ... 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 114s Preparing to unpack .../python3-minimal_3.12.7-1_armhf.deb ... 114s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 114s Setting up python3-minimal (3.12.7-1) ... 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 114s Preparing to unpack .../00-python3_3.12.7-1_armhf.deb ... 114s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 114s Preparing to unpack .../01-tzdata_2024b-1ubuntu2_all.deb ... 114s Unpacking tzdata (2024b-1ubuntu2) over (2024a-4ubuntu1) ... 114s Preparing to unpack .../02-python3.12_3.12.7-3_armhf.deb ... 114s Unpacking python3.12 (3.12.7-3) over (3.12.7-1) ... 114s Preparing to unpack .../03-libpython3.12-stdlib_3.12.7-3_armhf.deb ... 114s Unpacking libpython3.12-stdlib:armhf (3.12.7-3) over (3.12.7-1) ... 115s Preparing to unpack .../04-python3.12-minimal_3.12.7-3_armhf.deb ... 115s Unpacking python3.12-minimal (3.12.7-3) over (3.12.7-1) ... 115s Preparing to unpack .../05-libpython3.12-minimal_3.12.7-3_armhf.deb ... 115s Unpacking libpython3.12-minimal:armhf (3.12.7-3) over (3.12.7-1) ... 115s Preparing to unpack .../06-libpython3-stdlib_3.12.7-1_armhf.deb ... 115s Unpacking libpython3-stdlib:armhf (3.12.7-1) over (3.12.6-0ubuntu1) ... 115s Preparing to unpack .../07-libnss-systemd_256.5-2ubuntu4_armhf.deb ... 115s Unpacking libnss-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Preparing to unpack .../08-systemd-timesyncd_256.5-2ubuntu4_armhf.deb ... 115s Unpacking systemd-timesyncd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Preparing to unpack .../09-systemd-resolved_256.5-2ubuntu4_armhf.deb ... 115s Unpacking systemd-resolved (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Preparing to unpack .../10-libsystemd-shared_256.5-2ubuntu4_armhf.deb ... 115s Unpacking libsystemd-shared:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Preparing to unpack .../11-libsystemd0_256.5-2ubuntu4_armhf.deb ... 115s Unpacking libsystemd0:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Setting up libsystemd0:armhf (256.5-2ubuntu4) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 115s Preparing to unpack .../systemd-sysv_256.5-2ubuntu4_armhf.deb ... 115s Unpacking systemd-sysv (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Preparing to unpack .../libpam-systemd_256.5-2ubuntu4_armhf.deb ... 115s Unpacking libpam-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 115s Preparing to unpack .../systemd_256.5-2ubuntu4_armhf.deb ... 115s Unpacking systemd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 116s Preparing to unpack .../udev_256.5-2ubuntu4_armhf.deb ... 116s Unpacking udev (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 116s Preparing to unpack .../libudev1_256.5-2ubuntu4_armhf.deb ... 116s Unpacking libudev1:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 116s Setting up libudev1:armhf (256.5-2ubuntu4) ... 116s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 116s Preparing to unpack .../0-python3-problem-report_2.30.0-0ubuntu5_all.deb ... 116s Unpacking python3-problem-report (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 116s Preparing to unpack .../1-python3-apport_2.30.0-0ubuntu5_all.deb ... 116s Unpacking python3-apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 116s Preparing to unpack .../2-python3-gi_3.50.0-3_armhf.deb ... 116s Unpacking python3-gi (3.50.0-3) over (3.48.2-1) ... 116s Preparing to unpack .../3-apport-core-dump-handler_2.30.0-0ubuntu5_all.deb ... 116s Unpacking apport-core-dump-handler (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 116s Preparing to unpack .../4-apport_2.30.0-0ubuntu5_all.deb ... 116s Unpacking apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 116s Preparing to unpack .../5-libbsd0_0.12.2-2_armhf.deb ... 116s Unpacking libbsd0:armhf (0.12.2-2) over (0.12.2-1) ... 116s Setting up libbsd0:armhf (0.12.2-2) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 117s Preparing to unpack .../0-libedit2_3.1-20240808-1_armhf.deb ... 117s Unpacking libedit2:armhf (3.1-20240808-1) over (3.1-20240517-1) ... 117s Preparing to unpack .../1-openssh-sftp-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 117s Unpacking openssh-sftp-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 117s Preparing to unpack .../2-openssh-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 117s Unpacking openssh-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 117s Preparing to unpack .../3-openssh-client_1%3a9.7p1-7ubuntu5_armhf.deb ... 117s Unpacking openssh-client (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 117s Preparing to unpack .../4-libatomic1_14.2.0-8ubuntu1_armhf.deb ... 117s Unpacking libatomic1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 117s Preparing to unpack .../5-gcc-14-base_14.2.0-8ubuntu1_armhf.deb ... 117s Unpacking gcc-14-base:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 117s Setting up gcc-14-base:armhf (14.2.0-8ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 117s Preparing to unpack .../libstdc++6_14.2.0-8ubuntu1_armhf.deb ... 117s Unpacking libstdc++6:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 117s Setting up libstdc++6:armhf (14.2.0-8ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 117s Preparing to unpack .../libgcc-s1_14.2.0-8ubuntu1_armhf.deb ... 117s Unpacking libgcc-s1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 117s Setting up libgcc-s1:armhf (14.2.0-8ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 117s Preparing to unpack .../libattr1_1%3a2.5.2-2_armhf.deb ... 117s Unpacking libattr1:armhf (1:2.5.2-2) over (1:2.5.2-1build2) ... 117s Setting up libattr1:armhf (1:2.5.2-2) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 117s Preparing to unpack .../libgnutls30t64_3.8.8-2ubuntu1_armhf.deb ... 117s Unpacking libgnutls30t64:armhf (3.8.8-2ubuntu1) over (3.8.6-2ubuntu1) ... 117s Setting up libgnutls30t64:armhf (3.8.8-2ubuntu1) ... 117s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 117s Preparing to unpack .../install-info_7.1.1-1_armhf.deb ... 117s Unpacking install-info (7.1.1-1) over (7.1-3build2) ... 117s Setting up install-info (7.1.1-1) ... 118s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 118s Preparing to unpack .../00-mawk_1.3.4.20240905-1_armhf.deb ... 118s Unpacking mawk (1.3.4.20240905-1) over (1.3.4.20240622-2) ... 118s Preparing to unpack .../01-dhcpcd-base_1%3a10.1.0-2_armhf.deb ... 118s Unpacking dhcpcd-base (1:10.1.0-2) over (1:10.0.8-3) ... 118s Preparing to unpack .../02-distro-info-data_0.63_all.deb ... 118s Unpacking distro-info-data (0.63) over (0.62) ... 118s Preparing to unpack .../03-libdw1t64_0.192-4_armhf.deb ... 118s Unpacking libdw1t64:armhf (0.192-4) over (0.191-2) ... 118s Preparing to unpack .../04-libelf1t64_0.192-4_armhf.deb ... 118s Unpacking libelf1t64:armhf (0.192-4) over (0.191-2) ... 118s Preparing to unpack .../05-libbpf1_1%3a1.5.0-1_armhf.deb ... 118s Unpacking libbpf1:armhf (1:1.5.0-1) over (1:1.4.5-1) ... 118s Preparing to unpack .../06-libmnl0_1.0.5-3_armhf.deb ... 118s Unpacking libmnl0:armhf (1.0.5-3) over (1.0.5-2build1) ... 118s Preparing to unpack .../07-iproute2_6.10.0-2ubuntu1_armhf.deb ... 118s Unpacking iproute2 (6.10.0-2ubuntu1) over (6.10.0-2) ... 118s Preparing to unpack .../08-libfastjson4_1.2304.0-2_armhf.deb ... 118s Unpacking libfastjson4:armhf (1.2304.0-2) over (1.2304.0-1build1) ... 118s Preparing to unpack .../09-libjson-c5_0.18+ds-1_armhf.deb ... 118s Unpacking libjson-c5:armhf (0.18+ds-1) over (0.17-1build1) ... 118s Preparing to unpack .../10-libkeyutils1_1.6.3-4ubuntu2_armhf.deb ... 118s Unpacking libkeyutils1:armhf (1.6.3-4ubuntu2) over (1.6.3-3build1) ... 118s Preparing to unpack .../11-netplan-generator_1.1.1-1_armhf.deb ... 118s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 118s Unpacking netplan-generator (1.1.1-1) over (1.1-1) ... 118s Preparing to unpack .../12-python3-cffi-backend_1.17.1-2_armhf.deb ... 118s Unpacking python3-cffi-backend:armhf (1.17.1-2) over (1.17.1-1) ... 118s Preparing to unpack .../13-python3-netplan_1.1.1-1_armhf.deb ... 118s Unpacking python3-netplan (1.1.1-1) over (1.1-1) ... 118s Preparing to unpack .../14-netplan.io_1.1.1-1_armhf.deb ... 118s Unpacking netplan.io (1.1.1-1) over (1.1-1) ... 118s Preparing to unpack .../15-libnetplan1_1.1.1-1_armhf.deb ... 118s Unpacking libnetplan1:armhf (1.1.1-1) over (1.1-1) ... 119s Preparing to unpack .../16-python3-newt_0.52.24-2ubuntu4_armhf.deb ... 119s Unpacking python3-newt:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 119s Preparing to unpack .../17-libnewt0.52_0.52.24-2ubuntu4_armhf.deb ... 119s Unpacking libnewt0.52:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 119s Preparing to unpack .../18-libpopt0_1.19+dfsg-2_armhf.deb ... 119s Unpacking libpopt0:armhf (1.19+dfsg-2) over (1.19+dfsg-1build1) ... 119s Preparing to unpack .../19-vim-tiny_2%3a9.1.0777-1ubuntu1_armhf.deb ... 119s Unpacking vim-tiny (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 119s Preparing to unpack .../20-vim-common_2%3a9.1.0777-1ubuntu1_all.deb ... 119s Unpacking vim-common (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 119s Preparing to unpack .../21-whiptail_0.52.24-2ubuntu4_armhf.deb ... 119s Unpacking whiptail (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 119s Preparing to unpack .../22-xxd_2%3a9.1.0777-1ubuntu1_armhf.deb ... 119s Unpacking xxd (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 119s Preparing to unpack .../23-bash-completion_1%3a2.14.0-2_all.deb ... 119s Unpacking bash-completion (1:2.14.0-2) over (1:2.14.0-1) ... 119s Preparing to unpack .../24-info_7.1.1-1_armhf.deb ... 119s Unpacking info (7.1.1-1) over (7.1-3build2) ... 119s Preparing to unpack .../25-libdrm-common_2.4.123-1_all.deb ... 119s Unpacking libdrm-common (2.4.123-1) over (2.4.122-1) ... 119s Preparing to unpack .../26-libdrm2_2.4.123-1_armhf.deb ... 119s Unpacking libdrm2:armhf (2.4.123-1) over (2.4.122-1) ... 119s Preparing to unpack .../27-libevdev2_1.13.3+dfsg-1_armhf.deb ... 119s Unpacking libevdev2:armhf (1.13.3+dfsg-1) over (1.13.2+dfsg-1) ... 119s Preparing to unpack .../28-libmaxminddb0_1.11.0-1_armhf.deb ... 119s Unpacking libmaxminddb0:armhf (1.11.0-1) over (1.10.0-1) ... 119s Preparing to unpack .../29-libnetfilter-conntrack3_1.1.0-1_armhf.deb ... 119s Unpacking libnetfilter-conntrack3:armhf (1.1.0-1) over (1.0.9-6build1) ... 119s Preparing to unpack .../30-libnghttp2-14_1.64.0-1_armhf.deb ... 119s Unpacking libnghttp2-14:armhf (1.64.0-1) over (1.62.1-2) ... 119s Preparing to unpack .../31-libpipeline1_1.5.8-1_armhf.deb ... 119s Unpacking libpipeline1:armhf (1.5.8-1) over (1.5.7-2) ... 119s Preparing to unpack .../32-libpng16-16t64_1.6.44-2_armhf.deb ... 119s Unpacking libpng16-16t64:armhf (1.6.44-2) over (1.6.44-1) ... 119s Preparing to unpack .../33-libplymouth5_24.004.60-1ubuntu11_armhf.deb ... 119s Unpacking libplymouth5:armhf (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 119s Preparing to unpack .../34-libtraceevent1-plugin_1%3a1.8.3-1ubuntu1_armhf.deb ... 119s Unpacking libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 120s Preparing to unpack .../35-libtraceevent1_1%3a1.8.3-1ubuntu1_armhf.deb ... 120s Unpacking libtraceevent1:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 120s Preparing to unpack .../36-liburcu8t64_0.14.1-1_armhf.deb ... 120s Unpacking liburcu8t64:armhf (0.14.1-1) over (0.14.0-4) ... 120s Preparing to unpack .../37-libuv1t64_1.48.0-7_armhf.deb ... 120s Unpacking libuv1t64:armhf (1.48.0-7) over (1.48.0-5) ... 120s Preparing to unpack .../38-libx11-data_2%3a1.8.10-2_all.deb ... 120s Unpacking libx11-data (2:1.8.10-2) over (2:1.8.7-1build1) ... 120s Preparing to unpack .../39-libx11-6_2%3a1.8.10-2_armhf.deb ... 120s Unpacking libx11-6:armhf (2:1.8.10-2) over (2:1.8.7-1build1) ... 120s Preparing to unpack .../40-libxau6_1%3a1.0.11-1_armhf.deb ... 120s Unpacking libxau6:armhf (1:1.0.11-1) over (1:1.0.9-1build6) ... 120s Preparing to unpack .../41-nano_8.2-1_armhf.deb ... 120s Unpacking nano (8.2-1) over (8.1-1) ... 120s Preparing to unpack .../42-pci.ids_0.0~2024.10.24-1_all.deb ... 120s Unpacking pci.ids (0.0~2024.10.24-1) over (0.0~2024.09.12-1) ... 120s Preparing to unpack .../43-plymouth-theme-ubuntu-text_24.004.60-1ubuntu11_armhf.deb ... 120s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 120s Preparing to unpack .../44-plymouth_24.004.60-1ubuntu11_armhf.deb ... 120s Unpacking plymouth (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 120s Preparing to unpack .../45-python3.12-gdbm_3.12.7-3_armhf.deb ... 120s Unpacking python3.12-gdbm (3.12.7-3) over (3.12.7-1) ... 120s Selecting previously unselected package python3.13-gdbm. 120s Preparing to unpack .../46-python3.13-gdbm_3.13.0-2_armhf.deb ... 120s Unpacking python3.13-gdbm (3.13.0-2) ... 120s Preparing to unpack .../47-python3-gdbm_3.12.7-1_armhf.deb ... 120s Unpacking python3-gdbm:armhf (3.12.7-1) over (3.12.6-1ubuntu1) ... 120s Preparing to unpack .../48-ufw_0.36.2-8_all.deb ... 120s Unpacking ufw (0.36.2-8) over (0.36.2-6) ... 120s Preparing to unpack .../49-usbutils_1%3a018-1_armhf.deb ... 120s Unpacking usbutils (1:018-1) over (1:017-3build1) ... 120s Preparing to unpack .../50-dpkg-dev_1.22.11ubuntu3_all.deb ... 120s Unpacking dpkg-dev (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 121s Preparing to unpack .../51-libdpkg-perl_1.22.11ubuntu3_all.deb ... 121s Unpacking libdpkg-perl (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 121s Preparing to unpack .../52-libarchive13t64_3.7.4-1.1_armhf.deb ... 121s Unpacking libarchive13t64:armhf (3.7.4-1.1) over (3.7.4-1) ... 121s Preparing to unpack .../53-libftdi1-2_1.5-7_armhf.deb ... 121s Unpacking libftdi1-2:armhf (1.5-7) over (1.5-6build5) ... 121s Preparing to unpack .../54-libflashrom1_1.4.0-3ubuntu1_armhf.deb ... 121s Unpacking libflashrom1:armhf (1.4.0-3ubuntu1) over (1.3.0-2.1ubuntu2) ... 121s Preparing to unpack .../55-libjson-glib-1.0-common_1.10.0+ds-3_all.deb ... 121s Unpacking libjson-glib-1.0-common (1.10.0+ds-3) over (1.8.0-2build2) ... 121s Preparing to unpack .../56-libjson-glib-1.0-0_1.10.0+ds-3_armhf.deb ... 121s Unpacking libjson-glib-1.0-0:armhf (1.10.0+ds-3) over (1.8.0-2build2) ... 121s Preparing to unpack .../57-libfwupd2_1.9.26-2_armhf.deb ... 121s Unpacking libfwupd2:armhf (1.9.26-2) over (1.9.24-1) ... 121s Preparing to unpack .../58-libxmlb2_0.3.21-1_armhf.deb ... 121s Unpacking libxmlb2:armhf (0.3.21-1) over (0.3.19-1) ... 121s Preparing to unpack .../59-fwupd_1.9.26-2_armhf.deb ... 121s Unpacking fwupd (1.9.26-2) over (1.9.24-1) ... 121s Preparing to unpack .../60-libblockdev-utils3_3.2.1-1_armhf.deb ... 121s Unpacking libblockdev-utils3:armhf (3.2.1-1) over (3.1.1-2) ... 121s Preparing to unpack .../61-libblockdev-crypto3_3.2.1-1_armhf.deb ... 121s Unpacking libblockdev-crypto3:armhf (3.2.1-1) over (3.1.1-2) ... 121s Preparing to unpack .../62-libblockdev-fs3_3.2.1-1_armhf.deb ... 121s Unpacking libblockdev-fs3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../63-libblockdev-loop3_3.2.1-1_armhf.deb ... 122s Unpacking libblockdev-loop3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../64-libbytesize1_2.11-1ubuntu1_armhf.deb ... 122s Unpacking libbytesize1:armhf (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 122s Preparing to unpack .../65-libbytesize-common_2.11-1ubuntu1_all.deb ... 122s Unpacking libbytesize-common (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 122s Preparing to unpack .../66-libblockdev-mdraid3_3.2.1-1_armhf.deb ... 122s Unpacking libblockdev-mdraid3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../67-libnvme1t64_1.11-1_armhf.deb ... 122s Unpacking libnvme1t64 (1.11-1) over (1.10-1) ... 122s Preparing to unpack .../68-libblockdev-nvme3_3.2.1-1_armhf.deb ... 122s Unpacking libblockdev-nvme3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../69-libblockdev-part3_3.2.1-1_armhf.deb ... 122s Unpacking libblockdev-part3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../70-libblockdev-swap3_3.2.1-1_armhf.deb ... 122s Unpacking libblockdev-swap3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../71-libblockdev3_3.2.1-1_armhf.deb ... 122s Unpacking libblockdev3:armhf (3.2.1-1) over (3.1.1-2) ... 122s Preparing to unpack .../72-libgpgme11t64_1.23.2-5ubuntu4_armhf.deb ... 122s Unpacking libgpgme11t64:armhf (1.23.2-5ubuntu4) over (1.18.0-4.1ubuntu4) ... 122s Preparing to unpack .../73-libinih1_58-1ubuntu1_armhf.deb ... 122s Unpacking libinih1:armhf (58-1ubuntu1) over (55-1ubuntu2) ... 122s Preparing to unpack .../74-libldap-common_2.6.8+dfsg-1~exp4ubuntu3_all.deb ... 122s Unpacking libldap-common (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 122s Preparing to unpack .../75-libldap2_2.6.8+dfsg-1~exp4ubuntu3_armhf.deb ... 122s Unpacking libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 122s Preparing to unpack .../76-libnspr4_2%3a4.35-1.1ubuntu2_armhf.deb ... 122s Unpacking libnspr4:armhf (2:4.35-1.1ubuntu2) over (2:4.35-1.1ubuntu1) ... 122s Preparing to unpack .../77-libsgutils2-1.46-2_1.46-3ubuntu5_armhf.deb ... 122s Unpacking libsgutils2-1.46-2:armhf (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 122s Preparing to unpack .../78-libssh2-1t64_1.11.1-1_armhf.deb ... 122s Unpacking libssh2-1t64:armhf (1.11.1-1) over (1.11.0-7) ... 122s Preparing to unpack .../79-udisks2_2.10.1-11ubuntu1_armhf.deb ... 122s Unpacking udisks2 (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 122s Preparing to unpack .../80-libudisks2-0_2.10.1-11ubuntu1_armhf.deb ... 122s Unpacking libudisks2-0:armhf (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 122s Preparing to unpack .../81-libutempter0_1.2.1-4_armhf.deb ... 122s Unpacking libutempter0:armhf (1.2.1-4) over (1.2.1-3build1) ... 122s Preparing to unpack .../82-python3-certifi_2024.8.30+dfsg-1_all.deb ... 122s Unpacking python3-certifi (2024.8.30+dfsg-1) over (2024.6.2-1) ... 122s Preparing to unpack .../83-python3-configobj_5.0.9-1_all.deb ... 122s Unpacking python3-configobj (5.0.9-1) over (5.0.8-3) ... 122s Preparing to unpack .../84-python3-idna_3.8-2_all.deb ... 122s Unpacking python3-idna (3.8-2) over (3.6-2.1) ... 122s Preparing to unpack .../85-python3-more-itertools_10.5.0-1_all.deb ... 122s Unpacking python3-more-itertools (10.5.0-1) over (10.3.0-1) ... 122s Preparing to unpack .../86-python3-jaraco.functools_4.1.0-1_all.deb ... 123s Unpacking python3-jaraco.functools (4.1.0-1) over (4.0.2-1) ... 123s Preparing to unpack .../87-python3-json-pointer_2.4-2_all.deb ... 123s Unpacking python3-json-pointer (2.4-2) over (2.0-0ubuntu1) ... 123s Preparing to unpack .../88-python3-jsonpatch_1.32-4_all.deb ... 123s Unpacking python3-jsonpatch (1.32-4) over (1.32-3) ... 123s Preparing to unpack .../89-python3-lazr.uri_1.0.6-4_all.deb ... 123s Unpacking python3-lazr.uri (1.0.6-4) over (1.0.6-3) ... 123s Preparing to unpack .../90-python3-wadllib_2.0.0-1_all.deb ... 123s Unpacking python3-wadllib (2.0.0-1) over (1.3.6-5) ... 123s Preparing to unpack .../91-python3-oauthlib_3.2.2-2_all.deb ... 123s Unpacking python3-oauthlib (3.2.2-2) over (3.2.2-1) ... 123s Preparing to unpack .../92-python3-lazr.restfulclient_0.14.6-2_all.deb ... 123s Unpacking python3-lazr.restfulclient (0.14.6-2) over (0.14.6-1) ... 123s Preparing to unpack .../93-python3-typeguard_4.4.1-1_all.deb ... 123s Unpacking python3-typeguard (4.4.1-1) over (4.3.0-1) ... 123s Preparing to unpack .../94-python3-urllib3_2.0.7-2ubuntu0.1_all.deb ... 123s Unpacking python3-urllib3 (2.0.7-2ubuntu0.1) over (2.0.7-2) ... 123s Preparing to unpack .../95-python3-zipp_3.21.0-1_all.deb ... 123s Unpacking python3-zipp (3.21.0-1) over (3.20.0-1) ... 124s Preparing to unpack .../96-sg3-utils_1.46-3ubuntu5_armhf.deb ... 124s Unpacking sg3-utils (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 124s Preparing to unpack .../97-sg3-utils-udev_1.46-3ubuntu5_all.deb ... 124s Unpacking sg3-utils-udev (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 124s Selecting previously unselected package systemd-cryptsetup. 124s Preparing to unpack .../98-systemd-cryptsetup_256.5-2ubuntu4_armhf.deb ... 124s Unpacking systemd-cryptsetup (256.5-2ubuntu4) ... 124s Preparing to unpack .../99-ssh-import-id_5.11-0ubuntu3_all.deb ... 124s Unpacking ssh-import-id (5.11-0ubuntu3) over (5.11-0ubuntu2) ... 124s Setting up libpipeline1:armhf (1.5.8-1) ... 124s Setting up motd-news-config (13.5ubuntu3) ... 124s Setting up libtext-iconv-perl:armhf (1.7-8build4) ... 124s Setting up libtext-charwidth-perl:armhf (0.04-11build4) ... 124s Setting up liburcu8t64:armhf (0.14.1-1) ... 124s Setting up libxau6:armhf (1:1.0.11-1) ... 124s Setting up libkeyutils1:armhf (1.6.3-4ubuntu2) ... 124s Setting up pci.ids (0.0~2024.10.24-1) ... 124s Setting up libnewt0.52:armhf (0.52.24-2ubuntu4) ... 124s Setting up distro-info-data (0.63) ... 124s Setting up libfastjson4:armhf (1.2304.0-2) ... 124s Setting up libinih1:armhf (58-1ubuntu1) ... 124s Setting up libmaxminddb0:armhf (1.11.0-1) ... 124s Setting up python3.12-gdbm (3.12.7-3) ... 124s Setting up libxmlb2:armhf (0.3.21-1) ... 124s Setting up libedit2:armhf (3.1-20240808-1) ... 124s Setting up libuv1t64:armhf (1.48.0-7) ... 124s Setting up libpython3.12-minimal:armhf (3.12.7-3) ... 124s Setting up libnghttp2-14:armhf (1.64.0-1) ... 124s Setting up libsgutils2-1.46-2:armhf (1.46-3ubuntu5) ... 124s Setting up libnetplan1:armhf (1.1.1-1) ... 124s Setting up libldap-common (2.6.8+dfsg-1~exp4ubuntu3) ... 124s Setting up usbutils (1:018-1) ... 124s Setting up xxd (2:9.1.0777-1ubuntu1) ... 124s Setting up libelf1t64:armhf (0.192-4) ... 124s Setting up libdw1t64:armhf (0.192-4) ... 124s Setting up tzdata (2024b-1ubuntu2) ... 124s 124s Current default time zone: 'Etc/UTC' 124s Local time is now: Wed Nov 13 19:33:58 UTC 2024. 124s Universal Time is now: Wed Nov 13 19:33:58 UTC 2024. 124s Run 'dpkg-reconfigure tzdata' if you wish to change it. 124s 124s Setting up libftdi1-2:armhf (1.5-7) ... 124s Setting up libflashrom1:armhf (1.4.0-3ubuntu1) ... 124s Setting up vim-common (2:9.1.0777-1ubuntu1) ... 124s Installing new version of config file /etc/vim/vimrc ... 124s Setting up libx11-data (2:1.8.10-2) ... 124s Setting up libnspr4:armhf (2:4.35-1.1ubuntu2) ... 124s Setting up bash-completion (1:2.14.0-2) ... 124s Setting up libbytesize-common (2.11-1ubuntu1) ... 124s Setting up libblockdev-utils3:armhf (3.2.1-1) ... 124s Setting up libpng16-16t64:armhf (1.6.44-2) ... 124s Setting up libmnl0:armhf (1.0.5-3) ... 124s Setting up libatomic1:armhf (14.2.0-8ubuntu1) ... 124s Setting up libsystemd-shared:armhf (256.5-2ubuntu4) ... 124s Setting up dhcpcd-base (1:10.1.0-2) ... 124s Setting up libutempter0:armhf (1.2.1-4) ... 124s Setting up nano (8.2-1) ... 124s Setting up libblockdev-fs3:armhf (3.2.1-1) ... 124s Setting up perl-modules-5.40 (5.40.0-7) ... 124s Setting up libnetfilter-conntrack3:armhf (1.1.0-1) ... 124s Setting up libtraceevent1:armhf (1:1.8.3-1ubuntu1) ... 124s Setting up libx11-6:armhf (2:1.8.10-2) ... 124s Setting up libjson-glib-1.0-common (1.10.0+ds-3) ... 124s Setting up mawk (1.3.4.20240905-1) ... 124s Setting up libbytesize1:armhf (2.11-1ubuntu1) ... 124s Setting up libgpgme11t64:armhf (1.23.2-5ubuntu4) ... 124s Setting up libssh2-1t64:armhf (1.11.1-1) ... 124s Setting up libdrm-common (2.4.123-1) ... 124s Setting up libarchive13t64:armhf (3.7.4-1.1) ... 124s Setting up libjson-c5:armhf (0.18+ds-1) ... 124s Setting up libevdev2:armhf (1.13.3+dfsg-1) ... 124s Setting up libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) ... 124s Setting up info (7.1.1-1) ... 124s Setting up liblocale-gettext-perl (1.07-7build1) ... 124s Setting up libbpf1:armhf (1:1.5.0-1) ... 124s Setting up libudisks2-0:armhf (2.10.1-11ubuntu1) ... 124s Setting up python3.13-gdbm (3.13.0-2) ... 124s Setting up libpopt0:armhf (1.19+dfsg-2) ... 124s Setting up sg3-utils (1.46-3ubuntu5) ... 124s Setting up python3.12-minimal (3.12.7-3) ... 125s Setting up libpython3.12-stdlib:armhf (3.12.7-3) ... 125s Setting up libblockdev-mdraid3:armhf (3.2.1-1) ... 125s Setting up libblockdev-crypto3:armhf (3.2.1-1) ... 125s Setting up libblockdev-swap3:armhf (3.2.1-1) ... 125s Setting up iproute2 (6.10.0-2ubuntu1) ... 125s Setting up openssh-client (1:9.7p1-7ubuntu5) ... 125s Setting up python3.12 (3.12.7-3) ... 126s Setting up libblockdev-loop3:armhf (3.2.1-1) ... 126s Setting up systemd (256.5-2ubuntu4) ... 126s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 126s Created symlink '/run/systemd/system/tmp.mount' → '/dev/null'. 126s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 127s Setting up vim-tiny (2:9.1.0777-1ubuntu1) ... 127s Setting up libblockdev3:armhf (3.2.1-1) ... 127s Installing new version of config file /etc/libblockdev/3/conf.d/00-default.cfg ... 127s Setting up libjson-glib-1.0-0:armhf (1.10.0+ds-3) ... 127s Setting up libblockdev-part3:armhf (3.2.1-1) ... 127s Setting up sg3-utils-udev (1.46-3ubuntu5) ... 127s update-initramfs: deferring update (trigger activated) 127s Setting up libperl5.40:armhf (5.40.0-7) ... 127s Setting up perl (5.40.0-7) ... 127s Setting up systemd-cryptsetup (256.5-2ubuntu4) ... 127s Setting up libnvme1t64 (1.11-1) ... 127s Setting up systemd-timesyncd (256.5-2ubuntu4) ... 128s systemd-time-wait-sync.service is a disabled or a static unit not running, not starting it. 128s Setting up udev (256.5-2ubuntu4) ... 128s Setting up libdpkg-perl (1.22.11ubuntu3) ... 128s Setting up libblockdev-nvme3:armhf (3.2.1-1) ... 128s Setting up libdrm2:armhf (2.4.123-1) ... 128s Setting up whiptail (0.52.24-2ubuntu4) ... 128s Setting up libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) ... 128s Setting up libplymouth5:armhf (24.004.60-1ubuntu11) ... 128s Setting up netplan-generator (1.1.1-1) ... 128s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 128s Setting up libpython3-stdlib:armhf (3.12.7-1) ... 128s Setting up systemd-resolved (256.5-2ubuntu4) ... 129s Setting up openssh-sftp-server (1:9.7p1-7ubuntu5) ... 129s Setting up udisks2 (2.10.1-11ubuntu1) ... 129s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 129s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 129s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 129s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 129s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 129s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 129s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 129s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 129s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 129s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 129s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 129s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 129s loop8: Failed to write 'change' to '/sys/devices/virtual/block/loop8/uevent': Permission denied 129s Setting up systemd-sysv (256.5-2ubuntu4) ... 130s Setting up openssh-server (1:9.7p1-7ubuntu5) ... 131s Setting up plymouth (24.004.60-1ubuntu11) ... 131s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 131s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 131s Setting up libfwupd2:armhf (1.9.26-2) ... 131s Setting up libnss-systemd:armhf (256.5-2ubuntu4) ... 131s Setting up python3 (3.12.7-1) ... 131s Setting up python3-zipp (3.21.0-1) ... 132s Setting up python3-newt:armhf (0.52.24-2ubuntu4) ... 132s Setting up dpkg-dev (1.22.11ubuntu3) ... 132s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) ... 132s update-initramfs: deferring update (trigger activated) 132s Setting up python3-oauthlib (3.2.2-2) ... 132s Setting up python3-configobj (5.0.9-1) ... 132s Setting up python3-certifi (2024.8.30+dfsg-1) ... 132s Setting up python3-gi (3.50.0-3) ... 132s Setting up python3-idna (3.8-2) ... 132s Setting up python3-urllib3 (2.0.7-2ubuntu0.1) ... 133s Setting up python3-json-pointer (2.4-2) ... 133s Setting up libpam-systemd:armhf (256.5-2ubuntu4) ... 133s Setting up fwupd (1.9.26-2) ... 133s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 133s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 133s fwupd.service is a disabled or a static unit not running, not starting it. 134s Setting up python3-cffi-backend:armhf (1.17.1-2) ... 134s Setting up python3-more-itertools (10.5.0-1) ... 134s Setting up python3-jaraco.functools (4.1.0-1) ... 134s Setting up python3-gdbm:armhf (3.12.7-1) ... 134s Setting up python3-problem-report (2.30.0-0ubuntu5) ... 134s Setting up ssh-import-id (5.11-0ubuntu3) ... 134s Setting up python3-jsonpatch (1.32-4) ... 134s Setting up python3-typeguard (4.4.1-1) ... 134s Setting up ufw (0.36.2-8) ... 135s Setting up python3-lazr.uri (1.0.6-4) ... 135s Setting up python3-apport (2.30.0-0ubuntu5) ... 135s Setting up python3-wadllib (2.0.0-1) ... 136s Setting up python3-netplan (1.1.1-1) ... 136s Setting up python3-lazr.restfulclient (0.14.6-2) ... 136s Setting up netplan.io (1.1.1-1) ... 136s Setting up apport-core-dump-handler (2.30.0-0ubuntu5) ... 136s Setting up apport (2.30.0-0ubuntu5) ... 136s Installing new version of config file /etc/apport/crashdb.conf ... 137s apport-autoreport.service is a disabled or a static unit not running, not starting it. 137s Processing triggers for dbus (1.14.10-4ubuntu5) ... 137s Processing triggers for shared-mime-info (2.4-5) ... 138s Processing triggers for install-info (7.1.1-1) ... 138s Processing triggers for initramfs-tools (0.142ubuntu34) ... 138s Processing triggers for libc-bin (2.40-1ubuntu3) ... 138s Processing triggers for rsyslog (8.2406.0-1ubuntu2) ... 138s Processing triggers for man-db (2.12.1-3) ... 140s Reading package lists... 140s Building dependency tree... 140s Reading state information... 141s The following packages will be REMOVED: 141s libperl5.38t64* perl-modules-5.38* python3-netifaces* 141s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded. 141s After this operation, 41.7 MB disk space will be freed. 141s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61507 files and directories currently installed.) 141s Removing libperl5.38t64:armhf (5.38.2-5) ... 141s Removing perl-modules-5.38 (5.38.2-5) ... 141s Removing python3-netifaces:armhf (0.11.0-2build3) ... 141s Processing triggers for man-db (2.12.1-3) ... 142s Processing triggers for libc-bin (2.40-1ubuntu3) ... 144s autopkgtest [19:34:18]: rebooting testbed after setup commands that affected boot 215s autopkgtest [19:35:29]: testbed running kernel: Linux 6.8.0-47-generic #47~22.04.1-Ubuntu SMP PREEMPT_DYNAMIC Wed Oct 2 16:39:14 UTC 2 244s autopkgtest [19:35:58]: @@@@@@@@@@@@@@@@@@@@ apt-source pyfastx 259s Get:1 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (dsc) [2289 B] 259s Get:2 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (tar) [230 kB] 259s Get:3 http://ftpmaster.internal/ubuntu plucky/universe pyfastx 2.1.0-2 (diff) [7412 B] 259s gpgv: Signature made Fri Aug 30 18:49:12 2024 UTC 259s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 259s gpgv: issuer "emollier@debian.org" 259s gpgv: Can't check signature: No public key 259s dpkg-source: warning: cannot verify inline signature for ./pyfastx_2.1.0-2.dsc: no acceptable signature found 259s autopkgtest [19:36:13]: testing package pyfastx version 2.1.0-2 261s autopkgtest [19:36:15]: build not needed 263s autopkgtest [19:36:17]: test run-unit-test: preparing testbed 273s Reading package lists... 273s Building dependency tree... 273s Reading state information... 274s Starting pkgProblemResolver with broken count: 0 274s Starting 2 pkgProblemResolver with broken count: 0 274s Done 275s The following additional packages will be installed: 275s libpython3.13-minimal libpython3.13-stdlib pyfastx python3-all 275s python3-importlib-metadata python3-packaging python3-pyfaidx python3-pyfastx 275s python3.13 python3.13-minimal 275s Suggested packages: 275s python3.13-venv python3.13-doc binfmt-support 275s Recommended packages: 275s python3-biopython 275s The following NEW packages will be installed: 275s autopkgtest-satdep libpython3.13-minimal libpython3.13-stdlib pyfastx 275s python3-all python3-importlib-metadata python3-packaging python3-pyfaidx 275s python3-pyfastx python3.13 python3.13-minimal 275s 0 upgraded, 11 newly installed, 0 to remove and 0 not upgraded. 275s Need to get 5678 kB/5679 kB of archives. 275s After this operation, 19.8 MB of additional disk space will be used. 275s Get:1 /tmp/autopkgtest.xaeUuu/1-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [716 B] 275s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.13-minimal armhf 3.13.0-2 [866 kB] 275s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-minimal armhf 3.13.0-2 [1854 kB] 276s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.13-stdlib armhf 3.13.0-2 [1972 kB] 276s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf python3-importlib-metadata all 8.5.0-1 [20.7 kB] 276s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf python3-packaging all 24.1-1 [41.4 kB] 276s Get:7 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pyfaidx all 0.8.1.3-1 [29.7 kB] 276s Get:8 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pyfastx armhf 2.1.0-2 [52.7 kB] 276s Get:9 http://ftpmaster.internal/ubuntu plucky/universe armhf pyfastx armhf 2.1.0-2 [122 kB] 276s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13 armhf 3.13.0-2 [719 kB] 276s Get:11 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-all armhf 3.12.7-1 [890 B] 276s Fetched 5678 kB in 1s (7193 kB/s) 276s Selecting previously unselected package libpython3.13-minimal:armhf. 276s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59567 files and directories currently installed.) 276s Preparing to unpack .../00-libpython3.13-minimal_3.13.0-2_armhf.deb ... 276s Unpacking libpython3.13-minimal:armhf (3.13.0-2) ... 276s Selecting previously unselected package python3.13-minimal. 276s Preparing to unpack .../01-python3.13-minimal_3.13.0-2_armhf.deb ... 276s Unpacking python3.13-minimal (3.13.0-2) ... 276s Selecting previously unselected package libpython3.13-stdlib:armhf. 276s Preparing to unpack .../02-libpython3.13-stdlib_3.13.0-2_armhf.deb ... 276s Unpacking libpython3.13-stdlib:armhf (3.13.0-2) ... 276s Selecting previously unselected package python3-importlib-metadata. 276s Preparing to unpack .../03-python3-importlib-metadata_8.5.0-1_all.deb ... 276s Unpacking python3-importlib-metadata (8.5.0-1) ... 276s Selecting previously unselected package python3-packaging. 276s Preparing to unpack .../04-python3-packaging_24.1-1_all.deb ... 276s Unpacking python3-packaging (24.1-1) ... 276s Selecting previously unselected package python3-pyfaidx. 276s Preparing to unpack .../05-python3-pyfaidx_0.8.1.3-1_all.deb ... 276s Unpacking python3-pyfaidx (0.8.1.3-1) ... 276s Selecting previously unselected package python3-pyfastx. 276s Preparing to unpack .../06-python3-pyfastx_2.1.0-2_armhf.deb ... 276s Unpacking python3-pyfastx (2.1.0-2) ... 276s Selecting previously unselected package pyfastx. 277s Preparing to unpack .../07-pyfastx_2.1.0-2_armhf.deb ... 277s Unpacking pyfastx (2.1.0-2) ... 277s Selecting previously unselected package python3.13. 277s Preparing to unpack .../08-python3.13_3.13.0-2_armhf.deb ... 277s Unpacking python3.13 (3.13.0-2) ... 277s Selecting previously unselected package python3-all. 277s Preparing to unpack .../09-python3-all_3.12.7-1_armhf.deb ... 277s Unpacking python3-all (3.12.7-1) ... 277s Selecting previously unselected package autopkgtest-satdep. 277s Preparing to unpack .../10-1-autopkgtest-satdep.deb ... 277s Unpacking autopkgtest-satdep (0) ... 277s Setting up python3-importlib-metadata (8.5.0-1) ... 277s Setting up libpython3.13-minimal:armhf (3.13.0-2) ... 277s Setting up python3-packaging (24.1-1) ... 277s Setting up python3.13-minimal (3.13.0-2) ... 278s Setting up libpython3.13-stdlib:armhf (3.13.0-2) ... 278s Setting up python3-pyfaidx (0.8.1.3-1) ... 278s Setting up python3.13 (3.13.0-2) ... 279s Setting up python3-pyfastx (2.1.0-2) ... 279s Setting up python3-all (3.12.7-1) ... 279s Setting up pyfastx (2.1.0-2) ... 279s Setting up autopkgtest-satdep (0) ... 279s Processing triggers for man-db (2.12.1-3) ... 280s Processing triggers for systemd (256.5-2ubuntu4) ... 294s (Reading database ... 60399 files and directories currently installed.) 294s Removing autopkgtest-satdep (0) ... 300s autopkgtest [19:36:54]: test run-unit-test: [----------------------- 302s tests.test_fakeys (unittest.loader._FailedTest.tests.test_fakeys) ... ERROR 302s tests.test_fasta (unittest.loader._FailedTest.tests.test_fasta) ... ERROR 302s tests.test_fastq (unittest.loader._FailedTest.tests.test_fastq) ... ERROR 302s tests.test_fastx (unittest.loader._FailedTest.tests.test_fastx) ... ERROR 302s tests.test_fqkeys (unittest.loader._FailedTest.tests.test_fqkeys) ... ERROR 302s tests.test_read (unittest.loader._FailedTest.tests.test_read) ... ERROR 302s tests.test_sequence (unittest.loader._FailedTest.tests.test_sequence) ... ERROR 302s tests.test_sequence_error (unittest.loader._FailedTest.tests.test_sequence_error) ... ERROR 302s 302s ====================================================================== 302s ERROR: tests.test_fakeys (unittest.loader._FailedTest.tests.test_fakeys) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_fakeys 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_fakeys.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_fasta (unittest.loader._FailedTest.tests.test_fasta) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_fasta 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_fasta.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_fastq (unittest.loader._FailedTest.tests.test_fastq) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_fastq 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_fastq.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_fastx (unittest.loader._FailedTest.tests.test_fastx) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_fastx 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_fastx.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_fqkeys (unittest.loader._FailedTest.tests.test_fqkeys) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_fqkeys 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_fqkeys.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_read (unittest.loader._FailedTest.tests.test_read) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_read 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_read.py", line 4, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_sequence (unittest.loader._FailedTest.tests.test_sequence) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_sequence 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_sequence.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ====================================================================== 302s ERROR: tests.test_sequence_error (unittest.loader._FailedTest.tests.test_sequence_error) 302s ---------------------------------------------------------------------- 302s ImportError: Failed to import test module: tests.test_sequence_error 302s Traceback (most recent call last): 302s File "/usr/lib/python3.13/unittest/loader.py", line 396, in _find_test_path 302s module = self._get_module_from_name(name) 302s File "/usr/lib/python3.13/unittest/loader.py", line 339, in _get_module_from_name 302s __import__(name) 302s ~~~~~~~~~~^^^^^^ 302s File "/tmp/autopkgtest.xaeUuu/build.Wys/src/tests/test_sequence_error.py", line 3, in 302s import pyfastx 302s ModuleNotFoundError: No module named 'pyfastx' 302s 302s 302s ---------------------------------------------------------------------- 302s Ran 8 tests in 0.001s 302s 302s FAILED (errors=8) 303s autopkgtest [19:36:57]: test run-unit-test: -----------------------] 307s run-unit-test FAIL non-zero exit status 1 307s autopkgtest [19:37:01]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 311s autopkgtest [19:37:05]: test test-cli: preparing testbed 368s autopkgtest [19:38:02]: testbed dpkg architecture: armhf 370s autopkgtest [19:38:04]: testbed apt version: 2.9.8 370s autopkgtest [19:38:04]: @@@@@@@@@@@@@@@@@@@@ test bed setup 378s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 378s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [17.2 kB] 378s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [98.3 kB] 378s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [958 kB] 378s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 378s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Packages [101 kB] 378s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Packages [647 kB] 378s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Packages [17.2 kB] 378s Fetched 1919 kB in 1s (2050 kB/s) 378s Reading package lists... 395s tee: /proc/self/fd/2: Permission denied 416s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 416s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 416s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 416s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 417s Reading package lists... 417s Reading package lists... 418s Building dependency tree... 418s Reading state information... 418s Calculating upgrade... 419s The following packages were automatically installed and are no longer required: 419s libperl5.38t64 perl-modules-5.38 python3-netifaces 419s Use 'apt autoremove' to remove them. 419s The following NEW packages will be installed: 419s libperl5.40 perl-modules-5.40 python3.13-gdbm systemd-cryptsetup 419s The following packages will be upgraded: 419s apport apport-core-dump-handler base-files base-passwd bash-completion 419s dhcpcd-base distro-info-data dpkg dpkg-dev fwupd gcc-14-base info 419s install-info iproute2 libarchive13t64 libatomic1 libattr1 419s libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 libblockdev-mdraid3 419s libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 libblockdev-utils3 419s libblockdev3 libbpf1 libbsd0 libbytesize-common libbytesize1 libdb5.3t64 419s libdpkg-perl libdrm-common libdrm2 libdw1t64 libedit2 libelf1t64 libevdev2 419s libfastjson4 libflashrom1 libftdi1-2 libfwupd2 libgcc-s1 libgnutls30t64 419s libgpgme11t64 libinih1 libjson-c5 libjson-glib-1.0-0 libjson-glib-1.0-common 419s libkeyutils1 libldap-common libldap2 liblocale-gettext-perl libmaxminddb0 419s libmnl0 libnetfilter-conntrack3 libnetplan1 libnewt0.52 libnghttp2-14 419s libnspr4 libnss-systemd libnvme1t64 libpam-systemd libpipeline1 libplymouth5 419s libpng16-16t64 libpopt0 libpython3-stdlib libpython3.12-minimal 419s libpython3.12-stdlib libsgutils2-1.46-2 libssh2-1t64 libstdc++6 419s libsystemd-shared libsystemd0 libtext-charwidth-perl libtext-iconv-perl 419s libtraceevent1 libtraceevent1-plugin libudev1 libudisks2-0 liburcu8t64 419s libutempter0 libuv1t64 libx11-6 libx11-data libxau6 libxmlb2 mawk 419s motd-news-config nano netplan-generator netplan.io openssh-client 419s openssh-server openssh-sftp-server pci.ids perl perl-base plymouth 419s plymouth-theme-ubuntu-text python3 python3-apport python3-certifi 419s python3-cffi-backend python3-configobj python3-gdbm python3-gi python3-idna 419s python3-jaraco.functools python3-json-pointer python3-jsonpatch 419s python3-lazr.restfulclient python3-lazr.uri python3-minimal 419s python3-more-itertools python3-netplan python3-newt python3-oauthlib 419s python3-problem-report python3-typeguard python3-urllib3 python3-wadllib 419s python3-zipp python3.12 python3.12-gdbm python3.12-minimal sg3-utils 419s sg3-utils-udev ssh-import-id systemd systemd-resolved systemd-sysv 419s systemd-timesyncd tzdata udev udisks2 ufw usbutils vim-common vim-tiny 419s whiptail xxd 419s 143 upgraded, 4 newly installed, 0 to remove and 0 not upgraded. 419s Need to get 45.5 MB of archives. 419s After this operation, 43.2 MB of additional disk space will be used. 419s Get:1 http://ftpmaster.internal/ubuntu plucky/main armhf motd-news-config all 13.5ubuntu3 [5190 B] 419s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf base-files armhf 13.5ubuntu3 [75.1 kB] 419s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg armhf 1.22.11ubuntu3 [1247 kB] 420s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf perl-modules-5.40 all 5.40.0-7 [3214 kB] 420s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libperl5.40 armhf 5.40.0-7 [4139 kB] 420s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf perl armhf 5.40.0-7 [263 kB] 420s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf perl-base armhf 5.40.0-7 [1674 kB] 420s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf liblocale-gettext-perl armhf 1.07-7build1 [15.0 kB] 420s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-iconv-perl armhf 1.7-8build4 [12.8 kB] 420s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-charwidth-perl armhf 0.04-11build4 [9128 B] 420s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf libdb5.3t64 armhf 5.3.28+dfsg2-9 [655 kB] 420s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf base-passwd armhf 3.6.5 [53.2 kB] 420s Get:13 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-minimal armhf 3.12.7-1 [27.4 kB] 420s Get:14 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3 armhf 3.12.7-1 [24.0 kB] 420s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf tzdata all 2024b-1ubuntu2 [274 kB] 420s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12 armhf 3.12.7-3 [661 kB] 420s Get:17 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-stdlib armhf 3.12.7-3 [1934 kB] 420s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-minimal armhf 3.12.7-3 [2012 kB] 420s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-minimal armhf 3.12.7-3 [822 kB] 420s Get:20 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libpython3-stdlib armhf 3.12.7-1 [10.0 kB] 420s Get:21 http://ftpmaster.internal/ubuntu plucky/main armhf libnss-systemd armhf 256.5-2ubuntu4 [155 kB] 420s Get:22 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-timesyncd armhf 256.5-2ubuntu4 [40.7 kB] 420s Get:23 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-resolved armhf 256.5-2ubuntu4 [309 kB] 420s Get:24 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd-shared armhf 256.5-2ubuntu4 [2129 kB] 420s Get:25 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd0 armhf 256.5-2ubuntu4 [428 kB] 420s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-sysv armhf 256.5-2ubuntu4 [11.9 kB] 420s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf libpam-systemd armhf 256.5-2ubuntu4 [226 kB] 420s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf systemd armhf 256.5-2ubuntu4 [3442 kB] 420s Get:29 http://ftpmaster.internal/ubuntu plucky/main armhf udev armhf 256.5-2ubuntu4 [1949 kB] 420s Get:30 http://ftpmaster.internal/ubuntu plucky/main armhf libudev1 armhf 256.5-2ubuntu4 [188 kB] 420s Get:31 http://ftpmaster.internal/ubuntu plucky/main armhf python3-problem-report all 2.30.0-0ubuntu5 [25.0 kB] 420s Get:32 http://ftpmaster.internal/ubuntu plucky/main armhf python3-apport all 2.30.0-0ubuntu5 [93.2 kB] 420s Get:33 http://ftpmaster.internal/ubuntu plucky/main armhf python3-gi armhf 3.50.0-3 [227 kB] 420s Get:34 http://ftpmaster.internal/ubuntu plucky/main armhf apport-core-dump-handler all 2.30.0-0ubuntu5 [17.9 kB] 420s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf apport all 2.30.0-0ubuntu5 [83.0 kB] 420s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf libbsd0 armhf 0.12.2-2 [36.8 kB] 420s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf libedit2 armhf 3.1-20240808-1 [79.0 kB] 420s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-sftp-server armhf 1:9.7p1-7ubuntu5 [35.4 kB] 421s Get:39 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-server armhf 1:9.7p1-7ubuntu5 [505 kB] 421s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-client armhf 1:9.7p1-7ubuntu5 [889 kB] 421s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf libatomic1 armhf 14.2.0-8ubuntu1 [7846 B] 421s Get:42 http://ftpmaster.internal/ubuntu plucky/main armhf gcc-14-base armhf 14.2.0-8ubuntu1 [51.5 kB] 421s Get:43 http://ftpmaster.internal/ubuntu plucky/main armhf libstdc++6 armhf 14.2.0-8ubuntu1 [711 kB] 421s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf libgcc-s1 armhf 14.2.0-8ubuntu1 [40.8 kB] 421s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf libattr1 armhf 1:2.5.2-2 [10.5 kB] 421s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf libgnutls30t64 armhf 3.8.8-2ubuntu1 [955 kB] 421s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf install-info armhf 7.1.1-1 [61.4 kB] 421s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf mawk armhf 1.3.4.20240905-1 [116 kB] 421s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf dhcpcd-base armhf 1:10.1.0-2 [188 kB] 421s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf distro-info-data all 0.63 [6588 B] 421s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf libdw1t64 armhf 0.192-4 [243 kB] 421s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf libelf1t64 armhf 0.192-4 [50.2 kB] 421s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libbpf1 armhf 1:1.5.0-1 [158 kB] 421s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libmnl0 armhf 1.0.5-3 [10.7 kB] 421s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf iproute2 armhf 6.10.0-2ubuntu1 [1082 kB] 421s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf libfastjson4 armhf 1.2304.0-2 [20.2 kB] 421s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-c5 armhf 0.18+ds-1 [33.2 kB] 421s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf libkeyutils1 armhf 1.6.3-4ubuntu2 [8712 B] 421s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf netplan-generator armhf 1.1.1-1 [60.4 kB] 421s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf python3-cffi-backend armhf 1.17.1-2 [68.7 kB] 421s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf python3-netplan armhf 1.1.1-1 [24.1 kB] 421s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf netplan.io armhf 1.1.1-1 [66.4 kB] 421s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libnetplan1 armhf 1.1.1-1 [122 kB] 421s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf python3-newt armhf 0.52.24-2ubuntu4 [19.7 kB] 421s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf libnewt0.52 armhf 0.52.24-2ubuntu4 [39.2 kB] 421s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf libpopt0 armhf 1.19+dfsg-2 [25.4 kB] 421s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf vim-tiny armhf 2:9.1.0777-1ubuntu1 [693 kB] 421s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf vim-common all 2:9.1.0777-1ubuntu1 [394 kB] 421s Get:69 http://ftpmaster.internal/ubuntu plucky/main armhf whiptail armhf 0.52.24-2ubuntu4 [17.2 kB] 421s Get:70 http://ftpmaster.internal/ubuntu plucky/main armhf xxd armhf 2:9.1.0777-1ubuntu1 [66.8 kB] 421s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf bash-completion all 1:2.14.0-2 [210 kB] 421s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf info armhf 7.1.1-1 [126 kB] 421s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-common all 2.4.123-1 [8436 B] 421s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm2 armhf 2.4.123-1 [36.5 kB] 421s Get:75 http://ftpmaster.internal/ubuntu plucky/main armhf libevdev2 armhf 1.13.3+dfsg-1 [29.7 kB] 421s Get:76 http://ftpmaster.internal/ubuntu plucky/main armhf libmaxminddb0 armhf 1.11.0-1 [16.8 kB] 421s Get:77 http://ftpmaster.internal/ubuntu plucky/main armhf libnetfilter-conntrack3 armhf 1.1.0-1 [38.4 kB] 421s Get:78 http://ftpmaster.internal/ubuntu plucky/main armhf libnghttp2-14 armhf 1.64.0-1 [68.9 kB] 421s Get:79 http://ftpmaster.internal/ubuntu plucky/main armhf libpipeline1 armhf 1.5.8-1 [26.9 kB] 421s Get:80 http://ftpmaster.internal/ubuntu plucky/main armhf libpng16-16t64 armhf 1.6.44-2 [168 kB] 421s Get:81 http://ftpmaster.internal/ubuntu plucky/main armhf libplymouth5 armhf 24.004.60-1ubuntu11 [140 kB] 421s Get:82 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1-plugin armhf 1:1.8.3-1ubuntu1 [18.1 kB] 421s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1 armhf 1:1.8.3-1ubuntu1 [52.1 kB] 421s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf liburcu8t64 armhf 0.14.1-1 [56.6 kB] 421s Get:85 http://ftpmaster.internal/ubuntu plucky/main armhf libuv1t64 armhf 1.48.0-7 [83.3 kB] 421s Get:86 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-data all 2:1.8.10-2 [116 kB] 421s Get:87 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-6 armhf 2:1.8.10-2 [587 kB] 421s Get:88 http://ftpmaster.internal/ubuntu plucky/main armhf libxau6 armhf 1:1.0.11-1 [6558 B] 421s Get:89 http://ftpmaster.internal/ubuntu plucky/main armhf nano armhf 8.2-1 [276 kB] 421s Get:90 http://ftpmaster.internal/ubuntu plucky/main armhf pci.ids all 0.0~2024.10.24-1 [279 kB] 421s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-1ubuntu11 [9920 B] 421s Get:92 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth armhf 24.004.60-1ubuntu11 [142 kB] 421s Get:93 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-gdbm armhf 3.12.7-3 [28.7 kB] 421s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-gdbm armhf 3.13.0-2 [29.5 kB] 421s Get:95 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-gdbm armhf 3.12.7-1 [8642 B] 421s Get:96 http://ftpmaster.internal/ubuntu plucky/main armhf ufw all 0.36.2-8 [170 kB] 421s Get:97 http://ftpmaster.internal/ubuntu plucky/main armhf usbutils armhf 1:018-1 [76.1 kB] 421s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg-dev all 1.22.11ubuntu3 [1088 kB] 422s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libdpkg-perl all 1.22.11ubuntu3 [279 kB] 422s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libarchive13t64 armhf 3.7.4-1.1 [331 kB] 422s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libftdi1-2 armhf 1.5-7 [25.7 kB] 422s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libflashrom1 armhf 1.4.0-3ubuntu1 [141 kB] 422s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-common all 1.10.0+ds-3 [5586 B] 422s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-0 armhf 1.10.0+ds-3 [61.7 kB] 422s Get:105 http://ftpmaster.internal/ubuntu plucky/main armhf libfwupd2 armhf 1.9.26-2 [125 kB] 422s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf libxmlb2 armhf 0.3.21-1 [57.7 kB] 422s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf fwupd armhf 1.9.26-2 [4404 kB] 422s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-utils3 armhf 3.2.1-1 [17.4 kB] 422s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-crypto3 armhf 3.2.1-1 [22.4 kB] 422s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-fs3 armhf 3.2.1-1 [34.3 kB] 422s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-loop3 armhf 3.2.1-1 [6552 B] 422s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize1 armhf 2.11-1ubuntu1 [12.0 kB] 422s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize-common all 2.11-1ubuntu1 [3584 B] 422s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-mdraid3 armhf 3.2.1-1 [13.4 kB] 422s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf libnvme1t64 armhf 1.11-1 [73.8 kB] 422s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-nvme3 armhf 3.2.1-1 [17.6 kB] 423s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-part3 armhf 3.2.1-1 [16.5 kB] 423s Get:118 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-swap3 armhf 3.2.1-1 [8952 B] 423s Get:119 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev3 armhf 3.2.1-1 [44.2 kB] 423s Get:120 http://ftpmaster.internal/ubuntu plucky/main armhf libgpgme11t64 armhf 1.23.2-5ubuntu4 [123 kB] 423s Get:121 http://ftpmaster.internal/ubuntu plucky/main armhf libinih1 armhf 58-1ubuntu1 [6750 B] 423s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf libldap-common all 2.6.8+dfsg-1~exp4ubuntu3 [32.3 kB] 423s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf libldap2 armhf 2.6.8+dfsg-1~exp4ubuntu3 [173 kB] 423s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf libnspr4 armhf 2:4.35-1.1ubuntu2 [94.1 kB] 423s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf libsgutils2-1.46-2 armhf 1.46-3ubuntu5 [82.5 kB] 423s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf libssh2-1t64 armhf 1.11.1-1 [116 kB] 423s Get:127 http://ftpmaster.internal/ubuntu plucky/main armhf udisks2 armhf 2.10.1-11ubuntu1 [278 kB] 423s Get:128 http://ftpmaster.internal/ubuntu plucky/main armhf libudisks2-0 armhf 2.10.1-11ubuntu1 [142 kB] 423s Get:129 http://ftpmaster.internal/ubuntu plucky/main armhf libutempter0 armhf 1.2.1-4 [9062 B] 423s Get:130 http://ftpmaster.internal/ubuntu plucky/main armhf python3-certifi all 2024.8.30+dfsg-1 [9742 B] 423s Get:131 http://ftpmaster.internal/ubuntu plucky/main armhf python3-configobj all 5.0.9-1 [33.9 kB] 423s Get:132 http://ftpmaster.internal/ubuntu plucky/main armhf python3-idna all 3.8-2 [47.0 kB] 423s Get:133 http://ftpmaster.internal/ubuntu plucky/main armhf python3-more-itertools all 10.5.0-1 [56.2 kB] 423s Get:134 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jaraco.functools all 4.1.0-1 [11.8 kB] 423s Get:135 http://ftpmaster.internal/ubuntu plucky/main armhf python3-json-pointer all 2.4-2 [8396 B] 423s Get:136 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jsonpatch all 1.32-4 [12.2 kB] 423s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.uri all 1.0.6-4 [13.6 kB] 423s Get:138 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wadllib all 2.0.0-1 [36.7 kB] 423s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf python3-oauthlib all 3.2.2-2 [89.8 kB] 423s Get:140 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.restfulclient all 0.14.6-2 [50.9 kB] 423s Get:141 http://ftpmaster.internal/ubuntu plucky/main armhf python3-typeguard all 4.4.1-1 [29.0 kB] 423s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf python3-urllib3 all 2.0.7-2ubuntu0.1 [93.1 kB] 423s Get:143 http://ftpmaster.internal/ubuntu plucky/main armhf python3-zipp all 3.21.0-1 [10.2 kB] 423s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils armhf 1.46-3ubuntu5 [816 kB] 423s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils-udev all 1.46-3ubuntu5 [5916 B] 423s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-cryptsetup armhf 256.5-2ubuntu4 [122 kB] 423s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf ssh-import-id all 5.11-0ubuntu3 [10.1 kB] 423s Preconfiguring packages ... 424s Fetched 45.5 MB in 4s (11.6 MB/s) 424s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 424s Preparing to unpack .../motd-news-config_13.5ubuntu3_all.deb ... 424s Unpacking motd-news-config (13.5ubuntu3) over (13.3ubuntu6) ... 424s Preparing to unpack .../base-files_13.5ubuntu3_armhf.deb ... 424s Unpacking base-files (13.5ubuntu3) over (13.3ubuntu6) ... 424s Setting up base-files (13.5ubuntu3) ... 424s Installing new version of config file /etc/issue ... 424s Installing new version of config file /etc/issue.net ... 424s Installing new version of config file /etc/lsb-release ... 425s motd-news.service is a disabled or a static unit not running, not starting it. 425s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 425s Preparing to unpack .../dpkg_1.22.11ubuntu3_armhf.deb ... 425s Unpacking dpkg (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 425s Setting up dpkg (1.22.11ubuntu3) ... 426s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 426s Preparing to unpack .../perl_5.40.0-7_armhf.deb ... 426s Unpacking perl (5.40.0-7) over (5.38.2-5) ... 426s Selecting previously unselected package perl-modules-5.40. 426s Preparing to unpack .../perl-modules-5.40_5.40.0-7_all.deb ... 426s Unpacking perl-modules-5.40 (5.40.0-7) ... 426s Selecting previously unselected package libperl5.40:armhf. 426s Preparing to unpack .../libperl5.40_5.40.0-7_armhf.deb ... 426s Unpacking libperl5.40:armhf (5.40.0-7) ... 426s Preparing to unpack .../perl-base_5.40.0-7_armhf.deb ... 426s Unpacking perl-base (5.40.0-7) over (5.38.2-5) ... 426s Setting up perl-base (5.40.0-7) ... 427s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 427s Preparing to unpack .../liblocale-gettext-perl_1.07-7build1_armhf.deb ... 427s Unpacking liblocale-gettext-perl (1.07-7build1) over (1.07-7) ... 427s Preparing to unpack .../libtext-iconv-perl_1.7-8build4_armhf.deb ... 427s Unpacking libtext-iconv-perl:armhf (1.7-8build4) over (1.7-8build3) ... 427s Preparing to unpack .../libtext-charwidth-perl_0.04-11build4_armhf.deb ... 427s Unpacking libtext-charwidth-perl:armhf (0.04-11build4) over (0.04-11build3) ... 427s Preparing to unpack .../libdb5.3t64_5.3.28+dfsg2-9_armhf.deb ... 427s Unpacking libdb5.3t64:armhf (5.3.28+dfsg2-9) over (5.3.28+dfsg2-7) ... 427s Setting up libdb5.3t64:armhf (5.3.28+dfsg2-9) ... 427s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 427s Preparing to unpack .../base-passwd_3.6.5_armhf.deb ... 427s Unpacking base-passwd (3.6.5) over (3.6.4) ... 427s Setting up base-passwd (3.6.5) ... 427s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 427s Preparing to unpack .../python3-minimal_3.12.7-1_armhf.deb ... 427s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 427s Setting up python3-minimal (3.12.7-1) ... 427s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 427s Preparing to unpack .../00-python3_3.12.7-1_armhf.deb ... 427s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 427s Preparing to unpack .../01-tzdata_2024b-1ubuntu2_all.deb ... 427s Unpacking tzdata (2024b-1ubuntu2) over (2024a-4ubuntu1) ... 428s Preparing to unpack .../02-python3.12_3.12.7-3_armhf.deb ... 428s Unpacking python3.12 (3.12.7-3) over (3.12.7-1) ... 428s Preparing to unpack .../03-libpython3.12-stdlib_3.12.7-3_armhf.deb ... 428s Unpacking libpython3.12-stdlib:armhf (3.12.7-3) over (3.12.7-1) ... 428s Preparing to unpack .../04-python3.12-minimal_3.12.7-3_armhf.deb ... 428s Unpacking python3.12-minimal (3.12.7-3) over (3.12.7-1) ... 428s Preparing to unpack .../05-libpython3.12-minimal_3.12.7-3_armhf.deb ... 428s Unpacking libpython3.12-minimal:armhf (3.12.7-3) over (3.12.7-1) ... 428s Preparing to unpack .../06-libpython3-stdlib_3.12.7-1_armhf.deb ... 428s Unpacking libpython3-stdlib:armhf (3.12.7-1) over (3.12.6-0ubuntu1) ... 428s Preparing to unpack .../07-libnss-systemd_256.5-2ubuntu4_armhf.deb ... 428s Unpacking libnss-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Preparing to unpack .../08-systemd-timesyncd_256.5-2ubuntu4_armhf.deb ... 428s Unpacking systemd-timesyncd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Preparing to unpack .../09-systemd-resolved_256.5-2ubuntu4_armhf.deb ... 428s Unpacking systemd-resolved (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Preparing to unpack .../10-libsystemd-shared_256.5-2ubuntu4_armhf.deb ... 428s Unpacking libsystemd-shared:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Preparing to unpack .../11-libsystemd0_256.5-2ubuntu4_armhf.deb ... 428s Unpacking libsystemd0:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Setting up libsystemd0:armhf (256.5-2ubuntu4) ... 428s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 428s Preparing to unpack .../systemd-sysv_256.5-2ubuntu4_armhf.deb ... 428s Unpacking systemd-sysv (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Preparing to unpack .../libpam-systemd_256.5-2ubuntu4_armhf.deb ... 428s Unpacking libpam-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 428s Preparing to unpack .../systemd_256.5-2ubuntu4_armhf.deb ... 428s Unpacking systemd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 429s Preparing to unpack .../udev_256.5-2ubuntu4_armhf.deb ... 429s Unpacking udev (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 429s Preparing to unpack .../libudev1_256.5-2ubuntu4_armhf.deb ... 429s Unpacking libudev1:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 429s Setting up libudev1:armhf (256.5-2ubuntu4) ... 429s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 429s Preparing to unpack .../0-python3-problem-report_2.30.0-0ubuntu5_all.deb ... 429s Unpacking python3-problem-report (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 430s Preparing to unpack .../1-python3-apport_2.30.0-0ubuntu5_all.deb ... 430s Unpacking python3-apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 430s Preparing to unpack .../2-python3-gi_3.50.0-3_armhf.deb ... 430s Unpacking python3-gi (3.50.0-3) over (3.48.2-1) ... 430s Preparing to unpack .../3-apport-core-dump-handler_2.30.0-0ubuntu5_all.deb ... 430s Unpacking apport-core-dump-handler (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 430s Preparing to unpack .../4-apport_2.30.0-0ubuntu5_all.deb ... 430s Unpacking apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 430s Preparing to unpack .../5-libbsd0_0.12.2-2_armhf.deb ... 430s Unpacking libbsd0:armhf (0.12.2-2) over (0.12.2-1) ... 430s Setting up libbsd0:armhf (0.12.2-2) ... 430s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 430s Preparing to unpack .../0-libedit2_3.1-20240808-1_armhf.deb ... 430s Unpacking libedit2:armhf (3.1-20240808-1) over (3.1-20240517-1) ... 430s Preparing to unpack .../1-openssh-sftp-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 430s Unpacking openssh-sftp-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 430s Preparing to unpack .../2-openssh-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 430s Unpacking openssh-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 430s Preparing to unpack .../3-openssh-client_1%3a9.7p1-7ubuntu5_armhf.deb ... 431s Unpacking openssh-client (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 431s Preparing to unpack .../4-libatomic1_14.2.0-8ubuntu1_armhf.deb ... 431s Unpacking libatomic1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 431s Preparing to unpack .../5-gcc-14-base_14.2.0-8ubuntu1_armhf.deb ... 431s Unpacking gcc-14-base:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 431s Setting up gcc-14-base:armhf (14.2.0-8ubuntu1) ... 431s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 431s Preparing to unpack .../libstdc++6_14.2.0-8ubuntu1_armhf.deb ... 431s Unpacking libstdc++6:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 431s Setting up libstdc++6:armhf (14.2.0-8ubuntu1) ... 431s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 431s Preparing to unpack .../libgcc-s1_14.2.0-8ubuntu1_armhf.deb ... 431s Unpacking libgcc-s1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 431s Setting up libgcc-s1:armhf (14.2.0-8ubuntu1) ... 431s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 431s Preparing to unpack .../libattr1_1%3a2.5.2-2_armhf.deb ... 431s Unpacking libattr1:armhf (1:2.5.2-2) over (1:2.5.2-1build2) ... 431s Setting up libattr1:armhf (1:2.5.2-2) ... 431s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 431s Preparing to unpack .../libgnutls30t64_3.8.8-2ubuntu1_armhf.deb ... 431s Unpacking libgnutls30t64:armhf (3.8.8-2ubuntu1) over (3.8.6-2ubuntu1) ... 431s Setting up libgnutls30t64:armhf (3.8.8-2ubuntu1) ... 431s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 431s Preparing to unpack .../install-info_7.1.1-1_armhf.deb ... 431s Unpacking install-info (7.1.1-1) over (7.1-3build2) ... 431s Setting up install-info (7.1.1-1) ... 432s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 432s Preparing to unpack .../00-mawk_1.3.4.20240905-1_armhf.deb ... 432s Unpacking mawk (1.3.4.20240905-1) over (1.3.4.20240622-2) ... 432s Preparing to unpack .../01-dhcpcd-base_1%3a10.1.0-2_armhf.deb ... 432s Unpacking dhcpcd-base (1:10.1.0-2) over (1:10.0.8-3) ... 432s Preparing to unpack .../02-distro-info-data_0.63_all.deb ... 432s Unpacking distro-info-data (0.63) over (0.62) ... 432s Preparing to unpack .../03-libdw1t64_0.192-4_armhf.deb ... 432s Unpacking libdw1t64:armhf (0.192-4) over (0.191-2) ... 432s Preparing to unpack .../04-libelf1t64_0.192-4_armhf.deb ... 432s Unpacking libelf1t64:armhf (0.192-4) over (0.191-2) ... 432s Preparing to unpack .../05-libbpf1_1%3a1.5.0-1_armhf.deb ... 432s Unpacking libbpf1:armhf (1:1.5.0-1) over (1:1.4.5-1) ... 432s Preparing to unpack .../06-libmnl0_1.0.5-3_armhf.deb ... 432s Unpacking libmnl0:armhf (1.0.5-3) over (1.0.5-2build1) ... 432s Preparing to unpack .../07-iproute2_6.10.0-2ubuntu1_armhf.deb ... 432s Unpacking iproute2 (6.10.0-2ubuntu1) over (6.10.0-2) ... 432s Preparing to unpack .../08-libfastjson4_1.2304.0-2_armhf.deb ... 432s Unpacking libfastjson4:armhf (1.2304.0-2) over (1.2304.0-1build1) ... 432s Preparing to unpack .../09-libjson-c5_0.18+ds-1_armhf.deb ... 432s Unpacking libjson-c5:armhf (0.18+ds-1) over (0.17-1build1) ... 432s Preparing to unpack .../10-libkeyutils1_1.6.3-4ubuntu2_armhf.deb ... 432s Unpacking libkeyutils1:armhf (1.6.3-4ubuntu2) over (1.6.3-3build1) ... 432s Preparing to unpack .../11-netplan-generator_1.1.1-1_armhf.deb ... 432s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 432s Unpacking netplan-generator (1.1.1-1) over (1.1-1) ... 432s Preparing to unpack .../12-python3-cffi-backend_1.17.1-2_armhf.deb ... 432s Unpacking python3-cffi-backend:armhf (1.17.1-2) over (1.17.1-1) ... 432s Preparing to unpack .../13-python3-netplan_1.1.1-1_armhf.deb ... 432s Unpacking python3-netplan (1.1.1-1) over (1.1-1) ... 433s Preparing to unpack .../14-netplan.io_1.1.1-1_armhf.deb ... 433s Unpacking netplan.io (1.1.1-1) over (1.1-1) ... 433s Preparing to unpack .../15-libnetplan1_1.1.1-1_armhf.deb ... 433s Unpacking libnetplan1:armhf (1.1.1-1) over (1.1-1) ... 433s Preparing to unpack .../16-python3-newt_0.52.24-2ubuntu4_armhf.deb ... 433s Unpacking python3-newt:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 433s Preparing to unpack .../17-libnewt0.52_0.52.24-2ubuntu4_armhf.deb ... 433s Unpacking libnewt0.52:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 433s Preparing to unpack .../18-libpopt0_1.19+dfsg-2_armhf.deb ... 433s Unpacking libpopt0:armhf (1.19+dfsg-2) over (1.19+dfsg-1build1) ... 433s Preparing to unpack .../19-vim-tiny_2%3a9.1.0777-1ubuntu1_armhf.deb ... 433s Unpacking vim-tiny (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 433s Preparing to unpack .../20-vim-common_2%3a9.1.0777-1ubuntu1_all.deb ... 433s Unpacking vim-common (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 433s Preparing to unpack .../21-whiptail_0.52.24-2ubuntu4_armhf.deb ... 433s Unpacking whiptail (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 433s Preparing to unpack .../22-xxd_2%3a9.1.0777-1ubuntu1_armhf.deb ... 433s Unpacking xxd (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 433s Preparing to unpack .../23-bash-completion_1%3a2.14.0-2_all.deb ... 433s Unpacking bash-completion (1:2.14.0-2) over (1:2.14.0-1) ... 433s Preparing to unpack .../24-info_7.1.1-1_armhf.deb ... 433s Unpacking info (7.1.1-1) over (7.1-3build2) ... 433s Preparing to unpack .../25-libdrm-common_2.4.123-1_all.deb ... 433s Unpacking libdrm-common (2.4.123-1) over (2.4.122-1) ... 433s Preparing to unpack .../26-libdrm2_2.4.123-1_armhf.deb ... 433s Unpacking libdrm2:armhf (2.4.123-1) over (2.4.122-1) ... 433s Preparing to unpack .../27-libevdev2_1.13.3+dfsg-1_armhf.deb ... 433s Unpacking libevdev2:armhf (1.13.3+dfsg-1) over (1.13.2+dfsg-1) ... 433s Preparing to unpack .../28-libmaxminddb0_1.11.0-1_armhf.deb ... 433s Unpacking libmaxminddb0:armhf (1.11.0-1) over (1.10.0-1) ... 433s Preparing to unpack .../29-libnetfilter-conntrack3_1.1.0-1_armhf.deb ... 433s Unpacking libnetfilter-conntrack3:armhf (1.1.0-1) over (1.0.9-6build1) ... 433s Preparing to unpack .../30-libnghttp2-14_1.64.0-1_armhf.deb ... 433s Unpacking libnghttp2-14:armhf (1.64.0-1) over (1.62.1-2) ... 434s Preparing to unpack .../31-libpipeline1_1.5.8-1_armhf.deb ... 434s Unpacking libpipeline1:armhf (1.5.8-1) over (1.5.7-2) ... 434s Preparing to unpack .../32-libpng16-16t64_1.6.44-2_armhf.deb ... 434s Unpacking libpng16-16t64:armhf (1.6.44-2) over (1.6.44-1) ... 434s Preparing to unpack .../33-libplymouth5_24.004.60-1ubuntu11_armhf.deb ... 434s Unpacking libplymouth5:armhf (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 434s Preparing to unpack .../34-libtraceevent1-plugin_1%3a1.8.3-1ubuntu1_armhf.deb ... 434s Unpacking libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 434s Preparing to unpack .../35-libtraceevent1_1%3a1.8.3-1ubuntu1_armhf.deb ... 434s Unpacking libtraceevent1:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 434s Preparing to unpack .../36-liburcu8t64_0.14.1-1_armhf.deb ... 434s Unpacking liburcu8t64:armhf (0.14.1-1) over (0.14.0-4) ... 434s Preparing to unpack .../37-libuv1t64_1.48.0-7_armhf.deb ... 434s Unpacking libuv1t64:armhf (1.48.0-7) over (1.48.0-5) ... 434s Preparing to unpack .../38-libx11-data_2%3a1.8.10-2_all.deb ... 434s Unpacking libx11-data (2:1.8.10-2) over (2:1.8.7-1build1) ... 434s Preparing to unpack .../39-libx11-6_2%3a1.8.10-2_armhf.deb ... 434s Unpacking libx11-6:armhf (2:1.8.10-2) over (2:1.8.7-1build1) ... 434s Preparing to unpack .../40-libxau6_1%3a1.0.11-1_armhf.deb ... 434s Unpacking libxau6:armhf (1:1.0.11-1) over (1:1.0.9-1build6) ... 434s Preparing to unpack .../41-nano_8.2-1_armhf.deb ... 434s Unpacking nano (8.2-1) over (8.1-1) ... 434s Preparing to unpack .../42-pci.ids_0.0~2024.10.24-1_all.deb ... 434s Unpacking pci.ids (0.0~2024.10.24-1) over (0.0~2024.09.12-1) ... 434s Preparing to unpack .../43-plymouth-theme-ubuntu-text_24.004.60-1ubuntu11_armhf.deb ... 434s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 434s Preparing to unpack .../44-plymouth_24.004.60-1ubuntu11_armhf.deb ... 434s Unpacking plymouth (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 435s Preparing to unpack .../45-python3.12-gdbm_3.12.7-3_armhf.deb ... 435s Unpacking python3.12-gdbm (3.12.7-3) over (3.12.7-1) ... 435s Selecting previously unselected package python3.13-gdbm. 435s Preparing to unpack .../46-python3.13-gdbm_3.13.0-2_armhf.deb ... 435s Unpacking python3.13-gdbm (3.13.0-2) ... 435s Preparing to unpack .../47-python3-gdbm_3.12.7-1_armhf.deb ... 435s Unpacking python3-gdbm:armhf (3.12.7-1) over (3.12.6-1ubuntu1) ... 435s Preparing to unpack .../48-ufw_0.36.2-8_all.deb ... 435s Unpacking ufw (0.36.2-8) over (0.36.2-6) ... 435s Preparing to unpack .../49-usbutils_1%3a018-1_armhf.deb ... 435s Unpacking usbutils (1:018-1) over (1:017-3build1) ... 435s Preparing to unpack .../50-dpkg-dev_1.22.11ubuntu3_all.deb ... 435s Unpacking dpkg-dev (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 435s Preparing to unpack .../51-libdpkg-perl_1.22.11ubuntu3_all.deb ... 435s Unpacking libdpkg-perl (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 435s Preparing to unpack .../52-libarchive13t64_3.7.4-1.1_armhf.deb ... 435s Unpacking libarchive13t64:armhf (3.7.4-1.1) over (3.7.4-1) ... 435s Preparing to unpack .../53-libftdi1-2_1.5-7_armhf.deb ... 435s Unpacking libftdi1-2:armhf (1.5-7) over (1.5-6build5) ... 435s Preparing to unpack .../54-libflashrom1_1.4.0-3ubuntu1_armhf.deb ... 435s Unpacking libflashrom1:armhf (1.4.0-3ubuntu1) over (1.3.0-2.1ubuntu2) ... 435s Preparing to unpack .../55-libjson-glib-1.0-common_1.10.0+ds-3_all.deb ... 435s Unpacking libjson-glib-1.0-common (1.10.0+ds-3) over (1.8.0-2build2) ... 435s Preparing to unpack .../56-libjson-glib-1.0-0_1.10.0+ds-3_armhf.deb ... 435s Unpacking libjson-glib-1.0-0:armhf (1.10.0+ds-3) over (1.8.0-2build2) ... 436s Preparing to unpack .../57-libfwupd2_1.9.26-2_armhf.deb ... 436s Unpacking libfwupd2:armhf (1.9.26-2) over (1.9.24-1) ... 436s Preparing to unpack .../58-libxmlb2_0.3.21-1_armhf.deb ... 436s Unpacking libxmlb2:armhf (0.3.21-1) over (0.3.19-1) ... 436s Preparing to unpack .../59-fwupd_1.9.26-2_armhf.deb ... 436s Unpacking fwupd (1.9.26-2) over (1.9.24-1) ... 436s Preparing to unpack .../60-libblockdev-utils3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-utils3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../61-libblockdev-crypto3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-crypto3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../62-libblockdev-fs3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-fs3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../63-libblockdev-loop3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-loop3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../64-libbytesize1_2.11-1ubuntu1_armhf.deb ... 436s Unpacking libbytesize1:armhf (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 436s Preparing to unpack .../65-libbytesize-common_2.11-1ubuntu1_all.deb ... 436s Unpacking libbytesize-common (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 436s Preparing to unpack .../66-libblockdev-mdraid3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-mdraid3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../67-libnvme1t64_1.11-1_armhf.deb ... 436s Unpacking libnvme1t64 (1.11-1) over (1.10-1) ... 436s Preparing to unpack .../68-libblockdev-nvme3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-nvme3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../69-libblockdev-part3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-part3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../70-libblockdev-swap3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev-swap3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../71-libblockdev3_3.2.1-1_armhf.deb ... 436s Unpacking libblockdev3:armhf (3.2.1-1) over (3.1.1-2) ... 436s Preparing to unpack .../72-libgpgme11t64_1.23.2-5ubuntu4_armhf.deb ... 436s Unpacking libgpgme11t64:armhf (1.23.2-5ubuntu4) over (1.18.0-4.1ubuntu4) ... 436s Preparing to unpack .../73-libinih1_58-1ubuntu1_armhf.deb ... 436s Unpacking libinih1:armhf (58-1ubuntu1) over (55-1ubuntu2) ... 436s Preparing to unpack .../74-libldap-common_2.6.8+dfsg-1~exp4ubuntu3_all.deb ... 436s Unpacking libldap-common (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 437s Preparing to unpack .../75-libldap2_2.6.8+dfsg-1~exp4ubuntu3_armhf.deb ... 437s Unpacking libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 437s Preparing to unpack .../76-libnspr4_2%3a4.35-1.1ubuntu2_armhf.deb ... 437s Unpacking libnspr4:armhf (2:4.35-1.1ubuntu2) over (2:4.35-1.1ubuntu1) ... 437s Preparing to unpack .../77-libsgutils2-1.46-2_1.46-3ubuntu5_armhf.deb ... 437s Unpacking libsgutils2-1.46-2:armhf (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 437s Preparing to unpack .../78-libssh2-1t64_1.11.1-1_armhf.deb ... 437s Unpacking libssh2-1t64:armhf (1.11.1-1) over (1.11.0-7) ... 437s Preparing to unpack .../79-udisks2_2.10.1-11ubuntu1_armhf.deb ... 437s Unpacking udisks2 (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 437s Preparing to unpack .../80-libudisks2-0_2.10.1-11ubuntu1_armhf.deb ... 437s Unpacking libudisks2-0:armhf (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 437s Preparing to unpack .../81-libutempter0_1.2.1-4_armhf.deb ... 437s Unpacking libutempter0:armhf (1.2.1-4) over (1.2.1-3build1) ... 437s Preparing to unpack .../82-python3-certifi_2024.8.30+dfsg-1_all.deb ... 437s Unpacking python3-certifi (2024.8.30+dfsg-1) over (2024.6.2-1) ... 437s Preparing to unpack .../83-python3-configobj_5.0.9-1_all.deb ... 437s Unpacking python3-configobj (5.0.9-1) over (5.0.8-3) ... 437s Preparing to unpack .../84-python3-idna_3.8-2_all.deb ... 437s Unpacking python3-idna (3.8-2) over (3.6-2.1) ... 437s Preparing to unpack .../85-python3-more-itertools_10.5.0-1_all.deb ... 437s Unpacking python3-more-itertools (10.5.0-1) over (10.3.0-1) ... 437s Preparing to unpack .../86-python3-jaraco.functools_4.1.0-1_all.deb ... 437s Unpacking python3-jaraco.functools (4.1.0-1) over (4.0.2-1) ... 438s Preparing to unpack .../87-python3-json-pointer_2.4-2_all.deb ... 438s Unpacking python3-json-pointer (2.4-2) over (2.0-0ubuntu1) ... 438s Preparing to unpack .../88-python3-jsonpatch_1.32-4_all.deb ... 438s Unpacking python3-jsonpatch (1.32-4) over (1.32-3) ... 438s Preparing to unpack .../89-python3-lazr.uri_1.0.6-4_all.deb ... 438s Unpacking python3-lazr.uri (1.0.6-4) over (1.0.6-3) ... 438s Preparing to unpack .../90-python3-wadllib_2.0.0-1_all.deb ... 438s Unpacking python3-wadllib (2.0.0-1) over (1.3.6-5) ... 438s Preparing to unpack .../91-python3-oauthlib_3.2.2-2_all.deb ... 438s Unpacking python3-oauthlib (3.2.2-2) over (3.2.2-1) ... 438s Preparing to unpack .../92-python3-lazr.restfulclient_0.14.6-2_all.deb ... 438s Unpacking python3-lazr.restfulclient (0.14.6-2) over (0.14.6-1) ... 438s Preparing to unpack .../93-python3-typeguard_4.4.1-1_all.deb ... 439s Unpacking python3-typeguard (4.4.1-1) over (4.3.0-1) ... 439s Preparing to unpack .../94-python3-urllib3_2.0.7-2ubuntu0.1_all.deb ... 439s Unpacking python3-urllib3 (2.0.7-2ubuntu0.1) over (2.0.7-2) ... 439s Preparing to unpack .../95-python3-zipp_3.21.0-1_all.deb ... 439s Unpacking python3-zipp (3.21.0-1) over (3.20.0-1) ... 439s Preparing to unpack .../96-sg3-utils_1.46-3ubuntu5_armhf.deb ... 439s Unpacking sg3-utils (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 439s Preparing to unpack .../97-sg3-utils-udev_1.46-3ubuntu5_all.deb ... 439s Unpacking sg3-utils-udev (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 439s Selecting previously unselected package systemd-cryptsetup. 439s Preparing to unpack .../98-systemd-cryptsetup_256.5-2ubuntu4_armhf.deb ... 439s Unpacking systemd-cryptsetup (256.5-2ubuntu4) ... 439s Preparing to unpack .../99-ssh-import-id_5.11-0ubuntu3_all.deb ... 439s Unpacking ssh-import-id (5.11-0ubuntu3) over (5.11-0ubuntu2) ... 439s Setting up libpipeline1:armhf (1.5.8-1) ... 439s Setting up motd-news-config (13.5ubuntu3) ... 439s Setting up libtext-iconv-perl:armhf (1.7-8build4) ... 439s Setting up libtext-charwidth-perl:armhf (0.04-11build4) ... 439s Setting up liburcu8t64:armhf (0.14.1-1) ... 439s Setting up libxau6:armhf (1:1.0.11-1) ... 439s Setting up libkeyutils1:armhf (1.6.3-4ubuntu2) ... 439s Setting up pci.ids (0.0~2024.10.24-1) ... 439s Setting up libnewt0.52:armhf (0.52.24-2ubuntu4) ... 439s Setting up distro-info-data (0.63) ... 439s Setting up libfastjson4:armhf (1.2304.0-2) ... 439s Setting up libinih1:armhf (58-1ubuntu1) ... 439s Setting up libmaxminddb0:armhf (1.11.0-1) ... 439s Setting up python3.12-gdbm (3.12.7-3) ... 439s Setting up libxmlb2:armhf (0.3.21-1) ... 439s Setting up libedit2:armhf (3.1-20240808-1) ... 439s Setting up libuv1t64:armhf (1.48.0-7) ... 439s Setting up libpython3.12-minimal:armhf (3.12.7-3) ... 439s Setting up libnghttp2-14:armhf (1.64.0-1) ... 439s Setting up libsgutils2-1.46-2:armhf (1.46-3ubuntu5) ... 439s Setting up libnetplan1:armhf (1.1.1-1) ... 439s Setting up libldap-common (2.6.8+dfsg-1~exp4ubuntu3) ... 439s Setting up usbutils (1:018-1) ... 439s Setting up xxd (2:9.1.0777-1ubuntu1) ... 439s Setting up libelf1t64:armhf (0.192-4) ... 439s Setting up libdw1t64:armhf (0.192-4) ... 439s Setting up tzdata (2024b-1ubuntu2) ... 439s 439s Current default time zone: 'Etc/UTC' 439s Local time is now: Wed Nov 13 19:39:13 UTC 2024. 439s Universal Time is now: Wed Nov 13 19:39:13 UTC 2024. 439s Run 'dpkg-reconfigure tzdata' if you wish to change it. 439s 439s Setting up libftdi1-2:armhf (1.5-7) ... 439s Setting up libflashrom1:armhf (1.4.0-3ubuntu1) ... 439s Setting up vim-common (2:9.1.0777-1ubuntu1) ... 439s Installing new version of config file /etc/vim/vimrc ... 439s Setting up libx11-data (2:1.8.10-2) ... 439s Setting up libnspr4:armhf (2:4.35-1.1ubuntu2) ... 439s Setting up bash-completion (1:2.14.0-2) ... 439s Setting up libbytesize-common (2.11-1ubuntu1) ... 439s Setting up libblockdev-utils3:armhf (3.2.1-1) ... 439s Setting up libpng16-16t64:armhf (1.6.44-2) ... 439s Setting up libmnl0:armhf (1.0.5-3) ... 439s Setting up libatomic1:armhf (14.2.0-8ubuntu1) ... 439s Setting up libsystemd-shared:armhf (256.5-2ubuntu4) ... 439s Setting up dhcpcd-base (1:10.1.0-2) ... 439s Setting up libutempter0:armhf (1.2.1-4) ... 439s Setting up nano (8.2-1) ... 439s Setting up libblockdev-fs3:armhf (3.2.1-1) ... 439s Setting up perl-modules-5.40 (5.40.0-7) ... 439s Setting up libnetfilter-conntrack3:armhf (1.1.0-1) ... 439s Setting up libtraceevent1:armhf (1:1.8.3-1ubuntu1) ... 439s Setting up libx11-6:armhf (2:1.8.10-2) ... 439s Setting up libjson-glib-1.0-common (1.10.0+ds-3) ... 439s Setting up mawk (1.3.4.20240905-1) ... 439s Setting up libbytesize1:armhf (2.11-1ubuntu1) ... 439s Setting up libgpgme11t64:armhf (1.23.2-5ubuntu4) ... 439s Setting up libssh2-1t64:armhf (1.11.1-1) ... 439s Setting up libdrm-common (2.4.123-1) ... 439s Setting up libarchive13t64:armhf (3.7.4-1.1) ... 439s Setting up libjson-c5:armhf (0.18+ds-1) ... 439s Setting up libevdev2:armhf (1.13.3+dfsg-1) ... 439s Setting up libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) ... 439s Setting up info (7.1.1-1) ... 439s Setting up liblocale-gettext-perl (1.07-7build1) ... 439s Setting up libbpf1:armhf (1:1.5.0-1) ... 439s Setting up libudisks2-0:armhf (2.10.1-11ubuntu1) ... 439s Setting up python3.13-gdbm (3.13.0-2) ... 439s Setting up libpopt0:armhf (1.19+dfsg-2) ... 439s Setting up sg3-utils (1.46-3ubuntu5) ... 439s Setting up python3.12-minimal (3.12.7-3) ... 440s Setting up libpython3.12-stdlib:armhf (3.12.7-3) ... 440s Setting up libblockdev-mdraid3:armhf (3.2.1-1) ... 440s Setting up libblockdev-crypto3:armhf (3.2.1-1) ... 440s Setting up libblockdev-swap3:armhf (3.2.1-1) ... 440s Setting up iproute2 (6.10.0-2ubuntu1) ... 441s Setting up openssh-client (1:9.7p1-7ubuntu5) ... 441s Setting up python3.12 (3.12.7-3) ... 442s Setting up libblockdev-loop3:armhf (3.2.1-1) ... 442s Setting up systemd (256.5-2ubuntu4) ... 442s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 442s Created symlink '/run/systemd/system/tmp.mount' → '/dev/null'. 442s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 443s Setting up vim-tiny (2:9.1.0777-1ubuntu1) ... 443s Setting up libblockdev3:armhf (3.2.1-1) ... 443s Installing new version of config file /etc/libblockdev/3/conf.d/00-default.cfg ... 443s Setting up libjson-glib-1.0-0:armhf (1.10.0+ds-3) ... 443s Setting up libblockdev-part3:armhf (3.2.1-1) ... 443s Setting up sg3-utils-udev (1.46-3ubuntu5) ... 443s update-initramfs: deferring update (trigger activated) 443s Setting up libperl5.40:armhf (5.40.0-7) ... 443s Setting up perl (5.40.0-7) ... 443s Setting up systemd-cryptsetup (256.5-2ubuntu4) ... 443s Setting up libnvme1t64 (1.11-1) ... 443s Setting up systemd-timesyncd (256.5-2ubuntu4) ... 443s systemd-time-wait-sync.service is a disabled or a static unit not running, not starting it. 443s Setting up udev (256.5-2ubuntu4) ... 444s Setting up libdpkg-perl (1.22.11ubuntu3) ... 444s Setting up libblockdev-nvme3:armhf (3.2.1-1) ... 444s Setting up libdrm2:armhf (2.4.123-1) ... 444s Setting up whiptail (0.52.24-2ubuntu4) ... 444s Setting up libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) ... 444s Setting up libplymouth5:armhf (24.004.60-1ubuntu11) ... 444s Setting up netplan-generator (1.1.1-1) ... 444s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 444s Setting up libpython3-stdlib:armhf (3.12.7-1) ... 444s Setting up systemd-resolved (256.5-2ubuntu4) ... 445s Setting up openssh-sftp-server (1:9.7p1-7ubuntu5) ... 445s Setting up udisks2 (2.10.1-11ubuntu1) ... 445s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 445s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 445s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 445s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 445s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 445s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 445s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 445s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 445s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 445s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 445s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 445s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 445s loop8: Failed to write 'change' to '/sys/devices/virtual/block/loop8/uevent': Permission denied 445s Setting up systemd-sysv (256.5-2ubuntu4) ... 445s Setting up openssh-server (1:9.7p1-7ubuntu5) ... 447s Setting up plymouth (24.004.60-1ubuntu11) ... 447s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 447s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 447s Setting up libfwupd2:armhf (1.9.26-2) ... 447s Setting up libnss-systemd:armhf (256.5-2ubuntu4) ... 447s Setting up python3 (3.12.7-1) ... 447s Setting up python3-zipp (3.21.0-1) ... 448s Setting up python3-newt:armhf (0.52.24-2ubuntu4) ... 448s Setting up dpkg-dev (1.22.11ubuntu3) ... 448s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) ... 448s update-initramfs: deferring update (trigger activated) 448s Setting up python3-oauthlib (3.2.2-2) ... 448s Setting up python3-configobj (5.0.9-1) ... 448s Setting up python3-certifi (2024.8.30+dfsg-1) ... 448s Setting up python3-gi (3.50.0-3) ... 448s Setting up python3-idna (3.8-2) ... 449s Setting up python3-urllib3 (2.0.7-2ubuntu0.1) ... 449s Setting up python3-json-pointer (2.4-2) ... 449s Setting up libpam-systemd:armhf (256.5-2ubuntu4) ... 449s Setting up fwupd (1.9.26-2) ... 449s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 449s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 450s fwupd.service is a disabled or a static unit not running, not starting it. 450s Setting up python3-cffi-backend:armhf (1.17.1-2) ... 450s Setting up python3-more-itertools (10.5.0-1) ... 450s Setting up python3-jaraco.functools (4.1.0-1) ... 450s Setting up python3-gdbm:armhf (3.12.7-1) ... 450s Setting up python3-problem-report (2.30.0-0ubuntu5) ... 450s Setting up ssh-import-id (5.11-0ubuntu3) ... 450s Setting up python3-jsonpatch (1.32-4) ... 450s Setting up python3-typeguard (4.4.1-1) ... 450s Setting up ufw (0.36.2-8) ... 451s Setting up python3-lazr.uri (1.0.6-4) ... 451s Setting up python3-apport (2.30.0-0ubuntu5) ... 452s Setting up python3-wadllib (2.0.0-1) ... 452s Setting up python3-netplan (1.1.1-1) ... 452s Setting up python3-lazr.restfulclient (0.14.6-2) ... 452s Setting up netplan.io (1.1.1-1) ... 452s Setting up apport-core-dump-handler (2.30.0-0ubuntu5) ... 453s Setting up apport (2.30.0-0ubuntu5) ... 453s Installing new version of config file /etc/apport/crashdb.conf ... 453s apport-autoreport.service is a disabled or a static unit not running, not starting it. 453s Processing triggers for dbus (1.14.10-4ubuntu5) ... 453s Processing triggers for shared-mime-info (2.4-5) ... 454s Processing triggers for install-info (7.1.1-1) ... 454s Processing triggers for initramfs-tools (0.142ubuntu34) ... 454s Processing triggers for libc-bin (2.40-1ubuntu3) ... 454s Processing triggers for rsyslog (8.2406.0-1ubuntu2) ... 454s Processing triggers for man-db (2.12.1-3) ... 456s Reading package lists... 456s Building dependency tree... 456s Reading state information... 457s The following packages will be REMOVED: 457s libperl5.38t64* perl-modules-5.38* python3-netifaces* 457s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded. 457s After this operation, 41.7 MB disk space will be freed. 457s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61507 files and directories currently installed.) 457s Removing libperl5.38t64:armhf (5.38.2-5) ... 457s Removing perl-modules-5.38 (5.38.2-5) ... 457s Removing python3-netifaces:armhf (0.11.0-2build3) ... 457s Processing triggers for man-db (2.12.1-3) ... 458s Processing triggers for libc-bin (2.40-1ubuntu3) ... 460s autopkgtest [19:39:34]: rebooting testbed after setup commands that affected boot 569s Reading package lists... 569s Building dependency tree... 569s Reading state information... 570s Starting pkgProblemResolver with broken count: 0 570s Starting 2 pkgProblemResolver with broken count: 0 570s Done 571s The following additional packages will be installed: 571s pyfastx python3-importlib-metadata python3-packaging python3-pyfaidx 571s python3-pyfastx 571s Recommended packages: 571s python3-biopython 571s The following NEW packages will be installed: 571s autopkgtest-satdep pyfastx python3-importlib-metadata python3-packaging 571s python3-pyfaidx python3-pyfastx 571s 0 upgraded, 6 newly installed, 0 to remove and 0 not upgraded. 571s Need to get 266 kB/267 kB of archives. 571s After this operation, 705 kB of additional disk space will be used. 571s Get:1 /tmp/autopkgtest.xaeUuu/2-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [712 B] 571s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf python3-importlib-metadata all 8.5.0-1 [20.7 kB] 572s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf python3-packaging all 24.1-1 [41.4 kB] 572s Get:4 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pyfaidx all 0.8.1.3-1 [29.7 kB] 572s Get:5 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pyfastx armhf 2.1.0-2 [52.7 kB] 572s Get:6 http://ftpmaster.internal/ubuntu plucky/universe armhf pyfastx armhf 2.1.0-2 [122 kB] 572s Fetched 266 kB in 0s (610 kB/s) 572s Selecting previously unselected package python3-importlib-metadata. 572s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59567 files and directories currently installed.) 572s Preparing to unpack .../0-python3-importlib-metadata_8.5.0-1_all.deb ... 572s Unpacking python3-importlib-metadata (8.5.0-1) ... 572s Selecting previously unselected package python3-packaging. 572s Preparing to unpack .../1-python3-packaging_24.1-1_all.deb ... 572s Unpacking python3-packaging (24.1-1) ... 572s Selecting previously unselected package python3-pyfaidx. 572s Preparing to unpack .../2-python3-pyfaidx_0.8.1.3-1_all.deb ... 572s Unpacking python3-pyfaidx (0.8.1.3-1) ... 572s Selecting previously unselected package python3-pyfastx. 572s Preparing to unpack .../3-python3-pyfastx_2.1.0-2_armhf.deb ... 572s Unpacking python3-pyfastx (2.1.0-2) ... 572s Selecting previously unselected package pyfastx. 572s Preparing to unpack .../4-pyfastx_2.1.0-2_armhf.deb ... 572s Unpacking pyfastx (2.1.0-2) ... 572s Selecting previously unselected package autopkgtest-satdep. 572s Preparing to unpack .../5-2-autopkgtest-satdep.deb ... 572s Unpacking autopkgtest-satdep (0) ... 572s Setting up python3-importlib-metadata (8.5.0-1) ... 572s Setting up python3-packaging (24.1-1) ... 572s Setting up python3-pyfaidx (0.8.1.3-1) ... 572s Setting up python3-pyfastx (2.1.0-2) ... 572s Setting up pyfastx (2.1.0-2) ... 572s Setting up autopkgtest-satdep (0) ... 572s Processing triggers for man-db (2.12.1-3) ... 588s (Reading database ... 59664 files and directories currently installed.) 588s Removing autopkgtest-satdep (0) ... 600s autopkgtest [19:41:54]: test test-cli: [----------------------- 602s $ pyfastx --help 603s usage: pyfastx COMMAND [OPTIONS] 603s 603s A command line tool for FASTA/Q file manipulation 603s 603s options: 603s -h, --help show this help message and exit 603s -v, --version show program's version number and exit 603s 603s Commands: 603s 603s index build index for fasta/q file 603s stat show detailed statistics information of fasta/q file 603s split split fasta/q file into multiple files 603s fq2fa convert fastq file to fasta file 603s subseq get subsequences from fasta file by region 603s sample randomly sample sequences from fasta or fastq file 603s extract extract full sequences or reads from fasta/q file 603s $ # Found pyfastx commands: 'index stat split fq2fa subseq sample extract' 603s $ pyfastx index --help 603s usage: pyfastx index [-h] [-f] fastx [fastx ...] 603s 603s positional arguments: 603s fastx fasta or fastq file, gzip support 603s 603s options: 603s -h, --help show this help message and exit 603s -f, --full build full index, base composition will be calculated 603s $ pyfastx stat --help 603s usage: pyfastx stat [-h] fastx [fastx ...] 603s 603s positional arguments: 603s fastx fasta or fastq file, gzip support 603s 603s options: 603s -h, --help show this help message and exit 603s $ pyfastx split --help 603s usage: pyfastx split [-h] (-n int | -c int) [-o str] fastx 603s 603s positional arguments: 603s fastx fasta or fastq file, gzip support 603s 603s options: 603s -h, --help show this help message and exit 603s -n int split a fasta/q file into N new files with even size 603s -c int split a fasta/q file into multiple files containing 603s the same sequence counts 603s -o str, --out-dir str 603s output directory, default is current folder 603s $ pyfastx fq2fa --help 603s usage: pyfastx fq2fa [-h] [-o str] fastx 603s 603s positional arguments: 603s fastx fastq file, gzip support 603s 603s options: 603s -h, --help show this help message and exit 603s -o str, --out-file str 603s output file, default: output to stdout 604s $ pyfastx subseq --help 604s usage: pyfastx subseq [-h] [-r str | -b str] [-o str] fastx [region ...] 604s 604s positional arguments: 604s fastx input fasta file, gzip support 604s region format is chr:start-end, start and end position is 604s 1-based, multiple regions were separated by space 604s 604s options: 604s -h, --help show this help message and exit 604s -r str, --region-file str 604s tab-delimited file, one region per line, both start 604s and end position are 1-based 604s -b str, --bed-file str 604s tab-delimited BED file, 0-based start position and 604s 1-based end position 604s -o str, --out-file str 604s output file, default: output to stdout 604s $ pyfastx sample --help 604s usage: pyfastx sample [-h] (-n int | -p float) [-s int] [--sequential-read] 604s [-o str] 604s fastx 604s 604s positional arguments: 604s fastx fasta or fastq file, gzip support 604s 604s options: 604s -h, --help show this help message and exit 604s -n int number of sequences to be sampled 604s -p float proportion of sequences to be sampled, 0~1 604s -s int, --seed int random seed, default is the current system time 604s --sequential-read start sequential reading, particularly suitable for 604s sampling large numbers of sequences 604s -o str, --out-file str 604s output file, default: output to stdout 604s $ pyfastx extract --help 604s usage: pyfastx extract [-h] [-l str] [--reverse-complement] [--out-fasta] 604s [-o str] [--sequential-read] 604s fastx [name ...] 604s 604s positional arguments: 604s fastx fasta or fastq file, gzip support 604s name sequence name or read name, multiple names were 604s separated by space 604s 604s options: 604s -h, --help show this help message and exit 604s -l str, --list-file str 604s a file containing sequence or read names, one name per 604s line 604s --reverse-complement output reverse complement sequence 604s --out-fasta output fasta format when extract reads from fastq, 604s default output fastq format 604s -o str, --out-file str 604s output file, default: output to stdout 604s --sequential-read start sequential reading, particularly suitable for 604s extracting large numbers of sequences 604s $ pyfastx --version 604s pyfastx version 2.1.0 604s $ pyfastx index protein.fa 604s $ pyfastx index rna.fa 604s $ pyfastx index test.fa 604s $ pyfastx index test.fq 605s $ pyfastx index test.fa.gz 605s $ pyfastx index test.fq.gz 605s $ pyfastx stat protein.fa 605s fileName seqType seqCounts totalBases GC% avgLen medianLen maxLen minLen N50 L50 605s protein.fa protein 17 2265 - 133.235 80.0 419 23 263 4 605s $ pyfastx split -n 2 protein.fa 605s $ pyfastx fq2fa test.fq -o test.fa 605s $ pyfastx subseq protein.fa UPI0000000011:1-4 606s >UPI0000000011:1-4 606s MVDA 606s $ pyfastx sample -n 1 test.fq.gz -o sample.fq 606s $ pyfastx extract protein.fa UPI0000000011 606s >UPI0000000011 status=active 606s MVDAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIY 606s IPGTIILYATYVKSLLMKS 607s autopkgtest [19:42:01]: test test-cli: -----------------------] 611s autopkgtest [19:42:05]: test test-cli: - - - - - - - - - - results - - - - - - - - - - 611s test-cli PASS 615s autopkgtest [19:42:09]: @@@@@@@@@@@@@@@@@@@@ summary 615s run-unit-test FAIL non-zero exit status 1 615s test-cli PASS