0s autopkgtest [17:19:40]: starting date and time: 2024-11-13 17:19:40+0000 0s autopkgtest [17:19:40]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [17:19:40]: host juju-7f2275-prod-proposed-migration-environment-9; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.xqz5uoap/out --timeout-copy=6000 --setup-commands 'ln -s /dev/null /etc/systemd/system/bluetooth.service; printf "http_proxy=http://squid.internal:3128\nhttps_proxy=http://squid.internal:3128\nno_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com\n" >> /etc/environment' --apt-pocket=proposed=src:python3-defaults,src:python3-stdlib-extensions --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 python3-stdlib-extensions/3.12.7-1' -- lxd -r lxd-armhf-10.145.243.232 lxd-armhf-10.145.243.232:autopkgtest/ubuntu/plucky/armhf 53s autopkgtest [17:20:33]: testbed dpkg architecture: armhf 55s autopkgtest [17:20:35]: testbed apt version: 2.9.8 55s autopkgtest [17:20:35]: @@@@@@@@@@@@@@@@@@@@ test bed setup 63s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 63s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [17.2 kB] 63s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [104 kB] 63s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [971 kB] 64s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 64s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Packages [106 kB] 64s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Packages [647 kB] 64s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Packages [17.2 kB] 64s Fetched 1943 kB in 1s (1317 kB/s) 64s Reading package lists... 83s tee: /proc/self/fd/2: Permission denied 106s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 106s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 106s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 106s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 108s Reading package lists... 108s Reading package lists... 108s Building dependency tree... 108s Reading state information... 108s Calculating upgrade... 109s The following NEW packages will be installed: 109s python3.13-gdbm 109s The following packages will be upgraded: 109s libgnutls30t64 libjson-glib-1.0-0 libjson-glib-1.0-common libpython3-stdlib 109s libutempter0 python3 python3-gdbm python3-minimal 109s 8 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 109s Need to get 1131 kB of archives. 109s After this operation, 95.2 kB of additional disk space will be used. 109s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-minimal armhf 3.12.7-1 [27.4 kB] 109s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3 armhf 3.12.7-1 [24.0 kB] 109s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libpython3-stdlib armhf 3.12.7-1 [10.0 kB] 109s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf libgnutls30t64 armhf 3.8.8-2ubuntu1 [955 kB] 109s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-gdbm armhf 3.13.0-2 [29.5 kB] 109s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-gdbm armhf 3.12.7-1 [8642 B] 109s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-common all 1.10.0+ds-3 [5586 B] 109s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-0 armhf 1.10.0+ds-3 [61.7 kB] 109s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libutempter0 armhf 1.2.1-4 [9062 B] 110s Fetched 1131 kB in 1s (2077 kB/s) 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59559 files and directories currently installed.) 110s Preparing to unpack .../python3-minimal_3.12.7-1_armhf.deb ... 110s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 110s Setting up python3-minimal (3.12.7-1) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59559 files and directories currently installed.) 110s Preparing to unpack .../python3_3.12.7-1_armhf.deb ... 110s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 110s Preparing to unpack .../libpython3-stdlib_3.12.7-1_armhf.deb ... 110s Unpacking libpython3-stdlib:armhf (3.12.7-1) over (3.12.6-0ubuntu1) ... 110s Preparing to unpack .../libgnutls30t64_3.8.8-2ubuntu1_armhf.deb ... 110s Unpacking libgnutls30t64:armhf (3.8.8-2ubuntu1) over (3.8.6-2ubuntu1) ... 110s Setting up libgnutls30t64:armhf (3.8.8-2ubuntu1) ... 110s Selecting previously unselected package python3.13-gdbm. 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59559 files and directories currently installed.) 110s Preparing to unpack .../python3.13-gdbm_3.13.0-2_armhf.deb ... 110s Unpacking python3.13-gdbm (3.13.0-2) ... 111s Preparing to unpack .../python3-gdbm_3.12.7-1_armhf.deb ... 111s Unpacking python3-gdbm:armhf (3.12.7-1) over (3.12.6-1ubuntu1) ... 111s Preparing to unpack .../libjson-glib-1.0-common_1.10.0+ds-3_all.deb ... 111s Unpacking libjson-glib-1.0-common (1.10.0+ds-3) over (1.10.0+ds-2) ... 111s Preparing to unpack .../libjson-glib-1.0-0_1.10.0+ds-3_armhf.deb ... 111s Unpacking libjson-glib-1.0-0:armhf (1.10.0+ds-3) over (1.10.0+ds-2) ... 111s Preparing to unpack .../libutempter0_1.2.1-4_armhf.deb ... 111s Unpacking libutempter0:armhf (1.2.1-4) over (1.2.1-3build1) ... 111s Setting up libutempter0:armhf (1.2.1-4) ... 111s Setting up libjson-glib-1.0-common (1.10.0+ds-3) ... 111s Setting up python3.13-gdbm (3.13.0-2) ... 111s Setting up libpython3-stdlib:armhf (3.12.7-1) ... 111s Setting up python3 (3.12.7-1) ... 111s Setting up libjson-glib-1.0-0:armhf (1.10.0+ds-3) ... 111s Setting up python3-gdbm:armhf (3.12.7-1) ... 111s Processing triggers for man-db (2.12.1-3) ... 112s Processing triggers for libc-bin (2.40-1ubuntu3) ... 112s Reading package lists... 112s Building dependency tree... 112s Reading state information... 113s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 115s autopkgtest [17:21:35]: rebooting testbed after setup commands that affected boot 187s autopkgtest [17:22:47]: testbed running kernel: Linux 6.8.0-48-generic #48~22.04.1-Ubuntu SMP PREEMPT_DYNAMIC Mon Oct 7 11:49:53 UTC 2 217s autopkgtest [17:23:17]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 241s Get:1 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (dsc) [2389 B] 241s Get:2 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (tar) [4319 kB] 241s Get:3 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (diff) [7604 B] 241s gpgv: Signature made Sat Jul 13 18:52:01 2024 UTC 241s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 241s gpgv: issuer "emollier@debian.org" 241s gpgv: Can't check signature: No public key 241s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6.dsc: no acceptable signature found 242s autopkgtest [17:23:42]: testing package libedlib version 1.2.7-6 244s autopkgtest [17:23:44]: build not needed 247s autopkgtest [17:23:47]: test run-unit-test: preparing testbed 257s Reading package lists... 258s Building dependency tree... 258s Reading state information... 259s Starting pkgProblemResolver with broken count: 0 259s Starting 2 pkgProblemResolver with broken count: 0 259s Done 259s The following additional packages will be installed: 259s edlib-aligner libedlib-dev libedlib1 python3-edlib 259s The following NEW packages will be installed: 259s autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib 259s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 259s Need to get 115 kB/116 kB of archives. 259s After this operation, 266 kB of additional disk space will be used. 259s Get:1 /tmp/autopkgtest.hreDi3/1-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [728 B] 260s Get:2 http://ftpmaster.internal/ubuntu plucky/universe armhf libedlib1 armhf 1.2.7-6 [15.4 kB] 260s Get:3 http://ftpmaster.internal/ubuntu plucky/universe armhf edlib-aligner armhf 1.2.7-6 [19.9 kB] 260s Get:4 http://ftpmaster.internal/ubuntu plucky/universe armhf libedlib-dev armhf 1.2.7-6 [19.8 kB] 260s Get:5 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-edlib armhf 1.2.7-6 [60.0 kB] 260s Fetched 115 kB in 0s (249 kB/s) 260s Selecting previously unselected package libedlib1:armhf. 260s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59566 files and directories currently installed.) 260s Preparing to unpack .../libedlib1_1.2.7-6_armhf.deb ... 260s Unpacking libedlib1:armhf (1.2.7-6) ... 260s Selecting previously unselected package edlib-aligner. 260s Preparing to unpack .../edlib-aligner_1.2.7-6_armhf.deb ... 260s Unpacking edlib-aligner (1.2.7-6) ... 260s Selecting previously unselected package libedlib-dev:armhf. 260s Preparing to unpack .../libedlib-dev_1.2.7-6_armhf.deb ... 260s Unpacking libedlib-dev:armhf (1.2.7-6) ... 260s Selecting previously unselected package python3-edlib:armhf. 260s Preparing to unpack .../python3-edlib_1.2.7-6_armhf.deb ... 260s Unpacking python3-edlib:armhf (1.2.7-6) ... 260s Selecting previously unselected package autopkgtest-satdep. 261s Preparing to unpack .../1-autopkgtest-satdep.deb ... 261s Unpacking autopkgtest-satdep (0) ... 261s Setting up libedlib1:armhf (1.2.7-6) ... 261s Setting up python3-edlib:armhf (1.2.7-6) ... 261s Setting up edlib-aligner (1.2.7-6) ... 261s Setting up libedlib-dev:armhf (1.2.7-6) ... 261s Setting up autopkgtest-satdep (0) ... 261s Processing triggers for man-db (2.12.1-3) ... 261s Processing triggers for libc-bin (2.40-1ubuntu3) ... 279s (Reading database ... 59603 files and directories currently installed.) 279s Removing autopkgtest-satdep (0) ... 285s autopkgtest [17:24:25]: test run-unit-test: [----------------------- 287s Using NW alignment mode. 287s Reading queries... 287s Read 1 queries, 110 residues total. 287s Reading target fasta file... 287s Read target, 109 residues. 287s 287s Comparing queries to target... 287s 287s Query #0 (110 residues): score = 17 287s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 287s ||||||| | |||||||||| ||||||||||||||||||||||||||| 287s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 287s 287s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 287s | |||||||||||| || |||||||||| ||||||||| |||||| | 287s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 287s 287s T: AESIKSKKKKKE-STTB (93 - 108) 287s ||||||||||| ||| 287s Q: -ESIKSKKKKKENSTT- (94 - 109) 287s 287s 287s Cpu time of searching: 0.000051 287s autopkgtest [17:24:27]: test run-unit-test: -----------------------] 291s autopkgtest [17:24:31]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 291s run-unit-test PASS 296s autopkgtest [17:24:36]: @@@@@@@@@@@@@@@@@@@@ summary 296s run-unit-test PASS