0s autopkgtest [22:51:05]: starting date and time: 2024-11-13 22:51:05+0000 0s autopkgtest [22:51:05]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [22:51:05]: host juju-7f2275-prod-proposed-migration-environment-9; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.wtd35bev/out --timeout-copy=6000 --setup-commands 'ln -s /dev/null /etc/systemd/system/bluetooth.service; printf "http_proxy=http://squid.internal:3128\nhttps_proxy=http://squid.internal:3128\nno_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com\n" >> /etc/environment' --apt-pocket=proposed=src:fdroidserver,src:git,src:setuptools,src:google-android-installers,src:python3-defaults,src:openjdk-24,src:python3-stdlib-extensions,src:openjdk-8 --apt-upgrade fdroidserver --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=fdroidserver/2.3~a2-1 git/1:2.45.2-1.2ubuntu1 setuptools/75.2.0-1 google-android-installers/1726697545-1 python3-defaults/3.12.7-1 openjdk-24/24~22ea-1 python3-stdlib-extensions/3.12.7-1 openjdk-8/8u432-ga~us1-0ubuntu1' -- lxd -r lxd-armhf-10.145.243.36 lxd-armhf-10.145.243.36:autopkgtest/ubuntu/plucky/armhf 53s autopkgtest [22:51:58]: testbed dpkg architecture: armhf 55s autopkgtest [22:52:00]: testbed apt version: 2.9.8 55s autopkgtest [22:52:00]: @@@@@@@@@@@@@@@@@@@@ test bed setup 63s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 63s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [974 kB] 64s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [101 kB] 64s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 64s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [17.2 kB] 64s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Packages [104 kB] 64s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Packages [666 kB] 64s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Packages [17.2 kB] 64s Fetched 1959 kB in 1s (2121 kB/s) 64s Reading package lists... 90s tee: /proc/self/fd/2: Permission denied 113s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 113s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 113s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 113s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 114s Reading package lists... 114s Reading package lists... 115s Building dependency tree... 115s Reading state information... 116s Calculating upgrade... 118s The following packages were automatically installed and are no longer required: 118s libperl5.38t64 perl-modules-5.38 python3-netifaces 118s Use 'apt autoremove' to remove them. 118s The following NEW packages will be installed: 118s libperl5.40 perl-modules-5.40 python3-jaraco.text python3.13-gdbm 118s systemd-cryptsetup 118s The following packages will be upgraded: 118s apport apport-core-dump-handler base-files base-passwd bash-completion 118s dhcpcd-base distro-info-data dpkg dpkg-dev fwupd gcc-14-base info 118s install-info iproute2 libarchive13t64 libatomic1 libattr1 118s libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 libblockdev-mdraid3 118s libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 libblockdev-utils3 118s libblockdev3 libbpf1 libbsd0 libbytesize-common libbytesize1 libdb5.3t64 118s libdpkg-perl libdrm-common libdrm2 libdw1t64 libedit2 libelf1t64 libevdev2 118s libfastjson4 libflashrom1 libftdi1-2 libfwupd2 libgcc-s1 libgnutls30t64 118s libgpgme11t64 libinih1 libjson-c5 libjson-glib-1.0-0 libjson-glib-1.0-common 118s libkeyutils1 libldap-common libldap2 liblocale-gettext-perl libmaxminddb0 118s libmnl0 libnetfilter-conntrack3 libnetplan1 libnewt0.52 libnghttp2-14 118s libnspr4 libnss-systemd libnvme1t64 libpam-systemd libpipeline1 libplymouth5 118s libpng16-16t64 libpopt0 libpython3-stdlib libpython3.12-minimal 118s libpython3.12-stdlib libsgutils2-1.46-2 libssh2-1t64 libstdc++6 118s libsystemd-shared libsystemd0 libtext-charwidth-perl libtext-iconv-perl 118s libtraceevent1 libtraceevent1-plugin libudev1 libudisks2-0 liburcu8t64 118s libutempter0 libuv1t64 libx11-6 libx11-data libxau6 libxmlb2 mawk 118s motd-news-config nano netplan-generator netplan.io openssh-client 118s openssh-server openssh-sftp-server pci.ids perl perl-base plymouth 118s plymouth-theme-ubuntu-text python3 python3-apport python3-certifi 118s python3-cffi-backend python3-configobj python3-gdbm python3-gi python3-idna 118s python3-jaraco.functools python3-json-pointer python3-jsonpatch 118s python3-lazr.restfulclient python3-lazr.uri python3-minimal 118s python3-more-itertools python3-netplan python3-newt python3-oauthlib 118s python3-pkg-resources python3-problem-report python3-setuptools 118s python3-typeguard python3-urllib3 python3-wadllib python3-zipp python3.12 118s python3.12-gdbm python3.12-minimal sg3-utils sg3-utils-udev ssh-import-id 118s systemd systemd-resolved systemd-sysv systemd-timesyncd tzdata udev udisks2 118s ufw usbutils vim-common vim-tiny whiptail xxd 118s 145 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 118s Need to get 46.3 MB of archives. 118s After this operation, 43.2 MB of additional disk space will be used. 118s Get:1 http://ftpmaster.internal/ubuntu plucky/main armhf motd-news-config all 13.5ubuntu3 [5190 B] 118s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf base-files armhf 13.5ubuntu3 [75.1 kB] 118s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg armhf 1.22.11ubuntu3 [1247 kB] 119s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf perl-modules-5.40 all 5.40.0-7 [3214 kB] 119s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libperl5.40 armhf 5.40.0-7 [4139 kB] 119s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf perl armhf 5.40.0-7 [263 kB] 119s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf perl-base armhf 5.40.0-7 [1674 kB] 119s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf liblocale-gettext-perl armhf 1.07-7build1 [15.0 kB] 119s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-iconv-perl armhf 1.7-8build4 [12.8 kB] 119s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-charwidth-perl armhf 0.04-11build4 [9128 B] 119s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf libdb5.3t64 armhf 5.3.28+dfsg2-9 [655 kB] 119s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf base-passwd armhf 3.6.5 [53.2 kB] 119s Get:13 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-minimal armhf 3.12.7-1 [27.4 kB] 119s Get:14 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3 armhf 3.12.7-1 [24.0 kB] 119s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf tzdata all 2024b-1ubuntu2 [274 kB] 119s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12 armhf 3.12.7-3 [661 kB] 119s Get:17 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-stdlib armhf 3.12.7-3 [1934 kB] 119s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-minimal armhf 3.12.7-3 [2012 kB] 119s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-minimal armhf 3.12.7-3 [822 kB] 119s Get:20 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libpython3-stdlib armhf 3.12.7-1 [10.0 kB] 119s Get:21 http://ftpmaster.internal/ubuntu plucky/main armhf libnss-systemd armhf 256.5-2ubuntu4 [155 kB] 119s Get:22 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-timesyncd armhf 256.5-2ubuntu4 [40.7 kB] 119s Get:23 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-resolved armhf 256.5-2ubuntu4 [309 kB] 119s Get:24 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd-shared armhf 256.5-2ubuntu4 [2129 kB] 119s Get:25 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd0 armhf 256.5-2ubuntu4 [428 kB] 119s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-sysv armhf 256.5-2ubuntu4 [11.9 kB] 119s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf libpam-systemd armhf 256.5-2ubuntu4 [226 kB] 119s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf systemd armhf 256.5-2ubuntu4 [3442 kB] 119s Get:29 http://ftpmaster.internal/ubuntu plucky/main armhf udev armhf 256.5-2ubuntu4 [1949 kB] 119s Get:30 http://ftpmaster.internal/ubuntu plucky/main armhf libudev1 armhf 256.5-2ubuntu4 [188 kB] 119s Get:31 http://ftpmaster.internal/ubuntu plucky/main armhf python3-problem-report all 2.30.0-0ubuntu5 [25.0 kB] 119s Get:32 http://ftpmaster.internal/ubuntu plucky/main armhf python3-apport all 2.30.0-0ubuntu5 [93.2 kB] 119s Get:33 http://ftpmaster.internal/ubuntu plucky/main armhf python3-gi armhf 3.50.0-3 [227 kB] 119s Get:34 http://ftpmaster.internal/ubuntu plucky/main armhf apport-core-dump-handler all 2.30.0-0ubuntu5 [17.9 kB] 119s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf apport all 2.30.0-0ubuntu5 [83.0 kB] 119s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf libbsd0 armhf 0.12.2-2 [36.8 kB] 119s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf libedit2 armhf 3.1-20240808-1 [79.0 kB] 119s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-sftp-server armhf 1:9.7p1-7ubuntu5 [35.4 kB] 120s Get:39 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-server armhf 1:9.7p1-7ubuntu5 [505 kB] 120s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-client armhf 1:9.7p1-7ubuntu5 [889 kB] 120s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf libatomic1 armhf 14.2.0-8ubuntu1 [7846 B] 120s Get:42 http://ftpmaster.internal/ubuntu plucky/main armhf gcc-14-base armhf 14.2.0-8ubuntu1 [51.5 kB] 120s Get:43 http://ftpmaster.internal/ubuntu plucky/main armhf libstdc++6 armhf 14.2.0-8ubuntu1 [711 kB] 120s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf libgcc-s1 armhf 14.2.0-8ubuntu1 [40.8 kB] 120s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf libattr1 armhf 1:2.5.2-2 [10.5 kB] 120s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf libgnutls30t64 armhf 3.8.8-2ubuntu1 [955 kB] 120s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf install-info armhf 7.1.1-1 [61.4 kB] 120s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf mawk armhf 1.3.4.20240905-1 [116 kB] 120s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf dhcpcd-base armhf 1:10.1.0-2 [188 kB] 120s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf distro-info-data all 0.63 [6588 B] 120s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf libdw1t64 armhf 0.192-4 [243 kB] 120s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf libelf1t64 armhf 0.192-4 [50.2 kB] 120s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libbpf1 armhf 1:1.5.0-1 [158 kB] 120s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libmnl0 armhf 1.0.5-3 [10.7 kB] 120s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf iproute2 armhf 6.10.0-2ubuntu1 [1082 kB] 120s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf libfastjson4 armhf 1.2304.0-2 [20.2 kB] 120s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-c5 armhf 0.18+ds-1 [33.2 kB] 120s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf libkeyutils1 armhf 1.6.3-4ubuntu2 [8712 B] 120s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf netplan-generator armhf 1.1.1-1 [60.4 kB] 120s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf python3-cffi-backend armhf 1.17.1-2 [68.7 kB] 120s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf python3-netplan armhf 1.1.1-1 [24.1 kB] 120s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf netplan.io armhf 1.1.1-1 [66.4 kB] 120s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libnetplan1 armhf 1.1.1-1 [122 kB] 120s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf python3-newt armhf 0.52.24-2ubuntu4 [19.7 kB] 120s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf libnewt0.52 armhf 0.52.24-2ubuntu4 [39.2 kB] 120s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf libpopt0 armhf 1.19+dfsg-2 [25.4 kB] 120s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf vim-tiny armhf 2:9.1.0777-1ubuntu1 [693 kB] 120s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf vim-common all 2:9.1.0777-1ubuntu1 [394 kB] 120s Get:69 http://ftpmaster.internal/ubuntu plucky/main armhf whiptail armhf 0.52.24-2ubuntu4 [17.2 kB] 120s Get:70 http://ftpmaster.internal/ubuntu plucky/main armhf xxd armhf 2:9.1.0777-1ubuntu1 [66.8 kB] 120s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf bash-completion all 1:2.14.0-2 [210 kB] 120s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf info armhf 7.1.1-1 [126 kB] 120s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-common all 2.4.123-1 [8436 B] 120s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm2 armhf 2.4.123-1 [36.5 kB] 120s Get:75 http://ftpmaster.internal/ubuntu plucky/main armhf libevdev2 armhf 1.13.3+dfsg-1 [29.7 kB] 120s Get:76 http://ftpmaster.internal/ubuntu plucky/main armhf libmaxminddb0 armhf 1.11.0-1 [16.8 kB] 120s Get:77 http://ftpmaster.internal/ubuntu plucky/main armhf libnetfilter-conntrack3 armhf 1.1.0-1 [38.4 kB] 120s Get:78 http://ftpmaster.internal/ubuntu plucky/main armhf libnghttp2-14 armhf 1.64.0-1 [68.9 kB] 120s Get:79 http://ftpmaster.internal/ubuntu plucky/main armhf libpipeline1 armhf 1.5.8-1 [26.9 kB] 120s Get:80 http://ftpmaster.internal/ubuntu plucky/main armhf libpng16-16t64 armhf 1.6.44-2 [168 kB] 120s Get:81 http://ftpmaster.internal/ubuntu plucky/main armhf libplymouth5 armhf 24.004.60-1ubuntu11 [140 kB] 120s Get:82 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1-plugin armhf 1:1.8.3-1ubuntu1 [18.1 kB] 120s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1 armhf 1:1.8.3-1ubuntu1 [52.1 kB] 120s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf liburcu8t64 armhf 0.14.1-1 [56.6 kB] 120s Get:85 http://ftpmaster.internal/ubuntu plucky/main armhf libuv1t64 armhf 1.48.0-7 [83.3 kB] 120s Get:86 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-data all 2:1.8.10-2 [116 kB] 120s Get:87 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-6 armhf 2:1.8.10-2 [587 kB] 120s Get:88 http://ftpmaster.internal/ubuntu plucky/main armhf libxau6 armhf 1:1.0.11-1 [6558 B] 120s Get:89 http://ftpmaster.internal/ubuntu plucky/main armhf nano armhf 8.2-1 [276 kB] 120s Get:90 http://ftpmaster.internal/ubuntu plucky/main armhf pci.ids all 0.0~2024.10.24-1 [279 kB] 120s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-1ubuntu11 [9920 B] 120s Get:92 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth armhf 24.004.60-1ubuntu11 [142 kB] 120s Get:93 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-gdbm armhf 3.12.7-3 [28.7 kB] 120s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-gdbm armhf 3.13.0-2 [29.5 kB] 120s Get:95 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-gdbm armhf 3.12.7-1 [8642 B] 120s Get:96 http://ftpmaster.internal/ubuntu plucky/main armhf ufw all 0.36.2-8 [170 kB] 120s Get:97 http://ftpmaster.internal/ubuntu plucky/main armhf usbutils armhf 1:018-1 [76.1 kB] 120s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg-dev all 1.22.11ubuntu3 [1088 kB] 120s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libdpkg-perl all 1.22.11ubuntu3 [279 kB] 120s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libarchive13t64 armhf 3.7.4-1.1 [331 kB] 120s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libftdi1-2 armhf 1.5-7 [25.7 kB] 121s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libflashrom1 armhf 1.4.0-3ubuntu1 [141 kB] 121s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-common all 1.10.0+ds-3 [5586 B] 121s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-0 armhf 1.10.0+ds-3 [61.7 kB] 121s Get:105 http://ftpmaster.internal/ubuntu plucky/main armhf libfwupd2 armhf 1.9.26-2 [125 kB] 121s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf libxmlb2 armhf 0.3.21-1 [57.7 kB] 121s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf fwupd armhf 1.9.26-2 [4404 kB] 121s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-utils3 armhf 3.2.1-1 [17.4 kB] 121s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-crypto3 armhf 3.2.1-1 [22.4 kB] 121s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-fs3 armhf 3.2.1-1 [34.3 kB] 121s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-loop3 armhf 3.2.1-1 [6552 B] 121s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize1 armhf 2.11-1ubuntu1 [12.0 kB] 121s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize-common all 2.11-1ubuntu1 [3584 B] 121s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-mdraid3 armhf 3.2.1-1 [13.4 kB] 121s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf libnvme1t64 armhf 1.11-1 [73.8 kB] 121s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-nvme3 armhf 3.2.1-1 [17.6 kB] 121s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-part3 armhf 3.2.1-1 [16.5 kB] 121s Get:118 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-swap3 armhf 3.2.1-1 [8952 B] 121s Get:119 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev3 armhf 3.2.1-1 [44.2 kB] 121s Get:120 http://ftpmaster.internal/ubuntu plucky/main armhf libgpgme11t64 armhf 1.23.2-5ubuntu4 [123 kB] 121s Get:121 http://ftpmaster.internal/ubuntu plucky/main armhf libinih1 armhf 58-1ubuntu1 [6750 B] 121s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf libldap-common all 2.6.8+dfsg-1~exp4ubuntu3 [32.3 kB] 121s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf libldap2 armhf 2.6.8+dfsg-1~exp4ubuntu3 [173 kB] 121s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf libnspr4 armhf 2:4.35-1.1ubuntu2 [94.1 kB] 121s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf libsgutils2-1.46-2 armhf 1.46-3ubuntu5 [82.5 kB] 121s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf libssh2-1t64 armhf 1.11.1-1 [116 kB] 121s Get:127 http://ftpmaster.internal/ubuntu plucky/main armhf udisks2 armhf 2.10.1-11ubuntu1 [278 kB] 121s Get:128 http://ftpmaster.internal/ubuntu plucky/main armhf libudisks2-0 armhf 2.10.1-11ubuntu1 [142 kB] 121s Get:129 http://ftpmaster.internal/ubuntu plucky/main armhf libutempter0 armhf 1.2.1-4 [9062 B] 121s Get:130 http://ftpmaster.internal/ubuntu plucky/main armhf python3-certifi all 2024.8.30+dfsg-1 [9742 B] 121s Get:131 http://ftpmaster.internal/ubuntu plucky/main armhf python3-configobj all 5.0.9-1 [33.9 kB] 121s Get:132 http://ftpmaster.internal/ubuntu plucky/main armhf python3-idna all 3.8-2 [47.0 kB] 121s Get:133 http://ftpmaster.internal/ubuntu plucky/main armhf python3-more-itertools all 10.5.0-1 [56.2 kB] 121s Get:134 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jaraco.functools all 4.1.0-1 [11.8 kB] 121s Get:135 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jaraco.text all 4.0.0-1 [11.5 kB] 121s Get:136 http://ftpmaster.internal/ubuntu plucky/main armhf python3-json-pointer all 2.4-2 [8396 B] 121s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jsonpatch all 1.32-4 [12.2 kB] 121s Get:138 http://ftpmaster.internal/ubuntu plucky/main armhf python3-typeguard all 4.4.1-1 [29.0 kB] 121s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf python3-zipp all 3.21.0-1 [10.2 kB] 122s Get:140 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-pkg-resources all 75.2.0-1 [134 kB] 122s Get:141 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-setuptools all 75.2.0-1 [657 kB] 122s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.uri all 1.0.6-4 [13.6 kB] 122s Get:143 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wadllib all 2.0.0-1 [36.7 kB] 122s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf python3-oauthlib all 3.2.2-2 [89.8 kB] 122s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.restfulclient all 0.14.6-2 [50.9 kB] 122s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf python3-urllib3 all 2.0.7-2ubuntu0.1 [93.1 kB] 122s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils armhf 1.46-3ubuntu5 [816 kB] 122s Get:148 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils-udev all 1.46-3ubuntu5 [5916 B] 122s Get:149 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-cryptsetup armhf 256.5-2ubuntu4 [122 kB] 122s Get:150 http://ftpmaster.internal/ubuntu plucky/main armhf ssh-import-id all 5.11-0ubuntu3 [10.1 kB] 123s Preconfiguring packages ... 123s Fetched 46.3 MB in 4s (12.5 MB/s) 123s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 123s Preparing to unpack .../motd-news-config_13.5ubuntu3_all.deb ... 123s Unpacking motd-news-config (13.5ubuntu3) over (13.3ubuntu6) ... 123s Preparing to unpack .../base-files_13.5ubuntu3_armhf.deb ... 123s Unpacking base-files (13.5ubuntu3) over (13.3ubuntu6) ... 123s Setting up base-files (13.5ubuntu3) ... 123s Installing new version of config file /etc/issue ... 123s Installing new version of config file /etc/issue.net ... 123s Installing new version of config file /etc/lsb-release ... 124s motd-news.service is a disabled or a static unit not running, not starting it. 124s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 124s Preparing to unpack .../dpkg_1.22.11ubuntu3_armhf.deb ... 124s Unpacking dpkg (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 124s Setting up dpkg (1.22.11ubuntu3) ... 125s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 125s Preparing to unpack .../perl_5.40.0-7_armhf.deb ... 125s Unpacking perl (5.40.0-7) over (5.38.2-5) ... 125s Selecting previously unselected package perl-modules-5.40. 125s Preparing to unpack .../perl-modules-5.40_5.40.0-7_all.deb ... 125s Unpacking perl-modules-5.40 (5.40.0-7) ... 126s Selecting previously unselected package libperl5.40:armhf. 126s Preparing to unpack .../libperl5.40_5.40.0-7_armhf.deb ... 126s Unpacking libperl5.40:armhf (5.40.0-7) ... 127s Preparing to unpack .../perl-base_5.40.0-7_armhf.deb ... 127s Unpacking perl-base (5.40.0-7) over (5.38.2-5) ... 127s Setting up perl-base (5.40.0-7) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 127s Preparing to unpack .../liblocale-gettext-perl_1.07-7build1_armhf.deb ... 127s Unpacking liblocale-gettext-perl (1.07-7build1) over (1.07-7) ... 127s Preparing to unpack .../libtext-iconv-perl_1.7-8build4_armhf.deb ... 127s Unpacking libtext-iconv-perl:armhf (1.7-8build4) over (1.7-8build3) ... 127s Preparing to unpack .../libtext-charwidth-perl_0.04-11build4_armhf.deb ... 127s Unpacking libtext-charwidth-perl:armhf (0.04-11build4) over (0.04-11build3) ... 127s Preparing to unpack .../libdb5.3t64_5.3.28+dfsg2-9_armhf.deb ... 127s Unpacking libdb5.3t64:armhf (5.3.28+dfsg2-9) over (5.3.28+dfsg2-7) ... 127s Setting up libdb5.3t64:armhf (5.3.28+dfsg2-9) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 127s Preparing to unpack .../base-passwd_3.6.5_armhf.deb ... 127s Unpacking base-passwd (3.6.5) over (3.6.4) ... 127s Setting up base-passwd (3.6.5) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 127s Preparing to unpack .../python3-minimal_3.12.7-1_armhf.deb ... 127s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 127s Setting up python3-minimal (3.12.7-1) ... 127s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 127s Preparing to unpack .../00-python3_3.12.7-1_armhf.deb ... 127s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 127s Preparing to unpack .../01-tzdata_2024b-1ubuntu2_all.deb ... 127s Unpacking tzdata (2024b-1ubuntu2) over (2024a-4ubuntu1) ... 128s Preparing to unpack .../02-python3.12_3.12.7-3_armhf.deb ... 128s Unpacking python3.12 (3.12.7-3) over (3.12.7-1) ... 128s Preparing to unpack .../03-libpython3.12-stdlib_3.12.7-3_armhf.deb ... 128s Unpacking libpython3.12-stdlib:armhf (3.12.7-3) over (3.12.7-1) ... 128s Preparing to unpack .../04-python3.12-minimal_3.12.7-3_armhf.deb ... 128s Unpacking python3.12-minimal (3.12.7-3) over (3.12.7-1) ... 128s Preparing to unpack .../05-libpython3.12-minimal_3.12.7-3_armhf.deb ... 128s Unpacking libpython3.12-minimal:armhf (3.12.7-3) over (3.12.7-1) ... 128s Preparing to unpack .../06-libpython3-stdlib_3.12.7-1_armhf.deb ... 128s Unpacking libpython3-stdlib:armhf (3.12.7-1) over (3.12.6-0ubuntu1) ... 129s Preparing to unpack .../07-libnss-systemd_256.5-2ubuntu4_armhf.deb ... 129s Unpacking libnss-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Preparing to unpack .../08-systemd-timesyncd_256.5-2ubuntu4_armhf.deb ... 129s Unpacking systemd-timesyncd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Preparing to unpack .../09-systemd-resolved_256.5-2ubuntu4_armhf.deb ... 129s Unpacking systemd-resolved (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Preparing to unpack .../10-libsystemd-shared_256.5-2ubuntu4_armhf.deb ... 129s Unpacking libsystemd-shared:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Preparing to unpack .../11-libsystemd0_256.5-2ubuntu4_armhf.deb ... 129s Unpacking libsystemd0:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Setting up libsystemd0:armhf (256.5-2ubuntu4) ... 129s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 129s Preparing to unpack .../systemd-sysv_256.5-2ubuntu4_armhf.deb ... 129s Unpacking systemd-sysv (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Preparing to unpack .../libpam-systemd_256.5-2ubuntu4_armhf.deb ... 129s Unpacking libpam-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 129s Preparing to unpack .../systemd_256.5-2ubuntu4_armhf.deb ... 129s Unpacking systemd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 130s Preparing to unpack .../udev_256.5-2ubuntu4_armhf.deb ... 130s Unpacking udev (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 130s Preparing to unpack .../libudev1_256.5-2ubuntu4_armhf.deb ... 130s Unpacking libudev1:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 130s Setting up libudev1:armhf (256.5-2ubuntu4) ... 130s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 130s Preparing to unpack .../0-python3-problem-report_2.30.0-0ubuntu5_all.deb ... 130s Unpacking python3-problem-report (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 130s Preparing to unpack .../1-python3-apport_2.30.0-0ubuntu5_all.deb ... 130s Unpacking python3-apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 131s Preparing to unpack .../2-python3-gi_3.50.0-3_armhf.deb ... 131s Unpacking python3-gi (3.50.0-3) over (3.48.2-1) ... 131s Preparing to unpack .../3-apport-core-dump-handler_2.30.0-0ubuntu5_all.deb ... 131s Unpacking apport-core-dump-handler (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 131s Preparing to unpack .../4-apport_2.30.0-0ubuntu5_all.deb ... 131s Unpacking apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 131s Preparing to unpack .../5-libbsd0_0.12.2-2_armhf.deb ... 131s Unpacking libbsd0:armhf (0.12.2-2) over (0.12.2-1) ... 131s Setting up libbsd0:armhf (0.12.2-2) ... 131s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 131s Preparing to unpack .../0-libedit2_3.1-20240808-1_armhf.deb ... 131s Unpacking libedit2:armhf (3.1-20240808-1) over (3.1-20240517-1) ... 131s Preparing to unpack .../1-openssh-sftp-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 131s Unpacking openssh-sftp-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 131s Preparing to unpack .../2-openssh-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 131s Unpacking openssh-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 131s Preparing to unpack .../3-openssh-client_1%3a9.7p1-7ubuntu5_armhf.deb ... 131s Unpacking openssh-client (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 131s Preparing to unpack .../4-libatomic1_14.2.0-8ubuntu1_armhf.deb ... 131s Unpacking libatomic1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 131s Preparing to unpack .../5-gcc-14-base_14.2.0-8ubuntu1_armhf.deb ... 131s Unpacking gcc-14-base:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 132s Setting up gcc-14-base:armhf (14.2.0-8ubuntu1) ... 132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 132s Preparing to unpack .../libstdc++6_14.2.0-8ubuntu1_armhf.deb ... 132s Unpacking libstdc++6:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 132s Setting up libstdc++6:armhf (14.2.0-8ubuntu1) ... 132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 132s Preparing to unpack .../libgcc-s1_14.2.0-8ubuntu1_armhf.deb ... 132s Unpacking libgcc-s1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 132s Setting up libgcc-s1:armhf (14.2.0-8ubuntu1) ... 132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 132s Preparing to unpack .../libattr1_1%3a2.5.2-2_armhf.deb ... 132s Unpacking libattr1:armhf (1:2.5.2-2) over (1:2.5.2-1build2) ... 132s Setting up libattr1:armhf (1:2.5.2-2) ... 132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 132s Preparing to unpack .../libgnutls30t64_3.8.8-2ubuntu1_armhf.deb ... 132s Unpacking libgnutls30t64:armhf (3.8.8-2ubuntu1) over (3.8.6-2ubuntu1) ... 132s Setting up libgnutls30t64:armhf (3.8.8-2ubuntu1) ... 132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 132s Preparing to unpack .../install-info_7.1.1-1_armhf.deb ... 132s Unpacking install-info (7.1.1-1) over (7.1-3build2) ... 132s Setting up install-info (7.1.1-1) ... 133s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 133s Preparing to unpack .../000-mawk_1.3.4.20240905-1_armhf.deb ... 133s Unpacking mawk (1.3.4.20240905-1) over (1.3.4.20240622-2) ... 133s Preparing to unpack .../001-dhcpcd-base_1%3a10.1.0-2_armhf.deb ... 133s Unpacking dhcpcd-base (1:10.1.0-2) over (1:10.0.8-3) ... 133s Preparing to unpack .../002-distro-info-data_0.63_all.deb ... 133s Unpacking distro-info-data (0.63) over (0.62) ... 133s Preparing to unpack .../003-libdw1t64_0.192-4_armhf.deb ... 133s Unpacking libdw1t64:armhf (0.192-4) over (0.191-2) ... 133s Preparing to unpack .../004-libelf1t64_0.192-4_armhf.deb ... 133s Unpacking libelf1t64:armhf (0.192-4) over (0.191-2) ... 133s Preparing to unpack .../005-libbpf1_1%3a1.5.0-1_armhf.deb ... 133s Unpacking libbpf1:armhf (1:1.5.0-1) over (1:1.4.5-1) ... 133s Preparing to unpack .../006-libmnl0_1.0.5-3_armhf.deb ... 133s Unpacking libmnl0:armhf (1.0.5-3) over (1.0.5-2build1) ... 133s Preparing to unpack .../007-iproute2_6.10.0-2ubuntu1_armhf.deb ... 133s Unpacking iproute2 (6.10.0-2ubuntu1) over (6.10.0-2) ... 133s Preparing to unpack .../008-libfastjson4_1.2304.0-2_armhf.deb ... 133s Unpacking libfastjson4:armhf (1.2304.0-2) over (1.2304.0-1build1) ... 133s Preparing to unpack .../009-libjson-c5_0.18+ds-1_armhf.deb ... 133s Unpacking libjson-c5:armhf (0.18+ds-1) over (0.17-1build1) ... 133s Preparing to unpack .../010-libkeyutils1_1.6.3-4ubuntu2_armhf.deb ... 133s Unpacking libkeyutils1:armhf (1.6.3-4ubuntu2) over (1.6.3-3build1) ... 133s Preparing to unpack .../011-netplan-generator_1.1.1-1_armhf.deb ... 133s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 133s Unpacking netplan-generator (1.1.1-1) over (1.1-1) ... 134s Preparing to unpack .../012-python3-cffi-backend_1.17.1-2_armhf.deb ... 134s Unpacking python3-cffi-backend:armhf (1.17.1-2) over (1.17.1-1) ... 134s Preparing to unpack .../013-python3-netplan_1.1.1-1_armhf.deb ... 134s Unpacking python3-netplan (1.1.1-1) over (1.1-1) ... 134s Preparing to unpack .../014-netplan.io_1.1.1-1_armhf.deb ... 134s Unpacking netplan.io (1.1.1-1) over (1.1-1) ... 134s Preparing to unpack .../015-libnetplan1_1.1.1-1_armhf.deb ... 134s Unpacking libnetplan1:armhf (1.1.1-1) over (1.1-1) ... 134s Preparing to unpack .../016-python3-newt_0.52.24-2ubuntu4_armhf.deb ... 134s Unpacking python3-newt:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 134s Preparing to unpack .../017-libnewt0.52_0.52.24-2ubuntu4_armhf.deb ... 134s Unpacking libnewt0.52:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 134s Preparing to unpack .../018-libpopt0_1.19+dfsg-2_armhf.deb ... 134s Unpacking libpopt0:armhf (1.19+dfsg-2) over (1.19+dfsg-1build1) ... 134s Preparing to unpack .../019-vim-tiny_2%3a9.1.0777-1ubuntu1_armhf.deb ... 134s Unpacking vim-tiny (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 134s Preparing to unpack .../020-vim-common_2%3a9.1.0777-1ubuntu1_all.deb ... 134s Unpacking vim-common (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 134s Preparing to unpack .../021-whiptail_0.52.24-2ubuntu4_armhf.deb ... 134s Unpacking whiptail (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 134s Preparing to unpack .../022-xxd_2%3a9.1.0777-1ubuntu1_armhf.deb ... 134s Unpacking xxd (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 134s Preparing to unpack .../023-bash-completion_1%3a2.14.0-2_all.deb ... 134s Unpacking bash-completion (1:2.14.0-2) over (1:2.14.0-1) ... 135s Preparing to unpack .../024-info_7.1.1-1_armhf.deb ... 135s Unpacking info (7.1.1-1) over (7.1-3build2) ... 135s Preparing to unpack .../025-libdrm-common_2.4.123-1_all.deb ... 135s Unpacking libdrm-common (2.4.123-1) over (2.4.122-1) ... 135s Preparing to unpack .../026-libdrm2_2.4.123-1_armhf.deb ... 135s Unpacking libdrm2:armhf (2.4.123-1) over (2.4.122-1) ... 135s Preparing to unpack .../027-libevdev2_1.13.3+dfsg-1_armhf.deb ... 135s Unpacking libevdev2:armhf (1.13.3+dfsg-1) over (1.13.2+dfsg-1) ... 135s Preparing to unpack .../028-libmaxminddb0_1.11.0-1_armhf.deb ... 135s Unpacking libmaxminddb0:armhf (1.11.0-1) over (1.10.0-1) ... 135s Preparing to unpack .../029-libnetfilter-conntrack3_1.1.0-1_armhf.deb ... 135s Unpacking libnetfilter-conntrack3:armhf (1.1.0-1) over (1.0.9-6build1) ... 135s Preparing to unpack .../030-libnghttp2-14_1.64.0-1_armhf.deb ... 135s Unpacking libnghttp2-14:armhf (1.64.0-1) over (1.62.1-2) ... 135s Preparing to unpack .../031-libpipeline1_1.5.8-1_armhf.deb ... 135s Unpacking libpipeline1:armhf (1.5.8-1) over (1.5.7-2) ... 135s Preparing to unpack .../032-libpng16-16t64_1.6.44-2_armhf.deb ... 135s Unpacking libpng16-16t64:armhf (1.6.44-2) over (1.6.44-1) ... 135s Preparing to unpack .../033-libplymouth5_24.004.60-1ubuntu11_armhf.deb ... 135s Unpacking libplymouth5:armhf (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 135s Preparing to unpack .../034-libtraceevent1-plugin_1%3a1.8.3-1ubuntu1_armhf.deb ... 135s Unpacking libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 135s Preparing to unpack .../035-libtraceevent1_1%3a1.8.3-1ubuntu1_armhf.deb ... 135s Unpacking libtraceevent1:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 135s Preparing to unpack .../036-liburcu8t64_0.14.1-1_armhf.deb ... 135s Unpacking liburcu8t64:armhf (0.14.1-1) over (0.14.0-4) ... 136s Preparing to unpack .../037-libuv1t64_1.48.0-7_armhf.deb ... 136s Unpacking libuv1t64:armhf (1.48.0-7) over (1.48.0-5) ... 136s Preparing to unpack .../038-libx11-data_2%3a1.8.10-2_all.deb ... 136s Unpacking libx11-data (2:1.8.10-2) over (2:1.8.7-1build1) ... 136s Preparing to unpack .../039-libx11-6_2%3a1.8.10-2_armhf.deb ... 136s Unpacking libx11-6:armhf (2:1.8.10-2) over (2:1.8.7-1build1) ... 136s Preparing to unpack .../040-libxau6_1%3a1.0.11-1_armhf.deb ... 136s Unpacking libxau6:armhf (1:1.0.11-1) over (1:1.0.9-1build6) ... 136s Preparing to unpack .../041-nano_8.2-1_armhf.deb ... 136s Unpacking nano (8.2-1) over (8.1-1) ... 136s Preparing to unpack .../042-pci.ids_0.0~2024.10.24-1_all.deb ... 136s Unpacking pci.ids (0.0~2024.10.24-1) over (0.0~2024.09.12-1) ... 136s Preparing to unpack .../043-plymouth-theme-ubuntu-text_24.004.60-1ubuntu11_armhf.deb ... 136s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 136s Preparing to unpack .../044-plymouth_24.004.60-1ubuntu11_armhf.deb ... 136s Unpacking plymouth (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 136s Preparing to unpack .../045-python3.12-gdbm_3.12.7-3_armhf.deb ... 136s Unpacking python3.12-gdbm (3.12.7-3) over (3.12.7-1) ... 136s Selecting previously unselected package python3.13-gdbm. 136s Preparing to unpack .../046-python3.13-gdbm_3.13.0-2_armhf.deb ... 136s Unpacking python3.13-gdbm (3.13.0-2) ... 136s Preparing to unpack .../047-python3-gdbm_3.12.7-1_armhf.deb ... 136s Unpacking python3-gdbm:armhf (3.12.7-1) over (3.12.6-1ubuntu1) ... 136s Preparing to unpack .../048-ufw_0.36.2-8_all.deb ... 136s Unpacking ufw (0.36.2-8) over (0.36.2-6) ... 137s Preparing to unpack .../049-usbutils_1%3a018-1_armhf.deb ... 137s Unpacking usbutils (1:018-1) over (1:017-3build1) ... 137s Preparing to unpack .../050-dpkg-dev_1.22.11ubuntu3_all.deb ... 137s Unpacking dpkg-dev (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 137s Preparing to unpack .../051-libdpkg-perl_1.22.11ubuntu3_all.deb ... 137s Unpacking libdpkg-perl (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 137s Preparing to unpack .../052-libarchive13t64_3.7.4-1.1_armhf.deb ... 137s Unpacking libarchive13t64:armhf (3.7.4-1.1) over (3.7.4-1) ... 137s Preparing to unpack .../053-libftdi1-2_1.5-7_armhf.deb ... 137s Unpacking libftdi1-2:armhf (1.5-7) over (1.5-6build5) ... 137s Preparing to unpack .../054-libflashrom1_1.4.0-3ubuntu1_armhf.deb ... 137s Unpacking libflashrom1:armhf (1.4.0-3ubuntu1) over (1.3.0-2.1ubuntu2) ... 137s Preparing to unpack .../055-libjson-glib-1.0-common_1.10.0+ds-3_all.deb ... 137s Unpacking libjson-glib-1.0-common (1.10.0+ds-3) over (1.8.0-2build2) ... 137s Preparing to unpack .../056-libjson-glib-1.0-0_1.10.0+ds-3_armhf.deb ... 137s Unpacking libjson-glib-1.0-0:armhf (1.10.0+ds-3) over (1.8.0-2build2) ... 137s Preparing to unpack .../057-libfwupd2_1.9.26-2_armhf.deb ... 137s Unpacking libfwupd2:armhf (1.9.26-2) over (1.9.24-1) ... 137s Preparing to unpack .../058-libxmlb2_0.3.21-1_armhf.deb ... 137s Unpacking libxmlb2:armhf (0.3.21-1) over (0.3.19-1) ... 137s Preparing to unpack .../059-fwupd_1.9.26-2_armhf.deb ... 137s Unpacking fwupd (1.9.26-2) over (1.9.24-1) ... 138s Preparing to unpack .../060-libblockdev-utils3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-utils3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../061-libblockdev-crypto3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-crypto3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../062-libblockdev-fs3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-fs3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../063-libblockdev-loop3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-loop3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../064-libbytesize1_2.11-1ubuntu1_armhf.deb ... 138s Unpacking libbytesize1:armhf (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 138s Preparing to unpack .../065-libbytesize-common_2.11-1ubuntu1_all.deb ... 138s Unpacking libbytesize-common (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 138s Preparing to unpack .../066-libblockdev-mdraid3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-mdraid3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../067-libnvme1t64_1.11-1_armhf.deb ... 138s Unpacking libnvme1t64 (1.11-1) over (1.10-1) ... 138s Preparing to unpack .../068-libblockdev-nvme3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-nvme3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../069-libblockdev-part3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-part3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../070-libblockdev-swap3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev-swap3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../071-libblockdev3_3.2.1-1_armhf.deb ... 138s Unpacking libblockdev3:armhf (3.2.1-1) over (3.1.1-2) ... 138s Preparing to unpack .../072-libgpgme11t64_1.23.2-5ubuntu4_armhf.deb ... 138s Unpacking libgpgme11t64:armhf (1.23.2-5ubuntu4) over (1.18.0-4.1ubuntu4) ... 138s Preparing to unpack .../073-libinih1_58-1ubuntu1_armhf.deb ... 138s Unpacking libinih1:armhf (58-1ubuntu1) over (55-1ubuntu2) ... 138s Preparing to unpack .../074-libldap-common_2.6.8+dfsg-1~exp4ubuntu3_all.deb ... 138s Unpacking libldap-common (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 138s Preparing to unpack .../075-libldap2_2.6.8+dfsg-1~exp4ubuntu3_armhf.deb ... 138s Unpacking libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 138s Preparing to unpack .../076-libnspr4_2%3a4.35-1.1ubuntu2_armhf.deb ... 138s Unpacking libnspr4:armhf (2:4.35-1.1ubuntu2) over (2:4.35-1.1ubuntu1) ... 138s Preparing to unpack .../077-libsgutils2-1.46-2_1.46-3ubuntu5_armhf.deb ... 138s Unpacking libsgutils2-1.46-2:armhf (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 138s Preparing to unpack .../078-libssh2-1t64_1.11.1-1_armhf.deb ... 138s Unpacking libssh2-1t64:armhf (1.11.1-1) over (1.11.0-7) ... 138s Preparing to unpack .../079-udisks2_2.10.1-11ubuntu1_armhf.deb ... 138s Unpacking udisks2 (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 138s Preparing to unpack .../080-libudisks2-0_2.10.1-11ubuntu1_armhf.deb ... 138s Unpacking libudisks2-0:armhf (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 139s Preparing to unpack .../081-libutempter0_1.2.1-4_armhf.deb ... 139s Unpacking libutempter0:armhf (1.2.1-4) over (1.2.1-3build1) ... 139s Preparing to unpack .../082-python3-certifi_2024.8.30+dfsg-1_all.deb ... 139s Unpacking python3-certifi (2024.8.30+dfsg-1) over (2024.6.2-1) ... 139s Preparing to unpack .../083-python3-configobj_5.0.9-1_all.deb ... 139s Unpacking python3-configobj (5.0.9-1) over (5.0.8-3) ... 139s Preparing to unpack .../084-python3-idna_3.8-2_all.deb ... 139s Unpacking python3-idna (3.8-2) over (3.6-2.1) ... 139s Preparing to unpack .../085-python3-more-itertools_10.5.0-1_all.deb ... 139s Unpacking python3-more-itertools (10.5.0-1) over (10.3.0-1) ... 139s Preparing to unpack .../086-python3-jaraco.functools_4.1.0-1_all.deb ... 139s Unpacking python3-jaraco.functools (4.1.0-1) over (4.0.2-1) ... 139s Selecting previously unselected package python3-jaraco.text. 139s Preparing to unpack .../087-python3-jaraco.text_4.0.0-1_all.deb ... 139s Unpacking python3-jaraco.text (4.0.0-1) ... 139s Preparing to unpack .../088-python3-json-pointer_2.4-2_all.deb ... 139s Unpacking python3-json-pointer (2.4-2) over (2.0-0ubuntu1) ... 139s Preparing to unpack .../089-python3-jsonpatch_1.32-4_all.deb ... 140s Unpacking python3-jsonpatch (1.32-4) over (1.32-3) ... 140s Preparing to unpack .../090-python3-typeguard_4.4.1-1_all.deb ... 140s Unpacking python3-typeguard (4.4.1-1) over (4.3.0-1) ... 140s Preparing to unpack .../091-python3-zipp_3.21.0-1_all.deb ... 140s Unpacking python3-zipp (3.21.0-1) over (3.20.0-1) ... 140s Preparing to unpack .../092-python3-pkg-resources_75.2.0-1_all.deb ... 140s Unpacking python3-pkg-resources (75.2.0-1) over (74.1.2-1) ... 140s Preparing to unpack .../093-python3-setuptools_75.2.0-1_all.deb ... 140s Unpacking python3-setuptools (75.2.0-1) over (74.1.2-1) ... 141s Preparing to unpack .../094-python3-lazr.uri_1.0.6-4_all.deb ... 141s Unpacking python3-lazr.uri (1.0.6-4) over (1.0.6-3) ... 141s Preparing to unpack .../095-python3-wadllib_2.0.0-1_all.deb ... 141s Unpacking python3-wadllib (2.0.0-1) over (1.3.6-5) ... 141s Preparing to unpack .../096-python3-oauthlib_3.2.2-2_all.deb ... 141s Unpacking python3-oauthlib (3.2.2-2) over (3.2.2-1) ... 141s Preparing to unpack .../097-python3-lazr.restfulclient_0.14.6-2_all.deb ... 141s Unpacking python3-lazr.restfulclient (0.14.6-2) over (0.14.6-1) ... 141s Preparing to unpack .../098-python3-urllib3_2.0.7-2ubuntu0.1_all.deb ... 141s Unpacking python3-urllib3 (2.0.7-2ubuntu0.1) over (2.0.7-2) ... 141s Preparing to unpack .../099-sg3-utils_1.46-3ubuntu5_armhf.deb ... 141s Unpacking sg3-utils (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 141s Preparing to unpack .../100-sg3-utils-udev_1.46-3ubuntu5_all.deb ... 141s Unpacking sg3-utils-udev (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 142s Selecting previously unselected package systemd-cryptsetup. 142s Preparing to unpack .../101-systemd-cryptsetup_256.5-2ubuntu4_armhf.deb ... 142s Unpacking systemd-cryptsetup (256.5-2ubuntu4) ... 142s Preparing to unpack .../102-ssh-import-id_5.11-0ubuntu3_all.deb ... 142s Unpacking ssh-import-id (5.11-0ubuntu3) over (5.11-0ubuntu2) ... 142s Setting up libpipeline1:armhf (1.5.8-1) ... 142s Setting up motd-news-config (13.5ubuntu3) ... 142s Setting up libtext-iconv-perl:armhf (1.7-8build4) ... 142s Setting up libtext-charwidth-perl:armhf (0.04-11build4) ... 142s Setting up liburcu8t64:armhf (0.14.1-1) ... 142s Setting up libxau6:armhf (1:1.0.11-1) ... 142s Setting up libkeyutils1:armhf (1.6.3-4ubuntu2) ... 142s Setting up pci.ids (0.0~2024.10.24-1) ... 142s Setting up libnewt0.52:armhf (0.52.24-2ubuntu4) ... 142s Setting up distro-info-data (0.63) ... 142s Setting up libfastjson4:armhf (1.2304.0-2) ... 142s Setting up libinih1:armhf (58-1ubuntu1) ... 142s Setting up libmaxminddb0:armhf (1.11.0-1) ... 142s Setting up python3.12-gdbm (3.12.7-3) ... 142s Setting up libxmlb2:armhf (0.3.21-1) ... 142s Setting up libedit2:armhf (3.1-20240808-1) ... 142s Setting up libuv1t64:armhf (1.48.0-7) ... 142s Setting up libpython3.12-minimal:armhf (3.12.7-3) ... 142s Setting up libnghttp2-14:armhf (1.64.0-1) ... 142s Setting up libsgutils2-1.46-2:armhf (1.46-3ubuntu5) ... 142s Setting up libnetplan1:armhf (1.1.1-1) ... 142s Setting up libldap-common (2.6.8+dfsg-1~exp4ubuntu3) ... 142s Setting up usbutils (1:018-1) ... 142s Setting up xxd (2:9.1.0777-1ubuntu1) ... 142s Setting up libelf1t64:armhf (0.192-4) ... 142s Setting up libdw1t64:armhf (0.192-4) ... 142s Setting up tzdata (2024b-1ubuntu2) ... 142s 142s Current default time zone: 'Etc/UTC' 142s Local time is now: Wed Nov 13 22:53:27 UTC 2024. 142s Universal Time is now: Wed Nov 13 22:53:27 UTC 2024. 142s Run 'dpkg-reconfigure tzdata' if you wish to change it. 142s 142s Setting up libftdi1-2:armhf (1.5-7) ... 142s Setting up libflashrom1:armhf (1.4.0-3ubuntu1) ... 142s Setting up vim-common (2:9.1.0777-1ubuntu1) ... 142s Installing new version of config file /etc/vim/vimrc ... 142s Setting up libx11-data (2:1.8.10-2) ... 142s Setting up libnspr4:armhf (2:4.35-1.1ubuntu2) ... 142s Setting up bash-completion (1:2.14.0-2) ... 142s Setting up libbytesize-common (2.11-1ubuntu1) ... 142s Setting up libblockdev-utils3:armhf (3.2.1-1) ... 142s Setting up libpng16-16t64:armhf (1.6.44-2) ... 142s Setting up libmnl0:armhf (1.0.5-3) ... 142s Setting up libatomic1:armhf (14.2.0-8ubuntu1) ... 142s Setting up libsystemd-shared:armhf (256.5-2ubuntu4) ... 142s Setting up dhcpcd-base (1:10.1.0-2) ... 142s Setting up libutempter0:armhf (1.2.1-4) ... 142s Setting up nano (8.2-1) ... 142s Setting up libblockdev-fs3:armhf (3.2.1-1) ... 142s Setting up perl-modules-5.40 (5.40.0-7) ... 142s Setting up libnetfilter-conntrack3:armhf (1.1.0-1) ... 142s Setting up libtraceevent1:armhf (1:1.8.3-1ubuntu1) ... 142s Setting up libx11-6:armhf (2:1.8.10-2) ... 142s Setting up libjson-glib-1.0-common (1.10.0+ds-3) ... 142s Setting up mawk (1.3.4.20240905-1) ... 142s Setting up libbytesize1:armhf (2.11-1ubuntu1) ... 142s Setting up libgpgme11t64:armhf (1.23.2-5ubuntu4) ... 142s Setting up libssh2-1t64:armhf (1.11.1-1) ... 142s Setting up libdrm-common (2.4.123-1) ... 142s Setting up libarchive13t64:armhf (3.7.4-1.1) ... 142s Setting up libjson-c5:armhf (0.18+ds-1) ... 142s Setting up libevdev2:armhf (1.13.3+dfsg-1) ... 142s Setting up libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) ... 142s Setting up info (7.1.1-1) ... 142s Setting up liblocale-gettext-perl (1.07-7build1) ... 142s Setting up libbpf1:armhf (1:1.5.0-1) ... 142s Setting up libudisks2-0:armhf (2.10.1-11ubuntu1) ... 142s Setting up python3.13-gdbm (3.13.0-2) ... 142s Setting up libpopt0:armhf (1.19+dfsg-2) ... 142s Setting up sg3-utils (1.46-3ubuntu5) ... 142s Setting up python3.12-minimal (3.12.7-3) ... 143s Setting up libpython3.12-stdlib:armhf (3.12.7-3) ... 143s Setting up libblockdev-mdraid3:armhf (3.2.1-1) ... 143s Setting up libblockdev-crypto3:armhf (3.2.1-1) ... 143s Setting up libblockdev-swap3:armhf (3.2.1-1) ... 143s Setting up iproute2 (6.10.0-2ubuntu1) ... 143s Setting up openssh-client (1:9.7p1-7ubuntu5) ... 143s Setting up python3.12 (3.12.7-3) ... 144s Setting up libblockdev-loop3:armhf (3.2.1-1) ... 144s Setting up systemd (256.5-2ubuntu4) ... 144s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 145s Created symlink '/run/systemd/system/tmp.mount' → '/dev/null'. 145s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 145s Setting up vim-tiny (2:9.1.0777-1ubuntu1) ... 145s Setting up libblockdev3:armhf (3.2.1-1) ... 145s Installing new version of config file /etc/libblockdev/3/conf.d/00-default.cfg ... 145s Setting up libjson-glib-1.0-0:armhf (1.10.0+ds-3) ... 145s Setting up libblockdev-part3:armhf (3.2.1-1) ... 145s Setting up sg3-utils-udev (1.46-3ubuntu5) ... 146s update-initramfs: deferring update (trigger activated) 146s Setting up libperl5.40:armhf (5.40.0-7) ... 146s Setting up perl (5.40.0-7) ... 146s Setting up systemd-cryptsetup (256.5-2ubuntu4) ... 146s Setting up libnvme1t64 (1.11-1) ... 146s Setting up systemd-timesyncd (256.5-2ubuntu4) ... 146s systemd-time-wait-sync.service is a disabled or a static unit not running, not starting it. 146s Setting up udev (256.5-2ubuntu4) ... 147s Setting up libdpkg-perl (1.22.11ubuntu3) ... 147s Setting up libblockdev-nvme3:armhf (3.2.1-1) ... 147s Setting up libdrm2:armhf (2.4.123-1) ... 147s Setting up whiptail (0.52.24-2ubuntu4) ... 147s Setting up libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) ... 147s Setting up libplymouth5:armhf (24.004.60-1ubuntu11) ... 147s Setting up netplan-generator (1.1.1-1) ... 147s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 147s Setting up libpython3-stdlib:armhf (3.12.7-1) ... 147s Setting up systemd-resolved (256.5-2ubuntu4) ... 148s Setting up openssh-sftp-server (1:9.7p1-7ubuntu5) ... 148s Setting up udisks2 (2.10.1-11ubuntu1) ... 148s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 148s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 148s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 148s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 148s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 148s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 148s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 148s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 148s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 148s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 148s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 148s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 148s loop8: Failed to write 'change' to '/sys/devices/virtual/block/loop8/uevent': Permission denied 148s Setting up systemd-sysv (256.5-2ubuntu4) ... 149s Setting up openssh-server (1:9.7p1-7ubuntu5) ... 150s Setting up plymouth (24.004.60-1ubuntu11) ... 150s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 150s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 151s Setting up libfwupd2:armhf (1.9.26-2) ... 151s Setting up libnss-systemd:armhf (256.5-2ubuntu4) ... 151s Setting up python3 (3.12.7-1) ... 151s Setting up python3-zipp (3.21.0-1) ... 151s Setting up python3-newt:armhf (0.52.24-2ubuntu4) ... 152s Setting up dpkg-dev (1.22.11ubuntu3) ... 152s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) ... 152s update-initramfs: deferring update (trigger activated) 152s Setting up python3-oauthlib (3.2.2-2) ... 152s Setting up python3-configobj (5.0.9-1) ... 152s Setting up python3-certifi (2024.8.30+dfsg-1) ... 152s Setting up python3-gi (3.50.0-3) ... 153s Setting up python3-idna (3.8-2) ... 153s Setting up python3-urllib3 (2.0.7-2ubuntu0.1) ... 153s Setting up python3-json-pointer (2.4-2) ... 153s Setting up libpam-systemd:armhf (256.5-2ubuntu4) ... 154s Setting up fwupd (1.9.26-2) ... 154s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 154s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 155s fwupd.service is a disabled or a static unit not running, not starting it. 155s Setting up python3-cffi-backend:armhf (1.17.1-2) ... 155s Setting up python3-more-itertools (10.5.0-1) ... 155s Setting up python3-jaraco.functools (4.1.0-1) ... 155s Setting up python3-gdbm:armhf (3.12.7-1) ... 155s Setting up python3-problem-report (2.30.0-0ubuntu5) ... 155s Setting up ssh-import-id (5.11-0ubuntu3) ... 155s Setting up python3-jsonpatch (1.32-4) ... 156s Setting up python3-typeguard (4.4.1-1) ... 156s Setting up ufw (0.36.2-8) ... 157s Setting up python3-apport (2.30.0-0ubuntu5) ... 158s Setting up python3-jaraco.text (4.0.0-1) ... 158s Setting up python3-netplan (1.1.1-1) ... 158s Setting up python3-pkg-resources (75.2.0-1) ... 158s Setting up python3-setuptools (75.2.0-1) ... 160s Setting up python3-lazr.uri (1.0.6-4) ... 160s Setting up netplan.io (1.1.1-1) ... 160s Setting up python3-wadllib (2.0.0-1) ... 160s Setting up python3-lazr.restfulclient (0.14.6-2) ... 161s Setting up apport-core-dump-handler (2.30.0-0ubuntu5) ... 163s Setting up apport (2.30.0-0ubuntu5) ... 163s Installing new version of config file /etc/apport/crashdb.conf ... 163s apport-autoreport.service is a disabled or a static unit not running, not starting it. 163s Processing triggers for dbus (1.14.10-4ubuntu5) ... 163s Processing triggers for shared-mime-info (2.4-5) ... 164s Processing triggers for install-info (7.1.1-1) ... 164s Processing triggers for initramfs-tools (0.142ubuntu34) ... 164s Processing triggers for libc-bin (2.40-1ubuntu3) ... 164s Processing triggers for rsyslog (8.2406.0-1ubuntu2) ... 164s Processing triggers for man-db (2.12.1-3) ... 166s Reading package lists... 167s Building dependency tree... 167s Reading state information... 169s The following packages will be REMOVED: 169s libperl5.38t64* perl-modules-5.38* python3-netifaces* 170s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded. 170s After this operation, 41.7 MB disk space will be freed. 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61516 files and directories currently installed.) 170s Removing libperl5.38t64:armhf (5.38.2-5) ... 170s Removing perl-modules-5.38 (5.38.2-5) ... 170s Removing python3-netifaces:armhf (0.11.0-2build3) ... 170s Processing triggers for man-db (2.12.1-3) ... 170s Processing triggers for libc-bin (2.40-1ubuntu3) ... 172s autopkgtest [22:53:57]: rebooting testbed after setup commands that affected boot 244s autopkgtest [22:55:09]: testbed running kernel: Linux 6.8.0-47-generic #47~22.04.1-Ubuntu SMP PREEMPT_DYNAMIC Wed Oct 2 16:39:14 UTC 2 271s autopkgtest [22:55:36]: @@@@@@@@@@@@@@@@@@@@ apt-source fdroidserver 282s Get:1 http://ftpmaster.internal/ubuntu plucky/universe fdroidserver 2.3~a2-1 (dsc) [2316 B] 282s Get:2 http://ftpmaster.internal/ubuntu plucky/universe fdroidserver 2.3~a2-1 (tar) [5280 kB] 282s Get:3 http://ftpmaster.internal/ubuntu plucky/universe fdroidserver 2.3~a2-1 (asc) [488 B] 282s Get:4 http://ftpmaster.internal/ubuntu plucky/universe fdroidserver 2.3~a2-1 (diff) [22.0 kB] 283s gpgv: Signature made Wed Sep 11 10:47:20 2024 UTC 283s gpgv: using RSA key 972239DBE68699F526C06A053E177817BA1B9BFA 283s gpgv: Can't check signature: No public key 283s dpkg-source: warning: cannot verify inline signature for ./fdroidserver_2.3~a2-1.dsc: no acceptable signature found 283s autopkgtest [22:55:48]: testing package fdroidserver version 2.3~a2-1 285s autopkgtest [22:55:50]: build not needed 288s autopkgtest [22:55:53]: test command1: preparing testbed 299s Reading package lists... 299s Building dependency tree... 299s Reading state information... 300s Starting pkgProblemResolver with broken count: 0 300s Starting 2 pkgProblemResolver with broken count: 0 300s Done 301s The following additional packages will be installed: 301s adwaita-icon-theme androguard android-libart android-libbacktrace 301s android-libbase android-liblog android-libnativebridge 301s android-libnativeloader android-libziparchive apksigner at-spi2-common blt 301s ca-certificates-java dconf-gsettings-backend dconf-service 301s default-jdk-headless default-jre default-jre-headless dexdump fdroidserver 301s fontconfig fontconfig-config fonts-dejavu-core fonts-dejavu-mono fonts-lyx 301s git git-man graphviz gtk-update-icon-cache hicolor-icon-theme 301s humanity-icon-theme java-common libaom3 libapksig-java libasound2-data 301s libasound2t64 libatk-bridge2.0-0t64 libatk1.0-0t64 libatspi2.0-0t64 301s libavahi-client3 libavahi-common-data libavahi-common3 libblas3 301s libcairo-gobject2 libcairo2 libcdt5 libcgraph6 libcolord2 libcups2t64 301s libdatrie1 libdconf1 libde265-0 libdeflate0 libdrm-amdgpu1 libdrm-radeon1 301s libepoxy0 liberror-perl libfontconfig1 libfreetype6 libgbm1 libgd3 301s libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1 301s libgl1-mesa-dri libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 301s libgraphite2-3 libgtk-3-0t64 libgtk-3-common libgts-0.7-5t64 libgvc6 301s libgvpr2 libharfbuzz0b libheif-plugin-aomdec libheif-plugin-libde265 301s libheif1 libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 301s libjs-jquery libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 301s liblerc4 libllvm19 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0 301s libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0 libqhull-r8.0 301s libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 301s libtiff6 libtinyxml2-10 libtk8.6 libvulkan1 libwayland-client0 301s libwayland-cursor0 libwayland-egl1 libwayland-server0 libwebp7 libwebpdemux2 301s libwebpmux3 libx11-xcb1 libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 301s libxcb-present0 libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1 301s libxcb-xfixes0 libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2 301s libxi6 libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1 301s libxslt1.1 libxss1 libxt6t64 libxtst6 libxxf86vm1 mesa-libgallium 301s openjdk-21-jdk-headless openjdk-21-jre openjdk-21-jre-headless 301s python-matplotlib-data python3-appdirs python3-args python3-asn1crypto 301s python3-asttokens python3-bcrypt python3-biplist python3-brotli 301s python3-click python3-clint python3-colorama python3-contourpy 301s python3-cycler python3-dateutil python3-decorator python3-defusedxml 301s python3-executing python3-fonttools python3-fs python3-git python3-gitdb 301s python3-ipython python3-jedi python3-kiwisolver python3-libcloud 301s python3-looseversion python3-lxml python3-lz4 python3-magic 301s python3-matplotlib python3-matplotlib-inline python3-mpmath python3-nacl 301s python3-networkx python3-numpy python3-oscrypto python3-packaging 301s python3-paramiko python3-parso python3-pathspec python3-pexpect python3-pil 301s python3-pil.imagetk python3-platformdirs python3-png python3-prompt-toolkit 301s python3-ptyprocess python3-pure-eval python3-pycountry python3-pydot 301s python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy 301s python3-simplejson python3-six python3-smmap python3-stack-data 301s python3-sympy python3-tk python3-traitlets python3-typeshed python3-tz 301s python3-ufolib2 python3-unicodedata2 python3-wcwidth python3.12-tk 301s python3.13-tk s3cmd sdkmanager tk8.6-blt2.5 ubuntu-mono unicode-data 301s x11-common yamllint 301s Suggested packages: 301s adwaita-icon-theme-legacy blt-demo gradle ipfs-cid vagrant vagrant-cachier 301s vagrant-libvirt qemu-kvm git-daemon-run | git-daemon-sysvinit git-doc 301s git-email git-gui gitk gitweb git-cvs git-mediawiki git-svn gsfonts 301s graphviz-doc alsa-utils libasound2-plugins colord cups-common libgd-tools 301s gvfs libheif-plugin-x265 libheif-plugin-ffmpegdec libheif-plugin-jpegdec 301s libheif-plugin-jpegenc libheif-plugin-j2kdec libheif-plugin-j2kenc 301s libheif-plugin-kvazaar libheif-plugin-rav1e libheif-plugin-svtenc 301s libjs-jquery-ui-docs liblcms2-utils pcscd tcl8.6 tk8.6 openjdk-21-demo 301s openjdk-21-source libnss-mdns fonts-dejavu-extra fonts-ipafont-gothic 301s fonts-ipafont-mincho fonts-wqy-microhei | fonts-wqy-zenhei fonts-indic 301s python-cycler-doc python-git-doc python-ipython-doc python-lxml-doc 301s cm-super-minimal dvipng ffmpeg fonts-staypuft ghostscript gir1.2-gtk-3.0 301s inkscape ipython3 librsvg2-common python-matplotlib-doc python3-cairocffi 301s python3-gi-cairo python3-gobject python3-pyqt5 python3-sip python3-tornado 301s texlive-extra-utils texlive-latex-extra python-mpmath-doc python3-gmpy2 301s python-nacl-doc python3-gdal python3-pygraphviz gcc gfortran 301s python-numpy-doc python3-dev python3-pytest python3-gssapi python3-invoke 301s python-pexpect-doc python-pil-doc python-scipy-doc texlive-fonts-extra 301s python-sympy-doc tix python3-tk-dbg python-traitlets-doc 301s Recommended packages: 301s librsvg2-common python3-pyperclip python3-pyqt5 android-sdk opensc 301s fonts-liberation alsa-ucm-conf alsa-topology-conf at-spi2-core 301s libgdk-pixbuf2.0-bin libgl1-amber-dri libgtk-3-bin libgts-bin 301s libheif-plugin-aomenc javascript-common mesa-vulkan-drivers | vulkan-icd 301s libatk-wrapper-java-jni fonts-dejavu-extra python3-bs4 python3-cssselect 301s python3-html5lib python3-olefile g++ | c++-compiler isympy-common 301s python3-argcomplete 301s The following NEW packages will be installed: 301s adwaita-icon-theme androguard android-libart android-libbacktrace 301s android-libbase android-liblog android-libnativebridge 301s android-libnativeloader android-libziparchive apksigner at-spi2-common 301s autopkgtest-satdep blt ca-certificates-java dconf-gsettings-backend 301s dconf-service default-jdk-headless default-jre default-jre-headless dexdump 301s fdroidserver fontconfig fontconfig-config fonts-dejavu-core 301s fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache 301s hicolor-icon-theme humanity-icon-theme java-common libaom3 libapksig-java 301s libasound2-data libasound2t64 libatk-bridge2.0-0t64 libatk1.0-0t64 301s libatspi2.0-0t64 libavahi-client3 libavahi-common-data libavahi-common3 301s libblas3 libcairo-gobject2 libcairo2 libcdt5 libcgraph6 libcolord2 301s libcups2t64 libdatrie1 libdconf1 libde265-0 libdeflate0 libdrm-amdgpu1 301s libdrm-radeon1 libepoxy0 liberror-perl libfontconfig1 libfreetype6 libgbm1 301s libgd3 libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common libgfortran5 libgif7 301s libgl1 libgl1-mesa-dri libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 301s libgraphite2-3 libgtk-3-0t64 libgtk-3-common libgts-0.7-5t64 libgvc6 301s libgvpr2 libharfbuzz0b libheif-plugin-aomdec libheif-plugin-libde265 301s libheif1 libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 301s libjs-jquery libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 301s liblerc4 libllvm19 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0 301s libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0 libqhull-r8.0 301s libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 301s libtiff6 libtinyxml2-10 libtk8.6 libvulkan1 libwayland-client0 301s libwayland-cursor0 libwayland-egl1 libwayland-server0 libwebp7 libwebpdemux2 301s libwebpmux3 libx11-xcb1 libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 301s libxcb-present0 libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1 301s libxcb-xfixes0 libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2 301s libxi6 libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1 301s libxslt1.1 libxss1 libxt6t64 libxtst6 libxxf86vm1 mesa-libgallium 301s openjdk-21-jdk-headless openjdk-21-jre openjdk-21-jre-headless 301s python-matplotlib-data python3-appdirs python3-args python3-asn1crypto 301s python3-asttokens python3-bcrypt python3-biplist python3-brotli 301s python3-click python3-clint python3-colorama python3-contourpy 301s python3-cycler python3-dateutil python3-decorator python3-defusedxml 301s python3-executing python3-fonttools python3-fs python3-git python3-gitdb 301s python3-ipython python3-jedi python3-kiwisolver python3-libcloud 301s python3-looseversion python3-lxml python3-lz4 python3-magic 301s python3-matplotlib python3-matplotlib-inline python3-mpmath python3-nacl 301s python3-networkx python3-numpy python3-oscrypto python3-packaging 301s python3-paramiko python3-parso python3-pathspec python3-pexpect python3-pil 301s python3-pil.imagetk python3-platformdirs python3-png python3-prompt-toolkit 301s python3-ptyprocess python3-pure-eval python3-pycountry python3-pydot 301s python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy 301s python3-simplejson python3-six python3-smmap python3-stack-data 301s python3-sympy python3-tk python3-traitlets python3-typeshed python3-tz 301s python3-ufolib2 python3-unicodedata2 python3-wcwidth python3.12-tk 301s python3.13-tk s3cmd sdkmanager tk8.6-blt2.5 ubuntu-mono unicode-data 301s x11-common yamllint 301s 0 upgraded, 230 newly installed, 0 to remove and 0 not upgraded. 301s Need to get 288 MB/288 MB of archives. 301s After this operation, 930 MB of additional disk space will be used. 301s Get:1 /tmp/autopkgtest.BGvKMW/1-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [744 B] 301s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf libgdk-pixbuf2.0-common all 2.42.12+dfsg-1 [7888 B] 301s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf libjpeg-turbo8 armhf 2.1.5-2ubuntu2 [125 kB] 301s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf libjpeg8 armhf 8c-2ubuntu11 [2148 B] 301s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libdeflate0 armhf 1.22-1 [38.9 kB] 301s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf libjbig0 armhf 2.1-6.1ubuntu2 [24.9 kB] 301s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf liblerc4 armhf 4.0.0+ds-4ubuntu2 [151 kB] 302s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf libsharpyuv0 armhf 1.4.0-0.1 [16.3 kB] 302s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libwebp7 armhf 1.4.0-0.1 [184 kB] 302s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf libtiff6 armhf 4.5.1+git230720-4ubuntu4 [179 kB] 302s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.12+dfsg-1 [135 kB] 302s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf gtk-update-icon-cache armhf 4.16.5+ds-1 [50.6 kB] 302s Get:13 http://ftpmaster.internal/ubuntu plucky/main armhf hicolor-icon-theme all 0.18-1 [13.5 kB] 302s Get:14 http://ftpmaster.internal/ubuntu plucky/main armhf humanity-icon-theme all 0.6.16 [1282 kB] 302s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf ubuntu-mono all 24.04-0ubuntu1 [151 kB] 302s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf adwaita-icon-theme all 47.0-2 [525 kB] 302s Get:17 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-asn1crypto all 1.5.1-3 [79.7 kB] 302s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf python3-colorama all 0.4.6-4 [32.1 kB] 302s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf python3-click all 8.1.7-2 [79.5 kB] 302s Get:20 http://ftpmaster.internal/ubuntu plucky/main armhf python3-decorator all 5.1.1-5 [10.1 kB] 302s Get:21 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-parso all 0.8.3-1 [67.2 kB] 302s Get:22 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-typeshed all 0.0~git20231111.6764465-3 [1274 kB] 302s Get:23 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-jedi all 0.19.1+ds1-1 [693 kB] 302s Get:24 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-traitlets all 5.14.3+really5.14.3-1 [71.5 kB] 302s Get:25 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-matplotlib-inline all 0.1.6-2 [8784 B] 302s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf python3-ptyprocess all 0.7.0-6 [14.8 kB] 302s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf python3-pexpect all 4.9-2 [48.1 kB] 302s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wcwidth all 0.2.13+dfsg1-1 [26.3 kB] 302s Get:29 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-prompt-toolkit all 3.0.48-1 [256 kB] 302s Get:30 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-asttokens all 2.4.1-2 [20.8 kB] 302s Get:31 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-executing all 2.1.0-0.1 [24.4 kB] 302s Get:32 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pure-eval all 0.2.3-1 [11.4 kB] 302s Get:33 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-stack-data all 0.6.3-1 [22.0 kB] 302s Get:34 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ipython all 8.20.0-1ubuntu1 [561 kB] 302s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf libxslt1.1 armhf 1.1.39-0exp1ubuntu1 [150 kB] 302s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lxml armhf 5.3.0-1 [1234 kB] 302s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf python3-magic all 2:0.4.27-3 [13.4 kB] 302s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [328 kB] 302s Get:39 http://ftpmaster.internal/ubuntu plucky/universe armhf libjs-jquery-ui all 1.13.2+dfsg-1 [252 kB] 302s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf fonts-dejavu-mono all 2.37-8 [502 kB] 302s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf fonts-dejavu-core all 2.37-8 [835 kB] 302s Get:42 http://ftpmaster.internal/ubuntu plucky/universe armhf fonts-lyx all 2.4.2.1-1 [171 kB] 302s Get:43 http://ftpmaster.internal/ubuntu plucky/universe armhf python-matplotlib-data all 3.8.3-3 [2928 kB] 302s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf python3-six all 1.16.0-7 [13.1 kB] 302s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf python3-dateutil all 2.9.0-2 [80.3 kB] 302s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf libfreetype6 armhf 2.13.3+dfsg-1 [330 kB] 302s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf libgomp1 armhf 14.2.0-8ubuntu1 [125 kB] 302s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf libimagequant0 armhf 2.18.0-1build1 [31.1 kB] 302s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf liblcms2-2 armhf 2.16-2 [137 kB] 302s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf libopenjp2-7 armhf 2.5.0-2ubuntu1 [170 kB] 302s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf libgraphite2-3 armhf 1.3.14-2ubuntu1 [64.8 kB] 302s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf libharfbuzz0b armhf 10.0.1-1 [463 kB] 302s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libraqm0 armhf 0.10.1-1build1 [12.4 kB] 302s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libwebpdemux2 armhf 1.4.0-0.1 [11.8 kB] 302s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf libwebpmux3 armhf 1.4.0-0.1 [22.5 kB] 302s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf python3-pil armhf 10.4.0-1ubuntu1 [428 kB] 302s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libtcl8.6 armhf 8.6.15+dfsg-2 [909 kB] 302s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf fontconfig-config armhf 2.15.0-1.1ubuntu2 [37.4 kB] 302s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf libfontconfig1 armhf 2.15.0-1.1ubuntu2 [113 kB] 302s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf libxrender1 armhf 1:0.9.10-1.1build1 [16.0 kB] 302s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf libxft2 armhf 2.3.6-1build1 [37.4 kB] 302s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf x11-common all 1:7.7+23ubuntu3 [21.7 kB] 302s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libxss1 armhf 1:1.2.3-1build3 [6500 B] 302s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf libtk8.6 armhf 8.6.15-1 [685 kB] 302s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-tk armhf 3.12.7-3 [112 kB] 302s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-tk armhf 3.13.0-2 [103 kB] 302s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf tk8.6-blt2.5 armhf 2.5.3+dfsg-7build1 [525 kB] 302s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf blt armhf 2.5.3+dfsg-7build1 [4840 B] 302s Get:69 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-tk armhf 3.12.7-1 [9752 B] 302s Get:70 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pil.imagetk armhf 10.4.0-1ubuntu1 [8848 B] 302s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf libblas3 armhf 3.12.0-3build2 [126 kB] 302s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf libgfortran5 armhf 14.2.0-8ubuntu1 [311 kB] 303s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf liblapack3 armhf 3.12.0-3build2 [2086 kB] 303s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf python3-numpy armhf 1:1.26.4+ds-11build1 [3570 kB] 303s Get:75 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-contourpy armhf 1.3.0-2 [192 kB] 303s Get:76 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-cycler all 0.12.1-1 [9716 B] 303s Get:77 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-brotli armhf 1.1.0-2build2 [321 kB] 303s Get:78 http://ftpmaster.internal/ubuntu plucky/universe armhf liblbfgsb0 armhf 3.0+dfsg.4-1build1 [27.4 kB] 303s Get:79 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-scipy armhf 1.13.1-5 [16.4 MB] 303s Get:80 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ufolib2 all 0.16.1+dfsg1-1 [33.4 kB] 303s Get:81 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-mpmath all 1.3.0-1 [425 kB] 303s Get:82 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-sympy all 1.13.3-1 [4228 kB] 304s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf python3-tz all 2024.1-2 [31.4 kB] 304s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf python3-appdirs all 1.4.4-4 [10.9 kB] 304s Get:85 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-fs all 2.4.16-4 [91.3 kB] 304s Get:86 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-lz4 armhf 4.0.2+dfsg-1build4 [24.8 kB] 304s Get:87 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-unicodedata2 armhf 15.1.0+ds-1build1 [361 kB] 304s Get:88 http://ftpmaster.internal/ubuntu plucky/universe armhf unicode-data all 15.1.0-1 [8878 kB] 304s Get:89 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-fonttools armhf 4.46.0-1build2 [1402 kB] 304s Get:90 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-kiwisolver armhf 1.4.7-2 [57.0 kB] 304s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf python3-packaging all 24.1-1 [41.4 kB] 304s Get:92 http://ftpmaster.internal/ubuntu plucky/universe armhf libqhull-r8.0 armhf 2020.2-6build1 [173 kB] 304s Get:93 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-matplotlib armhf 3.8.3-3 [4500 kB] 304s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf python3-networkx all 3.2.1-4ubuntu1 [11.5 MB] 304s Get:95 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-oscrypto all 1.3.0-7 [128 kB] 304s Get:96 http://ftpmaster.internal/ubuntu plucky/universe armhf libcdt5 armhf 2.42.4-2build3 [19.4 kB] 304s Get:97 http://ftpmaster.internal/ubuntu plucky/universe armhf libcgraph6 armhf 2.42.4-2build3 [37.6 kB] 304s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf libaom3 armhf 3.11.0~rc1-1 [1762 kB] 304s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libheif-plugin-aomdec armhf 1.18.1-2 [10.6 kB] 304s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libde265-0 armhf 1.0.15-1build4 [157 kB] 304s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libheif-plugin-libde265 armhf 1.18.1-2 [11.1 kB] 304s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libheif1 armhf 1.18.1-2 [288 kB] 305s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libxpm4 armhf 1:3.5.17-1build2 [30.1 kB] 305s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf libgd3 armhf 2.3.3-12ubuntu3 [108 kB] 305s Get:105 http://ftpmaster.internal/ubuntu plucky/universe armhf libgts-0.7-5t64 armhf 0.7.6+darcs121130-5.2build1 [139 kB] 305s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf libpixman-1-0 armhf 0.44.0-3 [183 kB] 305s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-render0 armhf 1.17.0-2 [15.3 kB] 305s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-shm0 armhf 1.17.0-2 [5774 B] 305s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf libcairo2 armhf 1.18.2-2 [484 kB] 305s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libltdl7 armhf 2.4.7-7build1 [37.6 kB] 305s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf fontconfig armhf 2.15.0-1.1ubuntu2 [189 kB] 305s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf libthai-data all 0.1.29-2build1 [158 kB] 305s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf libdatrie1 armhf 0.2.13-3build1 [15.7 kB] 305s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libthai0 armhf 0.1.29-2build1 [15.2 kB] 305s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf libpango-1.0-0 armhf 1.54.0+ds-3 [212 kB] 305s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libpangoft2-1.0-0 armhf 1.54.0+ds-3 [42.9 kB] 305s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libpangocairo-1.0-0 armhf 1.54.0+ds-3 [24.8 kB] 305s Get:118 http://ftpmaster.internal/ubuntu plucky/universe armhf libpathplan4 armhf 2.42.4-2build3 [21.7 kB] 305s Get:119 http://ftpmaster.internal/ubuntu plucky/universe armhf libgvc6 armhf 2.42.4-2build3 [621 kB] 305s Get:120 http://ftpmaster.internal/ubuntu plucky/universe armhf libgvpr2 armhf 2.42.4-2build3 [161 kB] 305s Get:121 http://ftpmaster.internal/ubuntu plucky/universe armhf liblab-gamut1 armhf 2.42.4-2build3 [1833 kB] 305s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf libice6 armhf 2:1.1.1-1 [36.5 kB] 305s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf libsm6 armhf 2:1.2.4-1 [15.1 kB] 305s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf libxt6t64 armhf 1:1.2.1-1.2build1 [145 kB] 305s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf libxmu6 armhf 2:1.1.3-3build2 [40.4 kB] 305s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf libxaw7 armhf 2:1.0.16-1 [154 kB] 305s Get:127 http://ftpmaster.internal/ubuntu plucky/universe armhf graphviz armhf 2.42.4-2build3 [540 kB] 305s Get:128 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pydot all 2.0.0-3 [24.9 kB] 305s Get:129 http://ftpmaster.internal/ubuntu plucky/universe armhf androguard all 3.4.0~a1-15 [36.7 MB] 307s Get:130 http://ftpmaster.internal/ubuntu plucky/universe armhf android-libart armhf 14.0.0+r15-1ubuntu2 [2428 kB] 307s Get:131 http://ftpmaster.internal/ubuntu plucky/universe armhf android-liblog armhf 1:34.0.4-1.1 [34.3 kB] 307s Get:132 http://ftpmaster.internal/ubuntu plucky/universe armhf android-libbase armhf 1:34.0.4-1.1 [90.1 kB] 307s Get:133 http://ftpmaster.internal/ubuntu plucky/universe armhf android-libbacktrace armhf 1:34.0.4-1.1 [218 kB] 307s Get:134 http://ftpmaster.internal/ubuntu plucky/universe armhf android-libnativebridge armhf 1:14.0.0+r15-1ubuntu2 [15.0 kB] 307s Get:135 http://ftpmaster.internal/ubuntu plucky/universe armhf android-libnativeloader armhf 1:14.0.0+r15-1ubuntu2 [6008 B] 307s Get:136 http://ftpmaster.internal/ubuntu plucky/universe armhf android-libziparchive armhf 1:34.0.4-1.1 [40.7 kB] 307s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf ca-certificates-java all 20240118 [11.6 kB] 307s Get:138 http://ftpmaster.internal/ubuntu plucky/main armhf java-common all 0.76 [6852 B] 307s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf libpcsclite1 armhf 2.3.0-1 [24.8 kB] 307s Get:140 http://ftpmaster.internal/ubuntu plucky/main armhf openjdk-21-jre-headless armhf 21.0.5+11-1 [39.7 MB] 308s Get:141 http://ftpmaster.internal/ubuntu plucky/main armhf default-jre-headless armhf 2:1.21-76 [3182 B] 308s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf at-spi2-common all 2.54.0-1 [8774 B] 308s Get:143 http://ftpmaster.internal/ubuntu plucky/main armhf libatk1.0-0t64 armhf 2.54.0-1 [48.0 kB] 308s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf libxi6 armhf 2:1.8.2-1 [26.5 kB] 308s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf libatspi2.0-0t64 armhf 2.54.0-1 [70.8 kB] 308s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf libatk-bridge2.0-0t64 armhf 2.54.0-1 [59.6 kB] 308s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf libcairo-gobject2 armhf 1.18.2-2 [126 kB] 308s Get:148 http://ftpmaster.internal/ubuntu plucky/main armhf libcolord2 armhf 1.4.7-1build2 [133 kB] 308s Get:149 http://ftpmaster.internal/ubuntu plucky/main armhf libavahi-common-data armhf 0.8-13ubuntu6 [29.7 kB] 308s Get:150 http://ftpmaster.internal/ubuntu plucky/main armhf libavahi-common3 armhf 0.8-13ubuntu6 [20.2 kB] 309s Get:151 http://ftpmaster.internal/ubuntu plucky/main armhf libavahi-client3 armhf 0.8-13ubuntu6 [24.2 kB] 309s Get:152 http://ftpmaster.internal/ubuntu plucky/main armhf libcups2t64 armhf 2.4.10-1ubuntu2 [239 kB] 309s Get:153 http://ftpmaster.internal/ubuntu plucky/main armhf libepoxy0 armhf 1.5.10-2 [192 kB] 309s Get:154 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-client0 armhf 1.23.0-1 [22.7 kB] 309s Get:155 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-cursor0 armhf 1.23.0-1 [9672 B] 309s Get:156 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-egl1 armhf 1.23.0-1 [5352 B] 309s Get:157 http://ftpmaster.internal/ubuntu plucky/main armhf libxcomposite1 armhf 1:0.4.6-1 [6060 B] 309s Get:158 http://ftpmaster.internal/ubuntu plucky/main armhf libxfixes3 armhf 1:6.0.0-2build1 [9038 B] 309s Get:159 http://ftpmaster.internal/ubuntu plucky/main armhf libxcursor1 armhf 1:1.2.2-1 [17.6 kB] 309s Get:160 http://ftpmaster.internal/ubuntu plucky/main armhf libxdamage1 armhf 1:1.1.6-1build1 [5462 B] 309s Get:161 http://ftpmaster.internal/ubuntu plucky/main armhf libxinerama1 armhf 2:1.1.4-3build1 [5866 B] 309s Get:162 http://ftpmaster.internal/ubuntu plucky/main armhf libxrandr2 armhf 2:1.5.4-1 [15.8 kB] 309s Get:163 http://ftpmaster.internal/ubuntu plucky/main armhf libdconf1 armhf 0.40.0-4build2 [38.4 kB] 309s Get:164 http://ftpmaster.internal/ubuntu plucky/main armhf dconf-service armhf 0.40.0-4build2 [27.4 kB] 309s Get:165 http://ftpmaster.internal/ubuntu plucky/main armhf dconf-gsettings-backend armhf 0.40.0-4build2 [23.6 kB] 309s Get:166 http://ftpmaster.internal/ubuntu plucky/main armhf libgtk-3-common all 3.24.43-3ubuntu2 [1202 kB] 309s Get:167 http://ftpmaster.internal/ubuntu plucky/main armhf libgtk-3-0t64 armhf 3.24.43-3ubuntu2 [2608 kB] 309s Get:168 http://ftpmaster.internal/ubuntu plucky/main armhf libglvnd0 armhf 1.7.0-1build1 [83.7 kB] 309s Get:169 http://ftpmaster.internal/ubuntu plucky/main armhf libglapi-mesa armhf 24.2.3-1ubuntu1 [49.4 kB] 309s Get:170 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-xcb1 armhf 2:1.8.10-2 [7902 B] 309s Get:171 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-dri2-0 armhf 1.17.0-2 [6868 B] 309s Get:172 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-dri3-0 armhf 1.17.0-2 [7120 B] 309s Get:173 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-glx0 armhf 1.17.0-2 [22.6 kB] 309s Get:174 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-present0 armhf 1.17.0-2 [5940 B] 309s Get:175 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-randr0 armhf 1.17.0-2 [17.0 kB] 309s Get:176 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-sync1 armhf 1.17.0-2 [8732 B] 309s Get:177 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-xfixes0 armhf 1.17.0-2 [10.0 kB] 309s Get:178 http://ftpmaster.internal/ubuntu plucky/main armhf libxshmfence1 armhf 1.3-1build5 [4464 B] 309s Get:179 http://ftpmaster.internal/ubuntu plucky/main armhf libxxf86vm1 armhf 1:1.1.4-1build4 [8068 B] 309s Get:180 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-amdgpu1 armhf 2.4.123-1 [18.9 kB] 309s Get:181 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-radeon1 armhf 2.4.123-1 [18.1 kB] 309s Get:182 http://ftpmaster.internal/ubuntu plucky/main armhf libllvm19 armhf 1:19.1.2-1ubuntu1 [27.8 MB] 310s Get:183 http://ftpmaster.internal/ubuntu plucky/main armhf mesa-libgallium armhf 24.2.3-1ubuntu1 [7895 kB] 310s Get:184 http://ftpmaster.internal/ubuntu plucky/main armhf libvulkan1 armhf 1.3.296.0-1 [114 kB] 310s Get:185 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-server0 armhf 1.23.0-1 [29.4 kB] 310s Get:186 http://ftpmaster.internal/ubuntu plucky/main armhf libgbm1 armhf 24.2.3-1ubuntu1 [28.2 kB] 310s Get:187 http://ftpmaster.internal/ubuntu plucky/main armhf libgl1-mesa-dri armhf 24.2.3-1ubuntu1 [30.8 kB] 310s Get:188 http://ftpmaster.internal/ubuntu plucky/main armhf libglx-mesa0 armhf 24.2.3-1ubuntu1 [131 kB] 310s Get:189 http://ftpmaster.internal/ubuntu plucky/main armhf libglx0 armhf 1.7.0-1build1 [39.3 kB] 310s Get:190 http://ftpmaster.internal/ubuntu plucky/main armhf libgl1 armhf 1.7.0-1build1 [105 kB] 310s Get:191 http://ftpmaster.internal/ubuntu plucky/main armhf libasound2-data all 1.2.12-1 [21.0 kB] 310s Get:192 http://ftpmaster.internal/ubuntu plucky/main armhf libasound2t64 armhf 1.2.12-1 [344 kB] 310s Get:193 http://ftpmaster.internal/ubuntu plucky/main armhf libgif7 armhf 5.2.2-1ubuntu1 [32.6 kB] 310s Get:194 http://ftpmaster.internal/ubuntu plucky/main armhf libxtst6 armhf 2:1.2.3-1.1build1 [10.7 kB] 310s Get:195 http://ftpmaster.internal/ubuntu plucky/main armhf openjdk-21-jre armhf 21.0.5+11-1 [197 kB] 310s Get:196 http://ftpmaster.internal/ubuntu plucky/main armhf default-jre armhf 2:1.21-76 [918 B] 310s Get:197 http://ftpmaster.internal/ubuntu plucky/universe armhf libapksig-java all 31.0.2-2 [406 kB] 310s Get:198 http://ftpmaster.internal/ubuntu plucky/universe armhf apksigner all 31.0.2-2 [444 kB] 310s Get:199 http://ftpmaster.internal/ubuntu plucky/main armhf openjdk-21-jdk-headless armhf 21.0.5+11-1 [78.2 MB] 313s Get:200 http://ftpmaster.internal/ubuntu plucky/main armhf default-jdk-headless armhf 2:1.21-76 [966 B] 313s Get:201 http://ftpmaster.internal/ubuntu plucky/universe armhf libtinyxml2-10 armhf 10.0.0+dfsg-2 [26.9 kB] 313s Get:202 http://ftpmaster.internal/ubuntu plucky/universe armhf dexdump armhf 14.0.0+r15-1ubuntu2 [39.4 kB] 314s Get:203 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-args all 0.1.0-5 [6082 B] 314s Get:204 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-clint all 0.5.1-4 [27.8 kB] 314s Get:205 http://ftpmaster.internal/ubuntu plucky/main armhf python3-defusedxml all 0.7.1-2 [42.0 kB] 314s Get:206 http://ftpmaster.internal/ubuntu plucky/main armhf liberror-perl all 0.17029-2 [25.6 kB] 314s Get:207 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf git-man all 1:2.45.2-1.2ubuntu1 [1122 kB] 314s Get:208 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf git armhf 1:2.45.2-1.2ubuntu1 [4509 kB] 314s Get:209 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-smmap all 6.0.0-1 [20.5 kB] 314s Get:210 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-gitdb all 4.0.11-1 [46.2 kB] 314s Get:211 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-git all 3.1.37-3 [138 kB] 314s Get:212 http://ftpmaster.internal/ubuntu plucky/main armhf python3-bcrypt armhf 4.2.0-1 [218 kB] 314s Get:213 http://ftpmaster.internal/ubuntu plucky/main armhf libsodium23 armhf 1.0.18-1build3 [139 kB] 314s Get:214 http://ftpmaster.internal/ubuntu plucky/main armhf python3-nacl armhf 1.5.0-6 [54.1 kB] 314s Get:215 http://ftpmaster.internal/ubuntu plucky/main armhf python3-paramiko all 3.4.0-1ubuntu2 [145 kB] 314s Get:216 http://ftpmaster.internal/ubuntu plucky/main armhf python3-platformdirs all 4.3.6-1 [16.8 kB] 314s Get:217 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-png all 0.20231004.0-4 [30.3 kB] 314s Get:218 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-qrcode all 7.4.2-5 [40.2 kB] 314s Get:219 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ruamel.yaml.clib armhf 0.2.8+ds-2 [125 kB] 314s Get:220 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ruamel.yaml all 0.18.6+ds-3 [126 kB] 314s Get:221 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-looseversion all 1.3.0-3 [8354 B] 314s Get:222 http://ftpmaster.internal/ubuntu plucky/universe armhf sdkmanager all 0.6.10-1 [34.3 kB] 314s Get:223 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pathspec all 0.12.1-1 [24.5 kB] 314s Get:224 http://ftpmaster.internal/ubuntu plucky/universe armhf yamllint all 1.35.1-2 [43.6 kB] 314s Get:225 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-biplist all 1.0.3-5 [11.3 kB] 314s Get:226 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pycountry all 24.6.1+ds1-1 [30.0 kB] 314s Get:227 http://ftpmaster.internal/ubuntu plucky/universe armhf s3cmd all 2.4.0-2 [128 kB] 314s Get:228 http://ftpmaster.internal/ubuntu plucky/universe armhf fdroidserver all 2.3~a2-1 [439 kB] 314s Get:229 http://ftpmaster.internal/ubuntu plucky/main armhf python3-simplejson armhf 3.19.3-1 [52.2 kB] 314s Get:230 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-libcloud all 3.8.0+repack-3 [828 kB] 315s Fetched 288 MB in 13s (21.5 MB/s) 315s Selecting previously unselected package libgdk-pixbuf2.0-common. 316s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59576 files and directories currently installed.) 316s Preparing to unpack .../000-libgdk-pixbuf2.0-common_2.42.12+dfsg-1_all.deb ... 316s Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... 316s Selecting previously unselected package libjpeg-turbo8:armhf. 316s Preparing to unpack .../001-libjpeg-turbo8_2.1.5-2ubuntu2_armhf.deb ... 316s Unpacking libjpeg-turbo8:armhf (2.1.5-2ubuntu2) ... 316s Selecting previously unselected package libjpeg8:armhf. 316s Preparing to unpack .../002-libjpeg8_8c-2ubuntu11_armhf.deb ... 316s Unpacking libjpeg8:armhf (8c-2ubuntu11) ... 316s Selecting previously unselected package libdeflate0:armhf. 316s Preparing to unpack .../003-libdeflate0_1.22-1_armhf.deb ... 316s Unpacking libdeflate0:armhf (1.22-1) ... 316s Selecting previously unselected package libjbig0:armhf. 316s Preparing to unpack .../004-libjbig0_2.1-6.1ubuntu2_armhf.deb ... 316s Unpacking libjbig0:armhf (2.1-6.1ubuntu2) ... 316s Selecting previously unselected package liblerc4:armhf. 316s Preparing to unpack .../005-liblerc4_4.0.0+ds-4ubuntu2_armhf.deb ... 316s Unpacking liblerc4:armhf (4.0.0+ds-4ubuntu2) ... 316s Selecting previously unselected package libsharpyuv0:armhf. 316s Preparing to unpack .../006-libsharpyuv0_1.4.0-0.1_armhf.deb ... 316s Unpacking libsharpyuv0:armhf (1.4.0-0.1) ... 316s Selecting previously unselected package libwebp7:armhf. 316s Preparing to unpack .../007-libwebp7_1.4.0-0.1_armhf.deb ... 316s Unpacking libwebp7:armhf (1.4.0-0.1) ... 316s Selecting previously unselected package libtiff6:armhf. 316s Preparing to unpack .../008-libtiff6_4.5.1+git230720-4ubuntu4_armhf.deb ... 316s Unpacking libtiff6:armhf (4.5.1+git230720-4ubuntu4) ... 316s Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. 316s Preparing to unpack .../009-libgdk-pixbuf-2.0-0_2.42.12+dfsg-1_armhf.deb ... 316s Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1) ... 316s Selecting previously unselected package gtk-update-icon-cache. 316s Preparing to unpack .../010-gtk-update-icon-cache_4.16.5+ds-1_armhf.deb ... 316s No diversion 'diversion of /usr/sbin/update-icon-caches to /usr/sbin/update-icon-caches.gtk2 by libgtk-3-bin', none removed. 316s No diversion 'diversion of /usr/share/man/man8/update-icon-caches.8.gz to /usr/share/man/man8/update-icon-caches.gtk2.8.gz by libgtk-3-bin', none removed. 316s Unpacking gtk-update-icon-cache (4.16.5+ds-1) ... 316s Selecting previously unselected package hicolor-icon-theme. 316s Preparing to unpack .../011-hicolor-icon-theme_0.18-1_all.deb ... 316s Unpacking hicolor-icon-theme (0.18-1) ... 316s Selecting previously unselected package humanity-icon-theme. 316s Preparing to unpack .../012-humanity-icon-theme_0.6.16_all.deb ... 316s Unpacking humanity-icon-theme (0.6.16) ... 317s Selecting previously unselected package ubuntu-mono. 317s Preparing to unpack .../013-ubuntu-mono_24.04-0ubuntu1_all.deb ... 317s Unpacking ubuntu-mono (24.04-0ubuntu1) ... 318s Selecting previously unselected package adwaita-icon-theme. 318s Preparing to unpack .../014-adwaita-icon-theme_47.0-2_all.deb ... 318s Unpacking adwaita-icon-theme (47.0-2) ... 318s Selecting previously unselected package python3-asn1crypto. 318s Preparing to unpack .../015-python3-asn1crypto_1.5.1-3_all.deb ... 318s Unpacking python3-asn1crypto (1.5.1-3) ... 318s Selecting previously unselected package python3-colorama. 318s Preparing to unpack .../016-python3-colorama_0.4.6-4_all.deb ... 318s Unpacking python3-colorama (0.4.6-4) ... 318s Selecting previously unselected package python3-click. 318s Preparing to unpack .../017-python3-click_8.1.7-2_all.deb ... 318s Unpacking python3-click (8.1.7-2) ... 318s Selecting previously unselected package python3-decorator. 318s Preparing to unpack .../018-python3-decorator_5.1.1-5_all.deb ... 318s Unpacking python3-decorator (5.1.1-5) ... 318s Selecting previously unselected package python3-parso. 318s Preparing to unpack .../019-python3-parso_0.8.3-1_all.deb ... 318s Unpacking python3-parso (0.8.3-1) ... 318s Selecting previously unselected package python3-typeshed. 318s Preparing to unpack .../020-python3-typeshed_0.0~git20231111.6764465-3_all.deb ... 318s Unpacking python3-typeshed (0.0~git20231111.6764465-3) ... 319s Selecting previously unselected package python3-jedi. 319s Preparing to unpack .../021-python3-jedi_0.19.1+ds1-1_all.deb ... 319s Unpacking python3-jedi (0.19.1+ds1-1) ... 320s Selecting previously unselected package python3-traitlets. 320s Preparing to unpack .../022-python3-traitlets_5.14.3+really5.14.3-1_all.deb ... 320s Unpacking python3-traitlets (5.14.3+really5.14.3-1) ... 320s Selecting previously unselected package python3-matplotlib-inline. 320s Preparing to unpack .../023-python3-matplotlib-inline_0.1.6-2_all.deb ... 320s Unpacking python3-matplotlib-inline (0.1.6-2) ... 320s Selecting previously unselected package python3-ptyprocess. 320s Preparing to unpack .../024-python3-ptyprocess_0.7.0-6_all.deb ... 320s Unpacking python3-ptyprocess (0.7.0-6) ... 320s Selecting previously unselected package python3-pexpect. 320s Preparing to unpack .../025-python3-pexpect_4.9-2_all.deb ... 320s Unpacking python3-pexpect (4.9-2) ... 320s Selecting previously unselected package python3-wcwidth. 320s Preparing to unpack .../026-python3-wcwidth_0.2.13+dfsg1-1_all.deb ... 320s Unpacking python3-wcwidth (0.2.13+dfsg1-1) ... 320s Selecting previously unselected package python3-prompt-toolkit. 320s Preparing to unpack .../027-python3-prompt-toolkit_3.0.48-1_all.deb ... 320s Unpacking python3-prompt-toolkit (3.0.48-1) ... 320s Selecting previously unselected package python3-asttokens. 320s Preparing to unpack .../028-python3-asttokens_2.4.1-2_all.deb ... 320s Unpacking python3-asttokens (2.4.1-2) ... 320s Selecting previously unselected package python3-executing. 320s Preparing to unpack .../029-python3-executing_2.1.0-0.1_all.deb ... 320s Unpacking python3-executing (2.1.0-0.1) ... 320s Selecting previously unselected package python3-pure-eval. 320s Preparing to unpack .../030-python3-pure-eval_0.2.3-1_all.deb ... 320s Unpacking python3-pure-eval (0.2.3-1) ... 320s Selecting previously unselected package python3-stack-data. 320s Preparing to unpack .../031-python3-stack-data_0.6.3-1_all.deb ... 320s Unpacking python3-stack-data (0.6.3-1) ... 320s Selecting previously unselected package python3-ipython. 320s Preparing to unpack .../032-python3-ipython_8.20.0-1ubuntu1_all.deb ... 320s Unpacking python3-ipython (8.20.0-1ubuntu1) ... 321s Selecting previously unselected package libxslt1.1:armhf. 321s Preparing to unpack .../033-libxslt1.1_1.1.39-0exp1ubuntu1_armhf.deb ... 321s Unpacking libxslt1.1:armhf (1.1.39-0exp1ubuntu1) ... 321s Selecting previously unselected package python3-lxml:armhf. 321s Preparing to unpack .../034-python3-lxml_5.3.0-1_armhf.deb ... 321s Unpacking python3-lxml:armhf (5.3.0-1) ... 321s Selecting previously unselected package python3-magic. 321s Preparing to unpack .../035-python3-magic_2%3a0.4.27-3_all.deb ... 321s Unpacking python3-magic (2:0.4.27-3) ... 321s Selecting previously unselected package libjs-jquery. 321s Preparing to unpack .../036-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... 321s Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 321s Selecting previously unselected package libjs-jquery-ui. 321s Preparing to unpack .../037-libjs-jquery-ui_1.13.2+dfsg-1_all.deb ... 321s Unpacking libjs-jquery-ui (1.13.2+dfsg-1) ... 321s Selecting previously unselected package fonts-dejavu-mono. 321s Preparing to unpack .../038-fonts-dejavu-mono_2.37-8_all.deb ... 321s Unpacking fonts-dejavu-mono (2.37-8) ... 321s Selecting previously unselected package fonts-dejavu-core. 321s Preparing to unpack .../039-fonts-dejavu-core_2.37-8_all.deb ... 321s Unpacking fonts-dejavu-core (2.37-8) ... 321s Selecting previously unselected package fonts-lyx. 321s Preparing to unpack .../040-fonts-lyx_2.4.2.1-1_all.deb ... 321s Unpacking fonts-lyx (2.4.2.1-1) ... 321s Selecting previously unselected package python-matplotlib-data. 321s Preparing to unpack .../041-python-matplotlib-data_3.8.3-3_all.deb ... 321s Unpacking python-matplotlib-data (3.8.3-3) ... 321s Selecting previously unselected package python3-six. 321s Preparing to unpack .../042-python3-six_1.16.0-7_all.deb ... 321s Unpacking python3-six (1.16.0-7) ... 321s Selecting previously unselected package python3-dateutil. 321s Preparing to unpack .../043-python3-dateutil_2.9.0-2_all.deb ... 321s Unpacking python3-dateutil (2.9.0-2) ... 321s Selecting previously unselected package libfreetype6:armhf. 321s Preparing to unpack .../044-libfreetype6_2.13.3+dfsg-1_armhf.deb ... 321s Unpacking libfreetype6:armhf (2.13.3+dfsg-1) ... 321s Selecting previously unselected package libgomp1:armhf. 322s Preparing to unpack .../045-libgomp1_14.2.0-8ubuntu1_armhf.deb ... 322s Unpacking libgomp1:armhf (14.2.0-8ubuntu1) ... 322s Selecting previously unselected package libimagequant0:armhf. 322s Preparing to unpack .../046-libimagequant0_2.18.0-1build1_armhf.deb ... 322s Unpacking libimagequant0:armhf (2.18.0-1build1) ... 322s Selecting previously unselected package liblcms2-2:armhf. 322s Preparing to unpack .../047-liblcms2-2_2.16-2_armhf.deb ... 322s Unpacking liblcms2-2:armhf (2.16-2) ... 322s Selecting previously unselected package libopenjp2-7:armhf. 322s Preparing to unpack .../048-libopenjp2-7_2.5.0-2ubuntu1_armhf.deb ... 322s Unpacking libopenjp2-7:armhf (2.5.0-2ubuntu1) ... 322s Selecting previously unselected package libgraphite2-3:armhf. 322s Preparing to unpack .../049-libgraphite2-3_1.3.14-2ubuntu1_armhf.deb ... 322s Unpacking libgraphite2-3:armhf (1.3.14-2ubuntu1) ... 322s Selecting previously unselected package libharfbuzz0b:armhf. 322s Preparing to unpack .../050-libharfbuzz0b_10.0.1-1_armhf.deb ... 322s Unpacking libharfbuzz0b:armhf (10.0.1-1) ... 322s Selecting previously unselected package libraqm0:armhf. 322s Preparing to unpack .../051-libraqm0_0.10.1-1build1_armhf.deb ... 322s Unpacking libraqm0:armhf (0.10.1-1build1) ... 322s Selecting previously unselected package libwebpdemux2:armhf. 322s Preparing to unpack .../052-libwebpdemux2_1.4.0-0.1_armhf.deb ... 322s Unpacking libwebpdemux2:armhf (1.4.0-0.1) ... 322s Selecting previously unselected package libwebpmux3:armhf. 322s Preparing to unpack .../053-libwebpmux3_1.4.0-0.1_armhf.deb ... 322s Unpacking libwebpmux3:armhf (1.4.0-0.1) ... 322s Selecting previously unselected package python3-pil:armhf. 322s Preparing to unpack .../054-python3-pil_10.4.0-1ubuntu1_armhf.deb ... 322s Unpacking python3-pil:armhf (10.4.0-1ubuntu1) ... 322s Selecting previously unselected package libtcl8.6:armhf. 322s Preparing to unpack .../055-libtcl8.6_8.6.15+dfsg-2_armhf.deb ... 322s Unpacking libtcl8.6:armhf (8.6.15+dfsg-2) ... 322s Selecting previously unselected package fontconfig-config. 322s Preparing to unpack .../056-fontconfig-config_2.15.0-1.1ubuntu2_armhf.deb ... 323s Unpacking fontconfig-config (2.15.0-1.1ubuntu2) ... 323s Selecting previously unselected package libfontconfig1:armhf. 323s Preparing to unpack .../057-libfontconfig1_2.15.0-1.1ubuntu2_armhf.deb ... 323s Unpacking libfontconfig1:armhf (2.15.0-1.1ubuntu2) ... 323s Selecting previously unselected package libxrender1:armhf. 323s Preparing to unpack .../058-libxrender1_1%3a0.9.10-1.1build1_armhf.deb ... 323s Unpacking libxrender1:armhf (1:0.9.10-1.1build1) ... 323s Selecting previously unselected package libxft2:armhf. 323s Preparing to unpack .../059-libxft2_2.3.6-1build1_armhf.deb ... 323s Unpacking libxft2:armhf (2.3.6-1build1) ... 323s Selecting previously unselected package x11-common. 323s Preparing to unpack .../060-x11-common_1%3a7.7+23ubuntu3_all.deb ... 323s Unpacking x11-common (1:7.7+23ubuntu3) ... 323s Selecting previously unselected package libxss1:armhf. 323s Preparing to unpack .../061-libxss1_1%3a1.2.3-1build3_armhf.deb ... 323s Unpacking libxss1:armhf (1:1.2.3-1build3) ... 323s Selecting previously unselected package libtk8.6:armhf. 323s Preparing to unpack .../062-libtk8.6_8.6.15-1_armhf.deb ... 323s Unpacking libtk8.6:armhf (8.6.15-1) ... 323s Selecting previously unselected package python3.12-tk. 323s Preparing to unpack .../063-python3.12-tk_3.12.7-3_armhf.deb ... 323s Unpacking python3.12-tk (3.12.7-3) ... 323s Selecting previously unselected package python3.13-tk. 323s Preparing to unpack .../064-python3.13-tk_3.13.0-2_armhf.deb ... 323s Unpacking python3.13-tk (3.13.0-2) ... 323s Selecting previously unselected package tk8.6-blt2.5. 323s Preparing to unpack .../065-tk8.6-blt2.5_2.5.3+dfsg-7build1_armhf.deb ... 323s Unpacking tk8.6-blt2.5 (2.5.3+dfsg-7build1) ... 323s Selecting previously unselected package blt. 323s Preparing to unpack .../066-blt_2.5.3+dfsg-7build1_armhf.deb ... 323s Unpacking blt (2.5.3+dfsg-7build1) ... 323s Selecting previously unselected package python3-tk:armhf. 323s Preparing to unpack .../067-python3-tk_3.12.7-1_armhf.deb ... 323s Unpacking python3-tk:armhf (3.12.7-1) ... 323s Selecting previously unselected package python3-pil.imagetk:armhf. 323s Preparing to unpack .../068-python3-pil.imagetk_10.4.0-1ubuntu1_armhf.deb ... 323s Unpacking python3-pil.imagetk:armhf (10.4.0-1ubuntu1) ... 323s Selecting previously unselected package libblas3:armhf. 323s Preparing to unpack .../069-libblas3_3.12.0-3build2_armhf.deb ... 323s Unpacking libblas3:armhf (3.12.0-3build2) ... 323s Selecting previously unselected package libgfortran5:armhf. 323s Preparing to unpack .../070-libgfortran5_14.2.0-8ubuntu1_armhf.deb ... 323s Unpacking libgfortran5:armhf (14.2.0-8ubuntu1) ... 323s Selecting previously unselected package liblapack3:armhf. 323s Preparing to unpack .../071-liblapack3_3.12.0-3build2_armhf.deb ... 323s Unpacking liblapack3:armhf (3.12.0-3build2) ... 323s Selecting previously unselected package python3-numpy. 324s Preparing to unpack .../072-python3-numpy_1%3a1.26.4+ds-11build1_armhf.deb ... 324s Unpacking python3-numpy (1:1.26.4+ds-11build1) ... 324s Selecting previously unselected package python3-contourpy. 324s Preparing to unpack .../073-python3-contourpy_1.3.0-2_armhf.deb ... 324s Unpacking python3-contourpy (1.3.0-2) ... 324s Selecting previously unselected package python3-cycler. 324s Preparing to unpack .../074-python3-cycler_0.12.1-1_all.deb ... 324s Unpacking python3-cycler (0.12.1-1) ... 324s Selecting previously unselected package python3-brotli. 324s Preparing to unpack .../075-python3-brotli_1.1.0-2build2_armhf.deb ... 324s Unpacking python3-brotli (1.1.0-2build2) ... 324s Selecting previously unselected package liblbfgsb0:armhf. 324s Preparing to unpack .../076-liblbfgsb0_3.0+dfsg.4-1build1_armhf.deb ... 324s Unpacking liblbfgsb0:armhf (3.0+dfsg.4-1build1) ... 324s Selecting previously unselected package python3-scipy. 324s Preparing to unpack .../077-python3-scipy_1.13.1-5_armhf.deb ... 324s Unpacking python3-scipy (1.13.1-5) ... 325s Selecting previously unselected package python3-ufolib2. 325s Preparing to unpack .../078-python3-ufolib2_0.16.1+dfsg1-1_all.deb ... 325s Unpacking python3-ufolib2 (0.16.1+dfsg1-1) ... 325s Selecting previously unselected package python3-mpmath. 325s Preparing to unpack .../079-python3-mpmath_1.3.0-1_all.deb ... 325s Unpacking python3-mpmath (1.3.0-1) ... 325s Selecting previously unselected package python3-sympy. 325s Preparing to unpack .../080-python3-sympy_1.13.3-1_all.deb ... 325s Unpacking python3-sympy (1.13.3-1) ... 326s Selecting previously unselected package python3-tz. 326s Preparing to unpack .../081-python3-tz_2024.1-2_all.deb ... 326s Unpacking python3-tz (2024.1-2) ... 326s Selecting previously unselected package python3-appdirs. 326s Preparing to unpack .../082-python3-appdirs_1.4.4-4_all.deb ... 326s Unpacking python3-appdirs (1.4.4-4) ... 326s Selecting previously unselected package python3-fs. 326s Preparing to unpack .../083-python3-fs_2.4.16-4_all.deb ... 326s Unpacking python3-fs (2.4.16-4) ... 326s Selecting previously unselected package python3-lz4. 326s Preparing to unpack .../084-python3-lz4_4.0.2+dfsg-1build4_armhf.deb ... 326s Unpacking python3-lz4 (4.0.2+dfsg-1build4) ... 326s Selecting previously unselected package python3-unicodedata2. 326s Preparing to unpack .../085-python3-unicodedata2_15.1.0+ds-1build1_armhf.deb ... 326s Unpacking python3-unicodedata2 (15.1.0+ds-1build1) ... 326s Selecting previously unselected package unicode-data. 326s Preparing to unpack .../086-unicode-data_15.1.0-1_all.deb ... 326s Unpacking unicode-data (15.1.0-1) ... 326s Selecting previously unselected package python3-fonttools. 326s Preparing to unpack .../087-python3-fonttools_4.46.0-1build2_armhf.deb ... 326s Unpacking python3-fonttools (4.46.0-1build2) ... 327s Selecting previously unselected package python3-kiwisolver. 327s Preparing to unpack .../088-python3-kiwisolver_1.4.7-2_armhf.deb ... 327s Unpacking python3-kiwisolver (1.4.7-2) ... 327s Selecting previously unselected package python3-packaging. 327s Preparing to unpack .../089-python3-packaging_24.1-1_all.deb ... 327s Unpacking python3-packaging (24.1-1) ... 327s Selecting previously unselected package libqhull-r8.0:armhf. 327s Preparing to unpack .../090-libqhull-r8.0_2020.2-6build1_armhf.deb ... 327s Unpacking libqhull-r8.0:armhf (2020.2-6build1) ... 327s Selecting previously unselected package python3-matplotlib. 327s Preparing to unpack .../091-python3-matplotlib_3.8.3-3_armhf.deb ... 327s Unpacking python3-matplotlib (3.8.3-3) ... 327s Selecting previously unselected package python3-networkx. 327s Preparing to unpack .../092-python3-networkx_3.2.1-4ubuntu1_all.deb ... 327s Unpacking python3-networkx (3.2.1-4ubuntu1) ... 328s Selecting previously unselected package python3-oscrypto. 328s Preparing to unpack .../093-python3-oscrypto_1.3.0-7_all.deb ... 328s Unpacking python3-oscrypto (1.3.0-7) ... 328s Selecting previously unselected package libcdt5:armhf. 328s Preparing to unpack .../094-libcdt5_2.42.4-2build3_armhf.deb ... 328s Unpacking libcdt5:armhf (2.42.4-2build3) ... 328s Selecting previously unselected package libcgraph6:armhf. 328s Preparing to unpack .../095-libcgraph6_2.42.4-2build3_armhf.deb ... 328s Unpacking libcgraph6:armhf (2.42.4-2build3) ... 328s Selecting previously unselected package libaom3:armhf. 328s Preparing to unpack .../096-libaom3_3.11.0~rc1-1_armhf.deb ... 328s Unpacking libaom3:armhf (3.11.0~rc1-1) ... 329s Selecting previously unselected package libheif-plugin-aomdec:armhf. 329s Preparing to unpack .../097-libheif-plugin-aomdec_1.18.1-2_armhf.deb ... 329s Unpacking libheif-plugin-aomdec:armhf (1.18.1-2) ... 329s Selecting previously unselected package libde265-0:armhf. 329s Preparing to unpack .../098-libde265-0_1.0.15-1build4_armhf.deb ... 329s Unpacking libde265-0:armhf (1.0.15-1build4) ... 329s Selecting previously unselected package libheif-plugin-libde265:armhf. 329s Preparing to unpack .../099-libheif-plugin-libde265_1.18.1-2_armhf.deb ... 329s Unpacking libheif-plugin-libde265:armhf (1.18.1-2) ... 329s Selecting previously unselected package libheif1:armhf. 329s Preparing to unpack .../100-libheif1_1.18.1-2_armhf.deb ... 329s Unpacking libheif1:armhf (1.18.1-2) ... 329s Selecting previously unselected package libxpm4:armhf. 329s Preparing to unpack .../101-libxpm4_1%3a3.5.17-1build2_armhf.deb ... 329s Unpacking libxpm4:armhf (1:3.5.17-1build2) ... 329s Selecting previously unselected package libgd3:armhf. 329s Preparing to unpack .../102-libgd3_2.3.3-12ubuntu3_armhf.deb ... 329s Unpacking libgd3:armhf (2.3.3-12ubuntu3) ... 329s Selecting previously unselected package libgts-0.7-5t64:armhf. 329s Preparing to unpack .../103-libgts-0.7-5t64_0.7.6+darcs121130-5.2build1_armhf.deb ... 329s Unpacking libgts-0.7-5t64:armhf (0.7.6+darcs121130-5.2build1) ... 329s Selecting previously unselected package libpixman-1-0:armhf. 329s Preparing to unpack .../104-libpixman-1-0_0.44.0-3_armhf.deb ... 329s Unpacking libpixman-1-0:armhf (0.44.0-3) ... 329s Selecting previously unselected package libxcb-render0:armhf. 329s Preparing to unpack .../105-libxcb-render0_1.17.0-2_armhf.deb ... 329s Unpacking libxcb-render0:armhf (1.17.0-2) ... 329s Selecting previously unselected package libxcb-shm0:armhf. 329s Preparing to unpack .../106-libxcb-shm0_1.17.0-2_armhf.deb ... 329s Unpacking libxcb-shm0:armhf (1.17.0-2) ... 329s Selecting previously unselected package libcairo2:armhf. 329s Preparing to unpack .../107-libcairo2_1.18.2-2_armhf.deb ... 329s Unpacking libcairo2:armhf (1.18.2-2) ... 329s Selecting previously unselected package libltdl7:armhf. 329s Preparing to unpack .../108-libltdl7_2.4.7-7build1_armhf.deb ... 329s Unpacking libltdl7:armhf (2.4.7-7build1) ... 329s Selecting previously unselected package fontconfig. 329s Preparing to unpack .../109-fontconfig_2.15.0-1.1ubuntu2_armhf.deb ... 329s Unpacking fontconfig (2.15.0-1.1ubuntu2) ... 329s Selecting previously unselected package libthai-data. 329s Preparing to unpack .../110-libthai-data_0.1.29-2build1_all.deb ... 329s Unpacking libthai-data (0.1.29-2build1) ... 329s Selecting previously unselected package libdatrie1:armhf. 330s Preparing to unpack .../111-libdatrie1_0.2.13-3build1_armhf.deb ... 330s Unpacking libdatrie1:armhf (0.2.13-3build1) ... 330s Selecting previously unselected package libthai0:armhf. 330s Preparing to unpack .../112-libthai0_0.1.29-2build1_armhf.deb ... 330s Unpacking libthai0:armhf (0.1.29-2build1) ... 330s Selecting previously unselected package libpango-1.0-0:armhf. 330s Preparing to unpack .../113-libpango-1.0-0_1.54.0+ds-3_armhf.deb ... 330s Unpacking libpango-1.0-0:armhf (1.54.0+ds-3) ... 330s Selecting previously unselected package libpangoft2-1.0-0:armhf. 330s Preparing to unpack .../114-libpangoft2-1.0-0_1.54.0+ds-3_armhf.deb ... 330s Unpacking libpangoft2-1.0-0:armhf (1.54.0+ds-3) ... 330s Selecting previously unselected package libpangocairo-1.0-0:armhf. 330s Preparing to unpack .../115-libpangocairo-1.0-0_1.54.0+ds-3_armhf.deb ... 330s Unpacking libpangocairo-1.0-0:armhf (1.54.0+ds-3) ... 330s Selecting previously unselected package libpathplan4:armhf. 330s Preparing to unpack .../116-libpathplan4_2.42.4-2build3_armhf.deb ... 330s Unpacking libpathplan4:armhf (2.42.4-2build3) ... 330s Selecting previously unselected package libgvc6. 330s Preparing to unpack .../117-libgvc6_2.42.4-2build3_armhf.deb ... 330s Unpacking libgvc6 (2.42.4-2build3) ... 330s Selecting previously unselected package libgvpr2:armhf. 330s Preparing to unpack .../118-libgvpr2_2.42.4-2build3_armhf.deb ... 330s Unpacking libgvpr2:armhf (2.42.4-2build3) ... 330s Selecting previously unselected package liblab-gamut1:armhf. 330s Preparing to unpack .../119-liblab-gamut1_2.42.4-2build3_armhf.deb ... 330s Unpacking liblab-gamut1:armhf (2.42.4-2build3) ... 330s Selecting previously unselected package libice6:armhf. 330s Preparing to unpack .../120-libice6_2%3a1.1.1-1_armhf.deb ... 330s Unpacking libice6:armhf (2:1.1.1-1) ... 330s Selecting previously unselected package libsm6:armhf. 330s Preparing to unpack .../121-libsm6_2%3a1.2.4-1_armhf.deb ... 330s Unpacking libsm6:armhf (2:1.2.4-1) ... 330s Selecting previously unselected package libxt6t64:armhf. 330s Preparing to unpack .../122-libxt6t64_1%3a1.2.1-1.2build1_armhf.deb ... 330s Unpacking libxt6t64:armhf (1:1.2.1-1.2build1) ... 330s Selecting previously unselected package libxmu6:armhf. 330s Preparing to unpack .../123-libxmu6_2%3a1.1.3-3build2_armhf.deb ... 330s Unpacking libxmu6:armhf (2:1.1.3-3build2) ... 330s Selecting previously unselected package libxaw7:armhf. 331s Preparing to unpack .../124-libxaw7_2%3a1.0.16-1_armhf.deb ... 331s Unpacking libxaw7:armhf (2:1.0.16-1) ... 331s Selecting previously unselected package graphviz. 331s Preparing to unpack .../125-graphviz_2.42.4-2build3_armhf.deb ... 331s Unpacking graphviz (2.42.4-2build3) ... 331s Selecting previously unselected package python3-pydot. 331s Preparing to unpack .../126-python3-pydot_2.0.0-3_all.deb ... 331s Unpacking python3-pydot (2.0.0-3) ... 331s Selecting previously unselected package androguard. 331s Preparing to unpack .../127-androguard_3.4.0~a1-15_all.deb ... 331s Unpacking androguard (3.4.0~a1-15) ... 332s Selecting previously unselected package android-libart:armhf. 332s Preparing to unpack .../128-android-libart_14.0.0+r15-1ubuntu2_armhf.deb ... 332s Unpacking android-libart:armhf (14.0.0+r15-1ubuntu2) ... 332s Selecting previously unselected package android-liblog:armhf. 332s Preparing to unpack .../129-android-liblog_1%3a34.0.4-1.1_armhf.deb ... 332s Unpacking android-liblog:armhf (1:34.0.4-1.1) ... 332s Selecting previously unselected package android-libbase:armhf. 332s Preparing to unpack .../130-android-libbase_1%3a34.0.4-1.1_armhf.deb ... 332s Unpacking android-libbase:armhf (1:34.0.4-1.1) ... 332s Selecting previously unselected package android-libbacktrace:armhf. 332s Preparing to unpack .../131-android-libbacktrace_1%3a34.0.4-1.1_armhf.deb ... 332s Unpacking android-libbacktrace:armhf (1:34.0.4-1.1) ... 332s Selecting previously unselected package android-libnativebridge:armhf. 332s Preparing to unpack .../132-android-libnativebridge_1%3a14.0.0+r15-1ubuntu2_armhf.deb ... 332s Unpacking android-libnativebridge:armhf (1:14.0.0+r15-1ubuntu2) ... 332s Selecting previously unselected package android-libnativeloader:armhf. 332s Preparing to unpack .../133-android-libnativeloader_1%3a14.0.0+r15-1ubuntu2_armhf.deb ... 332s Unpacking android-libnativeloader:armhf (1:14.0.0+r15-1ubuntu2) ... 332s Selecting previously unselected package android-libziparchive:armhf. 332s Preparing to unpack .../134-android-libziparchive_1%3a34.0.4-1.1_armhf.deb ... 332s Unpacking android-libziparchive:armhf (1:34.0.4-1.1) ... 332s Selecting previously unselected package ca-certificates-java. 332s Preparing to unpack .../135-ca-certificates-java_20240118_all.deb ... 332s Unpacking ca-certificates-java (20240118) ... 332s Selecting previously unselected package java-common. 332s Preparing to unpack .../136-java-common_0.76_all.deb ... 332s Unpacking java-common (0.76) ... 332s Selecting previously unselected package libpcsclite1:armhf. 332s Preparing to unpack .../137-libpcsclite1_2.3.0-1_armhf.deb ... 332s Unpacking libpcsclite1:armhf (2.3.0-1) ... 332s Selecting previously unselected package openjdk-21-jre-headless:armhf. 332s Preparing to unpack .../138-openjdk-21-jre-headless_21.0.5+11-1_armhf.deb ... 332s Unpacking openjdk-21-jre-headless:armhf (21.0.5+11-1) ... 334s Selecting previously unselected package default-jre-headless. 334s Preparing to unpack .../139-default-jre-headless_2%3a1.21-76_armhf.deb ... 334s Unpacking default-jre-headless (2:1.21-76) ... 334s Selecting previously unselected package at-spi2-common. 334s Preparing to unpack .../140-at-spi2-common_2.54.0-1_all.deb ... 334s Unpacking at-spi2-common (2.54.0-1) ... 334s Selecting previously unselected package libatk1.0-0t64:armhf. 334s Preparing to unpack .../141-libatk1.0-0t64_2.54.0-1_armhf.deb ... 334s Unpacking libatk1.0-0t64:armhf (2.54.0-1) ... 335s Selecting previously unselected package libxi6:armhf. 335s Preparing to unpack .../142-libxi6_2%3a1.8.2-1_armhf.deb ... 335s Unpacking libxi6:armhf (2:1.8.2-1) ... 335s Selecting previously unselected package libatspi2.0-0t64:armhf. 335s Preparing to unpack .../143-libatspi2.0-0t64_2.54.0-1_armhf.deb ... 335s Unpacking libatspi2.0-0t64:armhf (2.54.0-1) ... 335s Selecting previously unselected package libatk-bridge2.0-0t64:armhf. 335s Preparing to unpack .../144-libatk-bridge2.0-0t64_2.54.0-1_armhf.deb ... 335s Unpacking libatk-bridge2.0-0t64:armhf (2.54.0-1) ... 335s Selecting previously unselected package libcairo-gobject2:armhf. 335s Preparing to unpack .../145-libcairo-gobject2_1.18.2-2_armhf.deb ... 335s Unpacking libcairo-gobject2:armhf (1.18.2-2) ... 335s Selecting previously unselected package libcolord2:armhf. 335s Preparing to unpack .../146-libcolord2_1.4.7-1build2_armhf.deb ... 335s Unpacking libcolord2:armhf (1.4.7-1build2) ... 335s Selecting previously unselected package libavahi-common-data:armhf. 335s Preparing to unpack .../147-libavahi-common-data_0.8-13ubuntu6_armhf.deb ... 335s Unpacking libavahi-common-data:armhf (0.8-13ubuntu6) ... 335s Selecting previously unselected package libavahi-common3:armhf. 335s Preparing to unpack .../148-libavahi-common3_0.8-13ubuntu6_armhf.deb ... 335s Unpacking libavahi-common3:armhf (0.8-13ubuntu6) ... 335s Selecting previously unselected package libavahi-client3:armhf. 335s Preparing to unpack .../149-libavahi-client3_0.8-13ubuntu6_armhf.deb ... 335s Unpacking libavahi-client3:armhf (0.8-13ubuntu6) ... 335s Selecting previously unselected package libcups2t64:armhf. 335s Preparing to unpack .../150-libcups2t64_2.4.10-1ubuntu2_armhf.deb ... 335s Unpacking libcups2t64:armhf (2.4.10-1ubuntu2) ... 335s Selecting previously unselected package libepoxy0:armhf. 335s Preparing to unpack .../151-libepoxy0_1.5.10-2_armhf.deb ... 335s Unpacking libepoxy0:armhf (1.5.10-2) ... 335s Selecting previously unselected package libwayland-client0:armhf. 335s Preparing to unpack .../152-libwayland-client0_1.23.0-1_armhf.deb ... 335s Unpacking libwayland-client0:armhf (1.23.0-1) ... 335s Selecting previously unselected package libwayland-cursor0:armhf. 335s Preparing to unpack .../153-libwayland-cursor0_1.23.0-1_armhf.deb ... 335s Unpacking libwayland-cursor0:armhf (1.23.0-1) ... 335s Selecting previously unselected package libwayland-egl1:armhf. 335s Preparing to unpack .../154-libwayland-egl1_1.23.0-1_armhf.deb ... 335s Unpacking libwayland-egl1:armhf (1.23.0-1) ... 336s Selecting previously unselected package libxcomposite1:armhf. 336s Preparing to unpack .../155-libxcomposite1_1%3a0.4.6-1_armhf.deb ... 336s Unpacking libxcomposite1:armhf (1:0.4.6-1) ... 336s Selecting previously unselected package libxfixes3:armhf. 336s Preparing to unpack .../156-libxfixes3_1%3a6.0.0-2build1_armhf.deb ... 336s Unpacking libxfixes3:armhf (1:6.0.0-2build1) ... 336s Selecting previously unselected package libxcursor1:armhf. 336s Preparing to unpack .../157-libxcursor1_1%3a1.2.2-1_armhf.deb ... 336s Unpacking libxcursor1:armhf (1:1.2.2-1) ... 336s Selecting previously unselected package libxdamage1:armhf. 336s Preparing to unpack .../158-libxdamage1_1%3a1.1.6-1build1_armhf.deb ... 336s Unpacking libxdamage1:armhf (1:1.1.6-1build1) ... 336s Selecting previously unselected package libxinerama1:armhf. 336s Preparing to unpack .../159-libxinerama1_2%3a1.1.4-3build1_armhf.deb ... 336s Unpacking libxinerama1:armhf (2:1.1.4-3build1) ... 336s Selecting previously unselected package libxrandr2:armhf. 336s Preparing to unpack .../160-libxrandr2_2%3a1.5.4-1_armhf.deb ... 336s Unpacking libxrandr2:armhf (2:1.5.4-1) ... 336s Selecting previously unselected package libdconf1:armhf. 336s Preparing to unpack .../161-libdconf1_0.40.0-4build2_armhf.deb ... 336s Unpacking libdconf1:armhf (0.40.0-4build2) ... 336s Selecting previously unselected package dconf-service. 336s Preparing to unpack .../162-dconf-service_0.40.0-4build2_armhf.deb ... 336s Unpacking dconf-service (0.40.0-4build2) ... 336s Selecting previously unselected package dconf-gsettings-backend:armhf. 336s Preparing to unpack .../163-dconf-gsettings-backend_0.40.0-4build2_armhf.deb ... 336s Unpacking dconf-gsettings-backend:armhf (0.40.0-4build2) ... 336s Selecting previously unselected package libgtk-3-common. 336s Preparing to unpack .../164-libgtk-3-common_3.24.43-3ubuntu2_all.deb ... 336s Unpacking libgtk-3-common (3.24.43-3ubuntu2) ... 336s Selecting previously unselected package libgtk-3-0t64:armhf. 336s Preparing to unpack .../165-libgtk-3-0t64_3.24.43-3ubuntu2_armhf.deb ... 336s Unpacking libgtk-3-0t64:armhf (3.24.43-3ubuntu2) ... 337s Selecting previously unselected package libglvnd0:armhf. 337s Preparing to unpack .../166-libglvnd0_1.7.0-1build1_armhf.deb ... 337s Unpacking libglvnd0:armhf (1.7.0-1build1) ... 337s Selecting previously unselected package libglapi-mesa:armhf. 337s Preparing to unpack .../167-libglapi-mesa_24.2.3-1ubuntu1_armhf.deb ... 337s Unpacking libglapi-mesa:armhf (24.2.3-1ubuntu1) ... 337s Selecting previously unselected package libx11-xcb1:armhf. 337s Preparing to unpack .../168-libx11-xcb1_2%3a1.8.10-2_armhf.deb ... 337s Unpacking libx11-xcb1:armhf (2:1.8.10-2) ... 337s Selecting previously unselected package libxcb-dri2-0:armhf. 337s Preparing to unpack .../169-libxcb-dri2-0_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-dri2-0:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxcb-dri3-0:armhf. 337s Preparing to unpack .../170-libxcb-dri3-0_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-dri3-0:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxcb-glx0:armhf. 337s Preparing to unpack .../171-libxcb-glx0_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-glx0:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxcb-present0:armhf. 337s Preparing to unpack .../172-libxcb-present0_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-present0:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxcb-randr0:armhf. 337s Preparing to unpack .../173-libxcb-randr0_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-randr0:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxcb-sync1:armhf. 337s Preparing to unpack .../174-libxcb-sync1_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-sync1:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxcb-xfixes0:armhf. 337s Preparing to unpack .../175-libxcb-xfixes0_1.17.0-2_armhf.deb ... 337s Unpacking libxcb-xfixes0:armhf (1.17.0-2) ... 337s Selecting previously unselected package libxshmfence1:armhf. 337s Preparing to unpack .../176-libxshmfence1_1.3-1build5_armhf.deb ... 337s Unpacking libxshmfence1:armhf (1.3-1build5) ... 337s Selecting previously unselected package libxxf86vm1:armhf. 337s Preparing to unpack .../177-libxxf86vm1_1%3a1.1.4-1build4_armhf.deb ... 337s Unpacking libxxf86vm1:armhf (1:1.1.4-1build4) ... 338s Selecting previously unselected package libdrm-amdgpu1:armhf. 338s Preparing to unpack .../178-libdrm-amdgpu1_2.4.123-1_armhf.deb ... 338s Unpacking libdrm-amdgpu1:armhf (2.4.123-1) ... 338s Selecting previously unselected package libdrm-radeon1:armhf. 338s Preparing to unpack .../179-libdrm-radeon1_2.4.123-1_armhf.deb ... 338s Unpacking libdrm-radeon1:armhf (2.4.123-1) ... 338s Selecting previously unselected package libllvm19:armhf. 338s Preparing to unpack .../180-libllvm19_1%3a19.1.2-1ubuntu1_armhf.deb ... 338s Unpacking libllvm19:armhf (1:19.1.2-1ubuntu1) ... 339s Selecting previously unselected package mesa-libgallium:armhf. 339s Preparing to unpack .../181-mesa-libgallium_24.2.3-1ubuntu1_armhf.deb ... 339s Unpacking mesa-libgallium:armhf (24.2.3-1ubuntu1) ... 339s Selecting previously unselected package libvulkan1:armhf. 339s Preparing to unpack .../182-libvulkan1_1.3.296.0-1_armhf.deb ... 339s Unpacking libvulkan1:armhf (1.3.296.0-1) ... 339s Selecting previously unselected package libwayland-server0:armhf. 339s Preparing to unpack .../183-libwayland-server0_1.23.0-1_armhf.deb ... 339s Unpacking libwayland-server0:armhf (1.23.0-1) ... 339s Selecting previously unselected package libgbm1:armhf. 339s Preparing to unpack .../184-libgbm1_24.2.3-1ubuntu1_armhf.deb ... 339s Unpacking libgbm1:armhf (24.2.3-1ubuntu1) ... 339s Selecting previously unselected package libgl1-mesa-dri:armhf. 339s Preparing to unpack .../185-libgl1-mesa-dri_24.2.3-1ubuntu1_armhf.deb ... 340s Unpacking libgl1-mesa-dri:armhf (24.2.3-1ubuntu1) ... 340s Selecting previously unselected package libglx-mesa0:armhf. 340s Preparing to unpack .../186-libglx-mesa0_24.2.3-1ubuntu1_armhf.deb ... 340s Unpacking libglx-mesa0:armhf (24.2.3-1ubuntu1) ... 340s Selecting previously unselected package libglx0:armhf. 340s Preparing to unpack .../187-libglx0_1.7.0-1build1_armhf.deb ... 340s Unpacking libglx0:armhf (1.7.0-1build1) ... 340s Selecting previously unselected package libgl1:armhf. 340s Preparing to unpack .../188-libgl1_1.7.0-1build1_armhf.deb ... 340s Unpacking libgl1:armhf (1.7.0-1build1) ... 340s Selecting previously unselected package libasound2-data. 340s Preparing to unpack .../189-libasound2-data_1.2.12-1_all.deb ... 340s Unpacking libasound2-data (1.2.12-1) ... 340s Selecting previously unselected package libasound2t64:armhf. 340s Preparing to unpack .../190-libasound2t64_1.2.12-1_armhf.deb ... 340s Unpacking libasound2t64:armhf (1.2.12-1) ... 340s Selecting previously unselected package libgif7:armhf. 340s Preparing to unpack .../191-libgif7_5.2.2-1ubuntu1_armhf.deb ... 340s Unpacking libgif7:armhf (5.2.2-1ubuntu1) ... 340s Selecting previously unselected package libxtst6:armhf. 340s Preparing to unpack .../192-libxtst6_2%3a1.2.3-1.1build1_armhf.deb ... 340s Unpacking libxtst6:armhf (2:1.2.3-1.1build1) ... 340s Selecting previously unselected package openjdk-21-jre:armhf. 340s Preparing to unpack .../193-openjdk-21-jre_21.0.5+11-1_armhf.deb ... 340s Unpacking openjdk-21-jre:armhf (21.0.5+11-1) ... 340s Selecting previously unselected package default-jre. 340s Preparing to unpack .../194-default-jre_2%3a1.21-76_armhf.deb ... 340s Unpacking default-jre (2:1.21-76) ... 340s Selecting previously unselected package libapksig-java. 340s Preparing to unpack .../195-libapksig-java_31.0.2-2_all.deb ... 340s Unpacking libapksig-java (31.0.2-2) ... 340s Selecting previously unselected package apksigner. 340s Preparing to unpack .../196-apksigner_31.0.2-2_all.deb ... 340s Unpacking apksigner (31.0.2-2) ... 340s Selecting previously unselected package openjdk-21-jdk-headless:armhf. 340s Preparing to unpack .../197-openjdk-21-jdk-headless_21.0.5+11-1_armhf.deb ... 341s Unpacking openjdk-21-jdk-headless:armhf (21.0.5+11-1) ... 341s Selecting previously unselected package default-jdk-headless. 341s Preparing to unpack .../198-default-jdk-headless_2%3a1.21-76_armhf.deb ... 341s Unpacking default-jdk-headless (2:1.21-76) ... 341s Selecting previously unselected package libtinyxml2-10:armhf. 341s Preparing to unpack .../199-libtinyxml2-10_10.0.0+dfsg-2_armhf.deb ... 341s Unpacking libtinyxml2-10:armhf (10.0.0+dfsg-2) ... 341s Selecting previously unselected package dexdump. 341s Preparing to unpack .../200-dexdump_14.0.0+r15-1ubuntu2_armhf.deb ... 341s Unpacking dexdump (14.0.0+r15-1ubuntu2) ... 341s Selecting previously unselected package python3-args. 341s Preparing to unpack .../201-python3-args_0.1.0-5_all.deb ... 341s Unpacking python3-args (0.1.0-5) ... 341s Selecting previously unselected package python3-clint. 341s Preparing to unpack .../202-python3-clint_0.5.1-4_all.deb ... 341s Unpacking python3-clint (0.5.1-4) ... 341s Selecting previously unselected package python3-defusedxml. 341s Preparing to unpack .../203-python3-defusedxml_0.7.1-2_all.deb ... 341s Unpacking python3-defusedxml (0.7.1-2) ... 342s Selecting previously unselected package liberror-perl. 342s Preparing to unpack .../204-liberror-perl_0.17029-2_all.deb ... 342s Unpacking liberror-perl (0.17029-2) ... 342s Selecting previously unselected package git-man. 342s Preparing to unpack .../205-git-man_1%3a2.45.2-1.2ubuntu1_all.deb ... 342s Unpacking git-man (1:2.45.2-1.2ubuntu1) ... 342s Selecting previously unselected package git. 342s Preparing to unpack .../206-git_1%3a2.45.2-1.2ubuntu1_armhf.deb ... 342s Unpacking git (1:2.45.2-1.2ubuntu1) ... 342s Selecting previously unselected package python3-smmap. 342s Preparing to unpack .../207-python3-smmap_6.0.0-1_all.deb ... 342s Unpacking python3-smmap (6.0.0-1) ... 342s Selecting previously unselected package python3-gitdb. 342s Preparing to unpack .../208-python3-gitdb_4.0.11-1_all.deb ... 342s Unpacking python3-gitdb (4.0.11-1) ... 342s Selecting previously unselected package python3-git. 342s Preparing to unpack .../209-python3-git_3.1.37-3_all.deb ... 342s Unpacking python3-git (3.1.37-3) ... 342s Selecting previously unselected package python3-bcrypt. 342s Preparing to unpack .../210-python3-bcrypt_4.2.0-1_armhf.deb ... 342s Unpacking python3-bcrypt (4.2.0-1) ... 342s Selecting previously unselected package libsodium23:armhf. 342s Preparing to unpack .../211-libsodium23_1.0.18-1build3_armhf.deb ... 342s Unpacking libsodium23:armhf (1.0.18-1build3) ... 343s Selecting previously unselected package python3-nacl. 343s Preparing to unpack .../212-python3-nacl_1.5.0-6_armhf.deb ... 343s Unpacking python3-nacl (1.5.0-6) ... 343s Selecting previously unselected package python3-paramiko. 343s Preparing to unpack .../213-python3-paramiko_3.4.0-1ubuntu2_all.deb ... 343s Unpacking python3-paramiko (3.4.0-1ubuntu2) ... 343s Selecting previously unselected package python3-platformdirs. 343s Preparing to unpack .../214-python3-platformdirs_4.3.6-1_all.deb ... 343s Unpacking python3-platformdirs (4.3.6-1) ... 343s Selecting previously unselected package python3-png. 343s Preparing to unpack .../215-python3-png_0.20231004.0-4_all.deb ... 343s Unpacking python3-png (0.20231004.0-4) ... 343s Selecting previously unselected package python3-qrcode. 343s Preparing to unpack .../216-python3-qrcode_7.4.2-5_all.deb ... 343s Unpacking python3-qrcode (7.4.2-5) ... 343s Selecting previously unselected package python3-ruamel.yaml.clib:armhf. 343s Preparing to unpack .../217-python3-ruamel.yaml.clib_0.2.8+ds-2_armhf.deb ... 343s Unpacking python3-ruamel.yaml.clib:armhf (0.2.8+ds-2) ... 343s Selecting previously unselected package python3-ruamel.yaml. 343s Preparing to unpack .../218-python3-ruamel.yaml_0.18.6+ds-3_all.deb ... 343s Unpacking python3-ruamel.yaml (0.18.6+ds-3) ... 343s Selecting previously unselected package python3-looseversion. 343s Preparing to unpack .../219-python3-looseversion_1.3.0-3_all.deb ... 343s Unpacking python3-looseversion (1.3.0-3) ... 343s Selecting previously unselected package sdkmanager. 343s Preparing to unpack .../220-sdkmanager_0.6.10-1_all.deb ... 343s Unpacking sdkmanager (0.6.10-1) ... 343s Selecting previously unselected package python3-pathspec. 343s Preparing to unpack .../221-python3-pathspec_0.12.1-1_all.deb ... 343s Unpacking python3-pathspec (0.12.1-1) ... 343s Selecting previously unselected package yamllint. 343s Preparing to unpack .../222-yamllint_1.35.1-2_all.deb ... 343s Unpacking yamllint (1.35.1-2) ... 343s Selecting previously unselected package python3-biplist. 343s Preparing to unpack .../223-python3-biplist_1.0.3-5_all.deb ... 343s Unpacking python3-biplist (1.0.3-5) ... 343s Selecting previously unselected package python3-pycountry. 344s Preparing to unpack .../224-python3-pycountry_24.6.1+ds1-1_all.deb ... 344s Unpacking python3-pycountry (24.6.1+ds1-1) ... 344s Selecting previously unselected package s3cmd. 344s Preparing to unpack .../225-s3cmd_2.4.0-2_all.deb ... 344s Unpacking s3cmd (2.4.0-2) ... 344s Selecting previously unselected package fdroidserver. 344s Preparing to unpack .../226-fdroidserver_2.3~a2-1_all.deb ... 344s Unpacking fdroidserver (2.3~a2-1) ... 344s Selecting previously unselected package python3-simplejson. 344s Preparing to unpack .../227-python3-simplejson_3.19.3-1_armhf.deb ... 344s Unpacking python3-simplejson (3.19.3-1) ... 344s Selecting previously unselected package python3-libcloud. 344s Preparing to unpack .../228-python3-libcloud_3.8.0+repack-3_all.deb ... 344s Unpacking python3-libcloud (3.8.0+repack-3) ... 344s Selecting previously unselected package autopkgtest-satdep. 344s Preparing to unpack .../229-1-autopkgtest-satdep.deb ... 344s Unpacking autopkgtest-satdep (0) ... 344s Setting up libgraphite2-3:armhf (1.3.14-2ubuntu1) ... 344s Setting up libxcb-dri3-0:armhf (1.17.0-2) ... 344s Setting up liblcms2-2:armhf (2.16-2) ... 344s Setting up libpixman-1-0:armhf (0.44.0-3) ... 344s Setting up libllvm19:armhf (1:19.1.2-1ubuntu1) ... 344s Setting up libsharpyuv0:armhf (1.4.0-0.1) ... 344s Setting up libwayland-server0:armhf (1.23.0-1) ... 344s Setting up libaom3:armhf (3.11.0~rc1-1) ... 344s Setting up libx11-xcb1:armhf (2:1.8.10-2) ... 344s Setting up python3-pure-eval (0.2.3-1) ... 344s Setting up libsodium23:armhf (1.0.18-1build3) ... 344s Setting up libxdamage1:armhf (1:1.1.6-1build1) ... 344s Setting up libxcb-xfixes0:armhf (1.17.0-2) ... 344s Setting up liblerc4:armhf (4.0.0+ds-4ubuntu2) ... 344s Setting up libxpm4:armhf (1:3.5.17-1build2) ... 344s Setting up hicolor-icon-theme (0.18-1) ... 344s Setting up libxi6:armhf (2:1.8.2-1) ... 344s Setting up android-liblog:armhf (1:34.0.4-1.1) ... 344s Setting up java-common (0.76) ... 344s Setting up libxrender1:armhf (1:0.9.10-1.1build1) ... 344s Setting up libdatrie1:armhf (0.2.13-3build1) ... 344s Setting up python3-parso (0.8.3-1) ... 345s Setting up python3-colorama (0.4.6-4) ... 345s Setting up python3-lz4 (4.0.2+dfsg-1build4) ... 345s Setting up libxcb-render0:armhf (1.17.0-2) ... 345s Setting up python3-defusedxml (0.7.1-2) ... 345s Setting up python3-asttokens (2.4.1-2) ... 346s Setting up libdrm-radeon1:armhf (2.4.123-1) ... 346s Setting up libglvnd0:armhf (1.7.0-1build1) ... 346s Setting up python3-unicodedata2 (15.1.0+ds-1build1) ... 346s Setting up fonts-lyx (2.4.2.1-1) ... 346s Setting up libxcb-glx0:armhf (1.17.0-2) ... 346s Setting up python3-bcrypt (4.2.0-1) ... 346s Setting up liblab-gamut1:armhf (2.42.4-2build3) ... 346s Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... 346s Setting up python3-ruamel.yaml.clib:armhf (0.2.8+ds-2) ... 346s Setting up x11-common (1:7.7+23ubuntu3) ... 346s Setting up libdeflate0:armhf (1.22-1) ... 346s Setting up libtinyxml2-10:armhf (10.0.0+dfsg-2) ... 346s Setting up libqhull-r8.0:armhf (2020.2-6build1) ... 346s Setting up libxcb-shm0:armhf (1.17.0-2) ... 346s Setting up libgomp1:armhf (14.2.0-8ubuntu1) ... 346s Setting up python3-click (8.1.7-2) ... 346s Setting up python3-networkx (3.2.1-4ubuntu1) ... 349s Setting up libjbig0:armhf (2.1-6.1ubuntu2) ... 349s Setting up android-libart:armhf (14.0.0+r15-1ubuntu2) ... 349s Setting up libcolord2:armhf (1.4.7-1build2) ... 349s Setting up python3-platformdirs (4.3.6-1) ... 349s Setting up python3-tz (2024.1-2) ... 349s Setting up libxxf86vm1:armhf (1:1.1.4-1build4) ... 349s Setting up python3-png (0.20231004.0-4) ... 349s Setting up libxcb-present0:armhf (1.17.0-2) ... 349s Setting up liberror-perl (0.17029-2) ... 349s Setting up libdconf1:armhf (0.40.0-4build2) ... 349s Setting up unicode-data (15.1.0-1) ... 349s Setting up python3-six (1.16.0-7) ... 349s Setting up python3-simplejson (3.19.3-1) ... 350s Setting up libasound2-data (1.2.12-1) ... 350s Setting up python3-decorator (5.1.1-5) ... 350s Setting up libblas3:armhf (3.12.0-3build2) ... 350s update-alternatives: using /usr/lib/arm-linux-gnueabihf/blas/libblas.so.3 to provide /usr/lib/arm-linux-gnueabihf/libblas.so.3 (libblas.so.3-arm-linux-gnueabihf) in auto mode 350s Setting up python3-packaging (24.1-1) ... 350s Setting up libasound2t64:armhf (1.2.12-1) ... 350s Setting up python3-wcwidth (0.2.13+dfsg1-1) ... 350s Setting up libfreetype6:armhf (2.13.3+dfsg-1) ... 350s Setting up python3-args (0.1.0-5) ... 351s Setting up libepoxy0:armhf (1.5.10-2) ... 351s Setting up python3-typeshed (0.0~git20231111.6764465-3) ... 351s Setting up libxfixes3:armhf (1:6.0.0-2build1) ... 351s Setting up libxcb-sync1:armhf (1.17.0-2) ... 351s Setting up python3-executing (2.1.0-0.1) ... 351s Setting up libpathplan4:armhf (2.42.4-2build3) ... 351s Setting up python3-brotli (1.1.0-2build2) ... 351s Setting up libavahi-common-data:armhf (0.8-13ubuntu6) ... 351s Setting up libatspi2.0-0t64:armhf (2.54.0-1) ... 351s Setting up python3-cycler (0.12.1-1) ... 351s Setting up python3-pycountry (24.6.1+ds1-1) ... 351s Setting up libxinerama1:armhf (2:1.1.4-3build1) ... 351s Setting up libimagequant0:armhf (2.18.0-1build1) ... 351s Setting up fonts-dejavu-mono (2.37-8) ... 351s Setting up python3-kiwisolver (1.4.7-2) ... 351s Setting up libxrandr2:armhf (2:1.5.4-1) ... 351s Setting up libtcl8.6:armhf (8.6.15+dfsg-2) ... 351s Setting up fonts-dejavu-core (2.37-8) ... 352s Setting up libpcsclite1:armhf (2.3.0-1) ... 352s Setting up libjpeg-turbo8:armhf (2.1.5-2ubuntu2) ... 352s Setting up libltdl7:armhf (2.4.7-7build1) ... 352s Setting up libglapi-mesa:armhf (24.2.3-1ubuntu1) ... 352s Setting up libgfortran5:armhf (14.2.0-8ubuntu1) ... 352s Setting up libvulkan1:armhf (1.3.296.0-1) ... 352s Setting up libwebp7:armhf (1.4.0-0.1) ... 352s Setting up libxcb-dri2-0:armhf (1.17.0-2) ... 352s Setting up python3-ruamel.yaml (0.18.6+ds-3) ... 352s Setting up libgif7:armhf (5.2.2-1ubuntu1) ... 352s Setting up python3-looseversion (1.3.0-3) ... 352s Setting up libxshmfence1:armhf (1.3-1build5) ... 352s Setting up at-spi2-common (2.54.0-1) ... 352s Setting up libxcb-randr0:armhf (1.17.0-2) ... 352s Setting up python3-traitlets (5.14.3+really5.14.3-1) ... 352s Setting up libxslt1.1:armhf (1.1.39-0exp1ubuntu1) ... 352s Setting up libopenjp2-7:armhf (2.5.0-2ubuntu1) ... 352s Setting up git-man (1:2.45.2-1.2ubuntu1) ... 352s Setting up libharfbuzz0b:armhf (10.0.1-1) ... 352s Setting up libthai-data (0.1.29-2build1) ... 352s Setting up python3-dateutil (2.9.0-2) ... 353s Setting up libgts-0.7-5t64:armhf (0.7.6+darcs121130-5.2build1) ... 353s Setting up libcdt5:armhf (2.42.4-2build3) ... 353s Setting up libcgraph6:armhf (2.42.4-2build3) ... 353s Setting up libwayland-egl1:armhf (1.23.0-1) ... 353s Setting up libxss1:armhf (1:1.2.3-1build3) ... 353s Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 353s Setting up ca-certificates-java (20240118) ... 353s No JRE found. Skipping Java certificates setup. 353s Setting up python3-biplist (1.0.3-5) ... 353s Setting up python3-mpmath (1.3.0-1) ... 354s Setting up libde265-0:armhf (1.0.15-1build4) ... 354s Setting up python3-magic (2:0.4.27-3) ... 354s Setting up android-libbase:armhf (1:34.0.4-1.1) ... 354s Setting up python-matplotlib-data (3.8.3-3) ... 354s Setting up libwebpmux3:armhf (1.4.0-0.1) ... 354s Setting up python3-pathspec (0.12.1-1) ... 354s Setting up python3-appdirs (1.4.4-4) ... 354s Setting up python3-smmap (6.0.0-1) ... 354s Setting up libxcomposite1:armhf (1:0.4.6-1) ... 354s Setting up python3-stack-data (0.6.3-1) ... 355s Setting up python3-asn1crypto (1.5.1-3) ... 355s Setting up python3-nacl (1.5.0-6) ... 355s Setting up libapksig-java (31.0.2-2) ... 355s Setting up python3-ptyprocess (0.7.0-6) ... 355s Setting up libdrm-amdgpu1:armhf (2.4.123-1) ... 355s Setting up sdkmanager (0.6.10-1) ... 355s Setting up libwayland-client0:armhf (1.23.0-1) ... 355s Setting up libjpeg8:armhf (8c-2ubuntu11) ... 355s Setting up python3-prompt-toolkit (3.0.48-1) ... 356s Setting up python3-sympy (1.13.3-1) ... 364s Setting up android-libnativebridge:armhf (1:14.0.0+r15-1ubuntu2) ... 364s Setting up libice6:armhf (2:1.1.1-1) ... 364s Setting up mesa-libgallium:armhf (24.2.3-1ubuntu1) ... 364s Setting up liblapack3:armhf (3.12.0-3build2) ... 364s update-alternatives: using /usr/lib/arm-linux-gnueabihf/lapack/liblapack.so.3 to provide /usr/lib/arm-linux-gnueabihf/liblapack.so.3 (liblapack.so.3-arm-linux-gnueabihf) in auto mode 364s Setting up python3-clint (0.5.1-4) ... 364s /usr/lib/python3/dist-packages/clint/packages/appdirs.py:82: SyntaxWarning: invalid escape sequence '\D' 364s """Return full path to the user-shared data dir for this application. 364s /usr/lib/python3/dist-packages/clint/packages/colorama/ansitowin32.py:43: SyntaxWarning: invalid escape sequence '\[' 364s ANSI_RE = re.compile('\033\[((?:\d|;)*)([a-zA-Z])') 364s /usr/lib/python3/dist-packages/clint/textui/colored.py:118: SyntaxWarning: invalid escape sequence '\$' 364s strip = re.compile("([^-_a-zA-Z0-9!@#%&=,/'\";:~`\$\^\*\(\)\+\[\]\.\{\}\|\?\<\>\\]+|[^\s]+)") 364s Setting up android-libziparchive:armhf (1:34.0.4-1.1) ... 364s Setting up libatk1.0-0t64:armhf (2.54.0-1) ... 364s Setting up openjdk-21-jre-headless:armhf (21.0.5+11-1) ... 364s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode 364s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode 364s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode 364s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode 364s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode 364s Setting up python3-jedi (0.19.1+ds1-1) ... 365s Setting up libgbm1:armhf (24.2.3-1ubuntu1) ... 365s Setting up fontconfig-config (2.15.0-1.1ubuntu2) ... 365s Setting up libxtst6:armhf (2:1.2.3-1.1build1) ... 365s Setting up libwebpdemux2:armhf (1.4.0-0.1) ... 365s Setting up libxcursor1:armhf (1:1.2.2-1) ... 365s Setting up libgl1-mesa-dri:armhf (24.2.3-1ubuntu1) ... 365s Setting up libavahi-common3:armhf (0.8-13ubuntu6) ... 365s Setting up dconf-service (0.40.0-4build2) ... 365s Setting up python3-libcloud (3.8.0+repack-3) ... 367s Setting up python3-gitdb (4.0.11-1) ... 367s Setting up s3cmd (2.4.0-2) ... 367s /usr/lib/python3/dist-packages/S3/FileLists.py:525: SyntaxWarning: invalid escape sequence '\*' 367s wildcard_split_result = re.split("\*|\?", uri_str, maxsplit=1) 367s /usr/lib/python3/dist-packages/S3/S3Uri.py:122: SyntaxWarning: invalid escape sequence '\.' 367s m = re.match("(.*\.)?s3(?:\-[^\.]*)?(?:\.dualstack)?(?:\.[^\.]*)?\.amazonaws\.com(?:\.cn)?$", 367s /usr/lib/python3/dist-packages/S3/S3Uri.py:170: SyntaxWarning: invalid escape sequence '\w' 367s _re = re.compile("^(\w+://)?(.*)", re.UNICODE) 367s Setting up python3-matplotlib-inline (0.1.6-2) ... 367s Setting up python3-fs (2.4.16-4) ... 368s Setting up libthai0:armhf (0.1.29-2build1) ... 368s Setting up yamllint (1.35.1-2) ... 368s Setting up python3-oscrypto (1.3.0-7) ... 368s Setting up libjs-jquery-ui (1.13.2+dfsg-1) ... 368s Setting up python3-pexpect (4.9-2) ... 368s Setting up libraqm0:armhf (0.10.1-1build1) ... 368s Setting up android-libnativeloader:armhf (1:14.0.0+r15-1ubuntu2) ... 368s Setting up git (1:2.45.2-1.2ubuntu1) ... 368s Setting up python3-numpy (1:1.26.4+ds-11build1) ... 371s Setting up android-libbacktrace:armhf (1:34.0.4-1.1) ... 371s Setting up libgvpr2:armhf (2.42.4-2build3) ... 371s Setting up python3-lxml:armhf (5.3.0-1) ... 372s Setting up libtiff6:armhf (4.5.1+git230720-4ubuntu4) ... 372s Setting up libwayland-cursor0:armhf (1.23.0-1) ... 372s Setting up libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1) ... 372s Setting up python3-contourpy (1.3.0-2) ... 372s Setting up libfontconfig1:armhf (2.15.0-1.1ubuntu2) ... 372s Setting up python3-paramiko (3.4.0-1ubuntu2) ... 372s Setting up libsm6:armhf (2:1.2.4-1) ... 372s Setting up libavahi-client3:armhf (0.8-13ubuntu6) ... 372s Setting up liblbfgsb0:armhf (3.0+dfsg.4-1build1) ... 372s Setting up libatk-bridge2.0-0t64:armhf (2.54.0-1) ... 372s Setting up gtk-update-icon-cache (4.16.5+ds-1) ... 372s Setting up fontconfig (2.15.0-1.1ubuntu2) ... 374s Regenerating fonts cache... done. 374s Setting up libxft2:armhf (2.3.6-1build1) ... 374s Setting up libglx-mesa0:armhf (24.2.3-1ubuntu1) ... 374s Setting up python3-scipy (1.13.1-5) ... 380s Setting up libglx0:armhf (1.7.0-1build1) ... 380s Setting up dconf-gsettings-backend:armhf (0.40.0-4build2) ... 380s Setting up libtk8.6:armhf (8.6.15-1) ... 380s Setting up libpango-1.0-0:armhf (1.54.0+ds-3) ... 380s Setting up python3.12-tk (3.12.7-3) ... 380s Setting up libcairo2:armhf (1.18.2-2) ... 380s Setting up python3.13-tk (3.13.0-2) ... 380s Setting up python3-pil:armhf (10.4.0-1ubuntu1) ... 381s Setting up dexdump (14.0.0+r15-1ubuntu2) ... 381s Setting up libgl1:armhf (1.7.0-1build1) ... 381s Setting up python3-ipython (8.20.0-1ubuntu1) ... 382s Setting up python3-git (3.1.37-3) ... 382s Setting up libxt6t64:armhf (1:1.2.1-1.2build1) ... 382s Setting up libcairo-gobject2:armhf (1.18.2-2) ... 382s Setting up python3-qrcode (7.4.2-5) ... 382s update-alternatives: using /usr/bin/python3-qr to provide /usr/bin/qr (qr) in auto mode 382s Setting up libpangoft2-1.0-0:armhf (1.54.0+ds-3) ... 382s Setting up libcups2t64:armhf (2.4.10-1ubuntu2) ... 382s Setting up libgtk-3-common (3.24.43-3ubuntu2) ... 382s Setting up libpangocairo-1.0-0:armhf (1.54.0+ds-3) ... 382s Setting up tk8.6-blt2.5 (2.5.3+dfsg-7build1) ... 382s Setting up libxmu6:armhf (2:1.1.3-3build2) ... 382s Setting up blt (2.5.3+dfsg-7build1) ... 382s Setting up python3-tk:armhf (3.12.7-1) ... 382s Setting up libxaw7:armhf (2:1.0.16-1) ... 382s Setting up python3-pil.imagetk:armhf (10.4.0-1ubuntu1) ... 382s Setting up python3-ufolib2 (0.16.1+dfsg1-1) ... 383s Setting up libheif-plugin-aomdec:armhf (1.18.1-2) ... 383s Setting up libheif-plugin-libde265:armhf (1.18.1-2) ... 383s Setting up libheif1:armhf (1.18.1-2) ... 383s Setting up python3-fonttools (4.46.0-1build2) ... 384s Setting up adwaita-icon-theme (47.0-2) ... 384s update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode 384s Setting up libgd3:armhf (2.3.3-12ubuntu3) ... 384s Setting up libgvc6 (2.42.4-2build3) ... 384s Setting up graphviz (2.42.4-2build3) ... 384s Setting up python3-matplotlib (3.8.3-3) ... 387s Setting up python3-pydot (2.0.0-3) ... 387s Setting up androguard (3.4.0~a1-15) ... 387s /usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:1027: SyntaxWarning: invalid escape sequence '\>' 387s """ 388s Setting up humanity-icon-theme (0.6.16) ... 388s Setting up ubuntu-mono (24.04-0ubuntu1) ... 388s Processing triggers for man-db (2.12.1-3) ... 389s Processing triggers for libglib2.0-0t64:armhf (2.82.1-0ubuntu1) ... 389s Setting up libgtk-3-0t64:armhf (3.24.43-3ubuntu2) ... 389s Processing triggers for libc-bin (2.40-1ubuntu3) ... 389s Processing triggers for ca-certificates-java (20240118) ... 390s Adding debian:ACCVRAIZ1.pem 390s Adding debian:AC_RAIZ_FNMT-RCM.pem 390s Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem 390s Adding debian:ANF_Secure_Server_Root_CA.pem 390s Adding debian:Actalis_Authentication_Root_CA.pem 390s Adding debian:AffirmTrust_Commercial.pem 390s Adding debian:AffirmTrust_Networking.pem 390s Adding debian:AffirmTrust_Premium.pem 390s Adding debian:AffirmTrust_Premium_ECC.pem 390s Adding debian:Amazon_Root_CA_1.pem 390s Adding debian:Amazon_Root_CA_2.pem 390s Adding debian:Amazon_Root_CA_3.pem 390s Adding debian:Amazon_Root_CA_4.pem 390s Adding debian:Atos_TrustedRoot_2011.pem 390s Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem 390s Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem 390s Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem 390s Adding debian:BJCA_Global_Root_CA1.pem 390s Adding debian:BJCA_Global_Root_CA2.pem 390s Adding debian:Baltimore_CyberTrust_Root.pem 390s Adding debian:Buypass_Class_2_Root_CA.pem 390s Adding debian:Buypass_Class_3_Root_CA.pem 390s Adding debian:CA_Disig_Root_R2.pem 390s Adding debian:CFCA_EV_ROOT.pem 390s Adding debian:COMODO_Certification_Authority.pem 390s Adding debian:COMODO_ECC_Certification_Authority.pem 390s Adding debian:COMODO_RSA_Certification_Authority.pem 390s Adding debian:Certainly_Root_E1.pem 390s Adding debian:Certainly_Root_R1.pem 390s Adding debian:Certigna.pem 390s Adding debian:Certigna_Root_CA.pem 390s Adding debian:Certum_EC-384_CA.pem 390s Adding debian:Certum_Trusted_Network_CA.pem 390s Adding debian:Certum_Trusted_Network_CA_2.pem 390s Adding debian:Certum_Trusted_Root_CA.pem 390s Adding debian:CommScope_Public_Trust_ECC_Root-01.pem 390s Adding debian:CommScope_Public_Trust_ECC_Root-02.pem 390s Adding debian:CommScope_Public_Trust_RSA_Root-01.pem 390s Adding debian:CommScope_Public_Trust_RSA_Root-02.pem 390s Adding debian:Comodo_AAA_Services_root.pem 390s Adding debian:D-TRUST_BR_Root_CA_1_2020.pem 390s Adding debian:D-TRUST_EV_Root_CA_1_2020.pem 390s Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem 390s Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem 390s Adding debian:DigiCert_Assured_ID_Root_CA.pem 390s Adding debian:DigiCert_Assured_ID_Root_G2.pem 390s Adding debian:DigiCert_Assured_ID_Root_G3.pem 390s Adding debian:DigiCert_Global_Root_CA.pem 390s Adding debian:DigiCert_Global_Root_G2.pem 390s Adding debian:DigiCert_Global_Root_G3.pem 390s Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem 390s Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem 390s Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem 390s Adding debian:DigiCert_Trusted_Root_G4.pem 390s Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem 390s Adding debian:Entrust_Root_Certification_Authority.pem 390s Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem 390s Adding debian:Entrust_Root_Certification_Authority_-_G2.pem 390s Adding debian:Entrust_Root_Certification_Authority_-_G4.pem 390s Adding debian:GDCA_TrustAUTH_R5_ROOT.pem 390s Adding debian:GLOBALTRUST_2020.pem 390s Adding debian:GTS_Root_R1.pem 390s Adding debian:GTS_Root_R2.pem 390s Adding debian:GTS_Root_R3.pem 390s Adding debian:GTS_Root_R4.pem 390s Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem 390s Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem 390s Adding debian:GlobalSign_Root_CA.pem 390s Adding debian:GlobalSign_Root_CA_-_R3.pem 390s Adding debian:GlobalSign_Root_CA_-_R6.pem 390s Adding debian:GlobalSign_Root_E46.pem 390s Adding debian:GlobalSign_Root_R46.pem 390s Adding debian:Go_Daddy_Class_2_CA.pem 390s Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem 390s Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem 390s Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem 390s Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem 390s Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem 390s Adding debian:HiPKI_Root_CA_-_G1.pem 390s Adding debian:Hongkong_Post_Root_CA_3.pem 390s Adding debian:ISRG_Root_X1.pem 390s Adding debian:ISRG_Root_X2.pem 390s Adding debian:IdenTrust_Commercial_Root_CA_1.pem 390s Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem 390s Adding debian:Izenpe.com.pem 390s Adding debian:Microsec_e-Szigno_Root_CA_2009.pem 390s Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem 390s Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem 390s Adding debian:NAVER_Global_Root_Certification_Authority.pem 390s Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem 390s Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem 390s Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem 390s Adding debian:QuoVadis_Root_CA_1_G3.pem 390s Adding debian:QuoVadis_Root_CA_2.pem 390s Adding debian:QuoVadis_Root_CA_2_G3.pem 390s Adding debian:QuoVadis_Root_CA_3.pem 390s Adding debian:QuoVadis_Root_CA_3_G3.pem 390s Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem 390s Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem 390s Adding debian:SSL.com_Root_Certification_Authority_ECC.pem 390s Adding debian:SSL.com_Root_Certification_Authority_RSA.pem 390s Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem 390s Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem 390s Adding debian:SZAFIR_ROOT_CA2.pem 390s Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem 390s Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem 390s Adding debian:SecureSign_RootCA11.pem 390s Adding debian:SecureTrust_CA.pem 390s Adding debian:Secure_Global_CA.pem 390s Adding debian:Security_Communication_ECC_RootCA1.pem 390s Adding debian:Security_Communication_RootCA2.pem 390s Adding debian:Security_Communication_RootCA3.pem 390s Adding debian:Security_Communication_Root_CA.pem 390s Adding debian:Starfield_Class_2_CA.pem 390s Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem 390s Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem 390s Adding debian:SwissSign_Gold_CA_-_G2.pem 390s Adding debian:SwissSign_Silver_CA_-_G2.pem 390s Adding debian:T-TeleSec_GlobalRoot_Class_2.pem 390s Adding debian:T-TeleSec_GlobalRoot_Class_3.pem 390s Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem 390s Adding debian:TWCA_Global_Root_CA.pem 390s Adding debian:TWCA_Root_Certification_Authority.pem 390s Adding debian:TeliaSonera_Root_CA_v1.pem 390s Adding debian:Telia_Root_CA_v2.pem 390s Adding debian:TrustAsia_Global_Root_CA_G3.pem 390s Adding debian:TrustAsia_Global_Root_CA_G4.pem 390s Adding debian:Trustwave_Global_Certification_Authority.pem 390s Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem 390s Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem 390s Adding debian:TunTrust_Root_CA.pem 390s Adding debian:UCA_Extended_Validation_Root.pem 390s Adding debian:UCA_Global_G2_Root.pem 390s Adding debian:USERTrust_ECC_Certification_Authority.pem 390s Adding debian:USERTrust_RSA_Certification_Authority.pem 390s Adding debian:XRamp_Global_CA_Root.pem 390s Adding debian:certSIGN_ROOT_CA.pem 390s Adding debian:certSIGN_Root_CA_G2.pem 390s Adding debian:e-Szigno_Root_CA_2017.pem 390s Adding debian:ePKI_Root_Certification_Authority.pem 390s Adding debian:emSign_ECC_Root_CA_-_C3.pem 390s Adding debian:emSign_ECC_Root_CA_-_G3.pem 390s Adding debian:emSign_Root_CA_-_C1.pem 390s Adding debian:emSign_Root_CA_-_G1.pem 390s Adding debian:vTrus_ECC_Root_CA.pem 390s Adding debian:vTrus_Root_CA.pem 390s done. 390s Setting up openjdk-21-jre:armhf (21.0.5+11-1) ... 390s Setting up openjdk-21-jdk-headless:armhf (21.0.5+11-1) ... 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode 390s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode 390s Setting up default-jre-headless (2:1.21-76) ... 390s Setting up apksigner (31.0.2-2) ... 390s Setting up fdroidserver (2.3~a2-1) ... 391s Setting up default-jre (2:1.21-76) ... 391s Setting up default-jdk-headless (2:1.21-76) ... 391s Setting up autopkgtest-satdep (0) ... 431s (Reading database ... 96188 files and directories currently installed.) 431s Removing autopkgtest-satdep (0) ... 437s autopkgtest [22:58:22]: test command1: echo Depends; export LANG=C.UTF-8 ANDROID_HOME=/usr/lib/android-sdk TRAVIS_OS_NAME=osx; fdroid=/usr/bin/fdroid ./tests/run-tests 437s autopkgtest [22:58:22]: test command1: [----------------------- 439s Depends 439s Using ANDROID_HOME=/usr/lib/android-sdk 439s Setting Workspace to /tmp/autopkgtest.BGvKMW/build.5vX/src 439s ============================================================================== 439s run commit hooks 439s ============================================================================== 439s run unit tests 439s + echo_header 'run commit hooks' 439s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src 439s + test -x ./hooks/pre-commit 439s + echo_header 'run unit tests' 439s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/tests 439s + for testcase in $WORKSPACE/tests/*.TestCase 439s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/build.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 439s ++ uname 439s + '[' Linux '!=' Linux ']' 439s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/build.TestCase 441s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/build.TestCase:1119: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 441s newSuite.addTest(unittest.makeSuite(BuildTest)) 441s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 441s INFO:root:Getting source for revision 1.0 441s INFO:root:Creating local.properties file at /tmp/tmp8ljueiap/local.properties 441s DEBUG:root:Removing debuggable flags from /tmp/tmp8ljueiap 441s INFO:root:Scanning source for common problems... 441s INFO:root:Removing shared library at baz.so 441s INFO:root:Ignoring Android AAR library at foo.aar 441s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar 441s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 441s DEBUG:root:Checking /tmp/tmp8ljueiap/mocked.app.id.apk 441s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 441s INFO:root:Getting source for revision 1.0 441s INFO:root:Creating local.properties file at /tmp/tmpjomw5lxc/local.properties 441s DEBUG:root:Removing debuggable flags from /tmp/tmpjomw5lxc 441s INFO:root:Cleaning Maven project... 441s INFO:root:Scanning source for common problems... 441s INFO:root:Removing Android APK file at target/no.apk 441s INFO:root:Building Maven project... 441s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 441s DEBUG:root:Checking /tmp/tmpjomw5lxc/target/no.apk 441s INFO:root:Getting source for revision 1.0 441s INFO:root:Updating local.properties file at /tmp/tmpjomw5lxc/local.properties 441s DEBUG:root:Removing debuggable flags from /tmp/tmpjomw5lxc 441s INFO:root:Cleaning Maven project... 441s INFO:root:Scanning source for common problems... 441s INFO:root:Removing Android APK file at mocked.app.id_1.apk 441s INFO:root:Removing Android APK file at target/no.apk 441s INFO:root:Building Maven project... 441s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 441s DEBUG:root:Checking /tmp/tmpjomw5lxc/target/no.apk 441s .WARNING:root:Android NDK version 'r21e' could not be found! 441s WARNING:root:Configured versions: 441s WARNING:root:Android NDK version 'r21e' could not be found! 441s WARNING:root:Configured versions: 441s INFO:root:Set NDK r21e (21.4.7075529) up 441s INFO:root:Getting source for revision 1.0 441s INFO:root:Creating local.properties file at /tmp/tmp270oiwnn/local.properties 441s DEBUG:root:Removing debuggable flags from /tmp/tmp270oiwnn 441s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 441s DEBUG:root:Checking /tmp/tmp270oiwnn/mocked.app.id.apk 441s .WARNING:root:Android NDK version 'r21e' could not be found! 441s WARNING:root:Configured versions: 441s WARNING:root: r24: /tmp/tmpzpmu95nx/ndk/24.0.8215888 441s INFO:root:Set NDK r21e (24.0.8215888) up 441s INFO:root:Set NDK r21e (21.4.7075529) up 441s INFO:root:Getting source for revision 1.0 441s INFO:root:Creating local.properties file at /tmp/tmpmlwjaa9k/local.properties 441s DEBUG:root:Removing debuggable flags from /tmp/tmpmlwjaa9k 441s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 441s DEBUG:root:Checking /tmp/tmpmlwjaa9k/mocked.app.id.apk 441s .DEBUG:root:Fetched buildserverid from VM: 0123456789abcdef0123456789abcdefcafebabe 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s .INFO:root:Building version 1.2.3 (123) of fake.id 441s INFO:root:Connecting to virtual machine... 441s INFO:root:Preparing server for build... 441s DEBUG:root:rsyncing /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver to 441s INFO:root:Sending srclib 'build/srclib/flutter' 441s DEBUG:root:rsyncing build/srclib/flutter to 441s DEBUG:root:rsyncing build to 441s INFO:root:Starting build... 441s INFO:root:...getting exit status 441s DEBUG:root:retrieved fake.id_123_toolsversion.log 441s INFO:root:Retrieving build output... 441s INFO:root:destroying buildserver after build 441s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 441s INFO:root:Creating log directory 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Creating build directory 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s INFO:root:compared built binary to supplied reference binary successfully 441s INFO:root:supplied reference binary has allowed signer aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:success: info.guardianproject.checkey 441s INFO:root:Finished 441s INFO:root:1 build succeeded 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s INFO:root:compared built binary to supplied reference binary successfully 441s DEBUG:root:removing unsigned/info.guardianproject.checkey_123.apk 441s DEBUG:root:removing unsigned/binaries/info.guardianproject.checkey_123.binary.apk 441s ERROR:root:Could not build app info.guardianproject.checkey: supplied reference binary signed with bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb instead of with ['aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa'] 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s DEBUG:root:removing unsigned/info.guardianproject.checkey_123.apk 441s DEBUG:root:removing unsigned/binaries/info.guardianproject.checkey_123.binary.apk 441s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed 441s ==== detail begin ==== 441s failed 441s ==== detail end ==== 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s INFO:root:compared built binary to supplied reference binary successfully 441s INFO:root:supplied reference binary has allowed signer aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:success: info.guardianproject.checkey 441s INFO:root:Finished 441s INFO:root:1 build succeeded 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s INFO:root:compared built binary to supplied reference binary successfully 441s WARNING:root:Keeping failed build "tmp/info.guardianproject.checkey_123.apk" 441s DEBUG:root:removing tmp/binaries/info.guardianproject.checkey_123.binary.apk 441s ERROR:root:Could not build app info.guardianproject.checkey: supplied reference binary signed with bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb instead of with ['aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa'] 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s WARNING:root:Keeping failed build "tmp/info.guardianproject.checkey_123.apk" 441s DEBUG:root:removing tmp/binaries/info.guardianproject.checkey_123.binary.apk 441s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed 441s ==== detail begin ==== 441s failed 441s ==== detail end ==== 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s .DEBUG:root:Reading 'config.yml' 441s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 441s INFO:root:Creating log directory 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Creating build directory 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s INFO:root:compared built binary to supplied reference binary successfully 441s ERROR:root:Could not build app info.guardianproject.checkey due to unknown error: Traceback (most recent call last): 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/build.py", line 1275, in main 441s used_key = common.apk_signer_fingerprint(of) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py", line 3338, in apk_signer_fingerprint 441s cert_encoded = get_first_signer_certificate(apk_path) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py", line 3264, in get_first_signer_certificate 441s apkobject = get_androguard_APK(apkpath) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py", line 2720, in get_androguard_APK 441s return APK(apkfile, skip_analysis=skip_analysis) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py", line 272, in __init__ 441s self.zip = zipfile.ZipFile(filename, mode="r") 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/usr/lib/python3.12/zipfile/__init__.py", line 1349, in __init__ 441s self._RealGetContents() 441s File "/usr/lib/python3.12/zipfile/__init__.py", line 1416, in _RealGetContents 441s raise BadZipFile("File is not a zip file") 441s zipfile.BadZipFile: File is not a zip file 441s 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s DEBUG:root:removing unsigned/info.guardianproject.checkey_123.apk 441s DEBUG:root:removing unsigned/binaries/info.guardianproject.checkey_123.binary.apk 441s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed 441s ==== detail begin ==== 441s failed 441s ==== detail end ==== 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s INFO:root:compared built binary to supplied reference binary successfully 441s ERROR:root:Could not build app info.guardianproject.checkey due to unknown error: Traceback (most recent call last): 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/build.py", line 1275, in main 441s used_key = common.apk_signer_fingerprint(of) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py", line 3338, in apk_signer_fingerprint 441s cert_encoded = get_first_signer_certificate(apk_path) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py", line 3264, in get_first_signer_certificate 441s apkobject = get_androguard_APK(apkpath) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py", line 2720, in get_androguard_APK 441s return APK(apkfile, skip_analysis=skip_analysis) 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py", line 272, in __init__ 441s self.zip = zipfile.ZipFile(filename, mode="r") 441s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 441s File "/usr/lib/python3.12/zipfile/__init__.py", line 1349, in __init__ 441s self._RealGetContents() 441s File "/usr/lib/python3.12/zipfile/__init__.py", line 1416, in _RealGetContents 441s raise BadZipFile("File is not a zip file") 441s zipfile.BadZipFile: File is not a zip file 441s 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:Getting git vcs interface for 441s DEBUG:root:Checking info.guardianproject.checkey:123 441s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 441s WARNING:root:Keeping failed build "tmp/info.guardianproject.checkey_123.apk" 441s DEBUG:root:removing tmp/binaries/info.guardianproject.checkey_123.binary.apk 441s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed 441s ==== detail begin ==== 441s failed 441s ==== detail end ==== 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s INFO:root:Build for app info.guardianproject.checkey:123 failed 441s INFO:root:Finished 441s INFO:root:1 build failed 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s DEBUG:root:skip deploying full build logs: not enabled in config 441s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 441s ..........DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 441s INFO:root:Getting source for revision master 441s INFO:root:Creating local.properties file at build/local.properties 441s DEBUG:root:Removing debuggable flags from build 441s DEBUG:root:scanner is configured to use signature data from: 'suss' 441s ERROR:root:Found Java JAR file at libs/android-support-v4r11.jar 441s INFO:root:Getting source for revision master 441s INFO:root:Updating local.properties file at build/local.properties 441s DEBUG:root:Removing debuggable flags from build 441s INFO:root:Collecting prebuilt libraries 441s INFO:root:...installing extlib android/android-support-v4r11.jar 441s INFO:root:Ignoring Java JAR file at libs/android-support-v4r11.jar 441s . 441s ---------------------------------------------------------------------- 441s Ran 19 tests in 0.446s 441s 441s OK 441s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 441s now run `fdroid build --onserver` 441s FakeFDroidPopen ['sudo', 'passwd', '--lock', 'root'] {} 441s FakeFDroidPopen ['sudo', 'SUDO_FORCE_REMOVE=yes', 'dpkg', '--purge', 'sudo'] {} 441s FakeFDroidPopen ['sudo', 'passwd', '--lock', 'root'] {} 441s FakeFDroidPopen ['sudo', 'SUDO_FORCE_REMOVE=yes', 'dpkg', '--purge', 'sudo'] {} 441s chan.exec_command bash --login -c "/home/fake/fdroidserver/fdroid build --on-server --verbose --refresh-scanner --skip-scan --no-tarball fake.id:123" 441s + for testcase in $WORKSPACE/tests/*.TestCase 441s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/checkupdates.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 441s ++ uname 441s + '[' Linux '!=' Linux ']' 441s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/checkupdates.TestCase 442s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/checkupdates.TestCase:336: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 442s newSuite.addTest(unittest.makeSuite(CheckupdatesTest)) 442s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:4530: DeprecationWarning: ast.Num is deprecated and will be removed in Python 3.14; use ast.Constant instead 442s if isinstance(node, ast.Num): # 442s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:4531: DeprecationWarning: Attribute n is deprecated and will be removed in Python 3.14; use value instead 442s return node.n 442s DEBUG:root:Applied vercode operation: 10109 -> 101091 442s DEBUG:root:Applied vercode operation: 10109 -> 101093 442s DEBUG:root:...updating - old vercode=101083, new vercode=101093 442s INFO:root:...updating to version 1.1.9 (101093) 442s INFO:root:...auto-generating build for 1.1.9 442s INFO:root:...auto-generating build for 1.1.9 442s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 442s INFO:root:...updating to version 1.1.9 (10109) 442s INFO:root:...auto-generating build for 1.1.9 442s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 442s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 442s INFO:root:...updating to version 1.1.9 (10109) 442s INFO:root:...auto-generating build for 1.1.9.10109-fdroid 442s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 442s .DEBUG:root:...requesting https://a.net/b.txt 442s DEBUG:root:...requesting https://d.net/e.txt 442s ..DEBUG:root:...requesting https://a.net/b.txt 442s DEBUG:root:...requesting https://d.net/e.txt 442s INFO:root:Version 1.1.9-beta for loop.starts.shooting is ignored 442s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 442s .DEBUG:root:All tags: 1.1.9,1.1.8 442s DEBUG:root:Check tag: '1.1.9' 442s DEBUG:root:UpdateCheckData found version 1.1.9 (10109) 442s DEBUG:root:Check tag: '1.1.8' 442s DEBUG:root:UpdateCheckData found version 1.1.9 (10109) 442s DEBUG:root:All tags: 1.1.9,1.1.8 442s DEBUG:root:Check tag: '1.1.9' 442s DEBUG:root:UpdateCheckData found version 1.1.0 (10109) 442s DEBUG:root:Check tag: '1.1.8' 442s DEBUG:root:UpdateCheckData found version 1.1.0 (10109) 442s DEBUG:root:All tags: 1.1.9,1.1.8 442s DEBUG:root:Check tag: '1.1.9' 442s DEBUG:root:UpdateCheckData found version 1.1.9 (10109) 442s DEBUG:root:Check tag: '1.1.8' 442s DEBUG:root:UpdateCheckData found version 1.1.8 (10109) 442s DEBUG:root:All tags: Android-1.1.0,1.1.8 442s DEBUG:root:Check tag: 'Android-1.1.0' 442s DEBUG:root:UpdateCheckData found version 1.1.0 (10109) 442s DEBUG:root:Check tag: '1.1.8' 442s DEBUG:root:UpdateCheckData regex Android-([\d.]+) for version name has no match in tag 1.1.8 442s DEBUG:root:All tags: Android-1.1.0+1 442s DEBUG:root:Check tag: 'Android-1.1.0+1' 442s DEBUG:root:UpdateCheckData found version 1.1.0 (1) 442s DEBUG:root:All tags: 2 442s DEBUG:root:Check tag: '2' 442s DEBUG:root:UpdateCheckData found version 2 (2) 442s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 442s INFO:root:...updating to version 1.1.9 (10109) 442s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 442s INFO:root:...updating to version 1.1.9 (10109) 442s INFO:root:...auto-generating build for 1.1.9 442s . 442s ---------------------------------------------------------------------- 442s Ran 9 tests in 0.022s 442s 442s OK 442s + for testcase in $WORKSPACE/tests/*.TestCase 442s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 442s ++ uname 442s + '[' Linux '!=' Linux ']' 442s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase 443s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase:3344: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 443s newSuite.addTest(unittest.makeSuite(CommonTest)) 443s DEBUG:root:> /bin/sh -c export 444s ...DEBUG:root:Using APK Signature v2 444s DEBUG:root:Using JAR Signature 444s DEBUG:root:Using JAR Signature 444s .DEBUG:root:Using APK Signature v2 444s DEBUG:root:Using JAR Signature 444s DEBUG:root:Using JAR Signature 444s ..CRITICAL:root:'repo_keyalias' not found in config.yml! 444s CRITICAL:root:'keystore' not found in config.yml! 444s CRITICAL:root:'keystorepass' not found in config.yml! 444s CRITICAL:root:'keypass' not found in config.yml! 444s ../tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase:2447: DeprecationWarning: pkg_resources is deprecated as an API. See https://setuptools.pypa.io/en/latest/pkg_resources.html 444s import pkg_resources 444s .s./tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:4530: DeprecationWarning: ast.Num is deprecated and will be removed in Python 3.14; use ast.Constant instead 444s if isinstance(node, ast.Num): # 444s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:4531: DeprecationWarning: Attribute n is deprecated and will be removed in Python 3.14; use value instead 444s return node.n 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)! 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s WARNING:root:config.py is deprecated, use config.yml 444s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:Reading 'config.yml' 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .........DEBUG:root:['rsync', '--archive', '--delete-after', '--safe-links', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ssh/id_rsa', 'repo/com.example.app_4711.log.gz', 'example.com:/var/www/fdroid/repo/'] 444s DEBUG:root:deployed process log repo/com.example.app_4711.log.gz to example.com:/var/www/fdroid/ 444s DEBUG:root:['rsync', '--archive', '--delete-after', '--safe-links', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ssh/id_rsa', 'repo/com.example.app_4711.log.gz', 'example.com:/var/www/fbot/repo/'] 444s DEBUG:root:deployed process log repo/com.example.app_4711.log.gz to example.com:/var/www/fbot/ 444s .DEBUG:root:skip deploying full build logs: not enabled in config 444s DEBUG:root:skip deploying full build logs: not enabled in config 444s DEBUG:root:skip deploying full build logs: not enabled in config 444s DEBUG:root:deployed process log repo/status/running.json to example.com:/var/www/fbot/ 444s DEBUG:root:deployed process log repo/status/running.json to example.com:/var/www/fbot/ 444s DEBUG:root:deployed process log repo/status/fakesubcommand.json to example.com:/var/www/fbot/ 444s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s DEBUG:root:> sh -c echo stdout message && echo stderr message 1>&2 444s DEBUG:root:> sh -c echo stdout message && echo stderr message 1>&2 444s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s ..INFO:root:Using /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/ANDROID_HOME/build-tools/30.0.3/apksigner 444s ..s....DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 444s ..DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s ...ERROR:androguard.axml:This does not look like an AXML file. header size does not equal 8! header size = 8308 445s ERROR:androguard.axml:This does not look like an AXML file. header size does not equal 8! header size = 8308 445s ERROR:androguard.apk:Error while parsing AndroidManifest.xml - is the file valid? 445s ...DEBUG:root:Reading 'config.yml' 445s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s ...INFO:root:[PosixPath('source-files/cn.wildfirechat.chat/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/settings.gradle'), PosixPath('source-files/cn.wildfirechat.chat/avenginekit/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/chat/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/client/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/client/src/main/AndroidManifest.xml'), PosixPath('source-files/cn.wildfirechat.chat/emojilibrary/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/gradle/build_libraries.gradle'), PosixPath('source-files/cn.wildfirechat.chat/imagepicker/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/mars-core-release/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/push/build.gradle')] 445s INFO:root:[PosixPath('source-files/com.anpmech.launcher/build.gradle'), PosixPath('source-files/com.anpmech.launcher/settings.gradle'), PosixPath('source-files/com.anpmech.launcher/app/build.gradle'), PosixPath('source-files/com.anpmech.launcher/app/src/main/AndroidManifest.xml')] 445s INFO:root:[PosixPath('source-files/org.tasks/build.gradle'), PosixPath('source-files/org.tasks/build.gradle.kts'), PosixPath('source-files/org.tasks/settings.gradle.kts'), PosixPath('source-files/org.tasks/app/build.gradle.kts'), PosixPath('source-files/org.tasks/buildSrc/build.gradle.kts')] 445s INFO:root:[PosixPath('source-files/ut.ewh.audiometrytest/build.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/settings.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/app/build.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/app/src/main/AndroidManifest.xml')] 445s INFO:root:[PosixPath('source-files/org.noise_planet.noisecapture/settings.gradle'), PosixPath('source-files/org.noise_planet.noisecapture/app/build.gradle'), PosixPath('source-files/org.noise_planet.noisecapture/sosfilter/build.gradle')] 445s ....WARNING:root:config.py is deprecated, use config.yml 445s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s .DEBUG:root:Reading 'config.yml' 445s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s .DEBUG:root:Reading 'config.yml' 445s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s ......sDEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s .........DEBUG:root:Reading 'config.yml' 445s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 445s .....DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml' 445s DEBUG:root:..got package=org.fdroid.fdroid, version=0.94-test, vercode=940 445s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/avenginekit/build.gradle' 445s DEBUG:root:..got package=None, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/build.gradle' 445s DEBUG:root:..got package=None, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/client/build.gradle' 445s DEBUG:root:..got package=None, version=1.0, vercode=1 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/client/src/main/AndroidManifest.xml' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/emojilibrary/build.gradle' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/gradle/build_libraries.gradle' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/imagepicker/build.gradle' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/mars-core-release/build.gradle' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/push/build.gradle' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/settings.gradle' 445s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/chat/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/pagerIndicator/src/main/AndroidManifest.xml' 445s DEBUG:root:..got package=com.viewpagerindicator, version=2.4.1, vercode=65 445s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/pagerIndicator/build.gradle' 445s DEBUG:root:..got package=com.viewpagerindicator, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/oneSheeld/src/main/AndroidManifest.xml' 445s DEBUG:root:..got package=com.integreight.onesheeld, version=None, vercode=None 445s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/oneSheeld/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/dev.patrickgold.florisboard/app/build.gradle.kts' 445s DEBUG:root:Parsing manifest at 'source-files/com.ubergeek42.WeechatAndroid/app/build.gradle.kts' 445s DEBUG:root:..got package=None, version=1.8.1, vercode=10801 445s DEBUG:root:Parsing manifest at 'source-files/com.ubergeek42.WeechatAndroid/app/src/main/res/values/strings.xml' 445s WARNING:root:Problem with xml at 'source-files/com.ubergeek42.WeechatAndroid/app/src/main/res/values/strings.xml' 445s .DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml' 445s DEBUG:root:..got package=org.fdroid.fdroid, version=0.94-test, vercode=940 445s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle' 445s DEBUG:root:..got package=org.fdroid.fdroid, version=None, vercode=None 445s .DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml' 445s DEBUG:root:..got package=None, version=0.94-test, vercode=940 445s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/eu.siacs.conversations/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.nextcloud.client/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.nextcloud.client/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/at.bitfire.davdroid/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.github.jameshnsears.quoteunquote/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/com.jens.automation2/build.gradle' 445s DEBUG:root:Parsing manifest at 'source-files/de.varengold.activeTAN/build.gradle' 445s ...........INFO:root:Getting source for revision master 445s INFO:root:Creating local.properties file at /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/source-files/fdroid/fdroidclient/local.properties 445s DEBUG:root:Removing debuggable flags from /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/source-files/fdroid/fdroidclient 445s INFO:root:Changing the version name 445s INFO:root:Changing the version code 445s .DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 447s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 447s DEBUG:root:> git rev-parse --show-toplevel 447s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 447s DEBUG:root:> git checkout -f 0.3 447s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 447s DEBUG:root:> git clean -dffx 447s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 447s DEBUG:root:> git rev-parse --show-toplevel 448s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 448s DEBUG:root:> git submodule foreach --recursive git reset --hard 448s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 448s DEBUG:root:> git reset --hard 448s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 448s DEBUG:root:> git submodule foreach --recursive git clean -dffx 448s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 448s DEBUG:root:> git clean -dffx 448s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 448s DEBUG:root:> git checkout -f 0.3 448s DEBUG:root:Directory: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/build/org.fdroid.ci.test.app 448s DEBUG:root:> git clean -dffx 448s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 448s INFO:root:Getting source for revision master 448s INFO:root:Collecting source libraries 448s DEBUG:root:Removing debuggable flags from /tmp/tmpp0hczo_p/build/srclib/FakeSrcLib 448s INFO:root:Creating local.properties file at /tmp/tmpp0hczo_p/build/com.example/local.properties 448s INFO:root:Creating local.properties file at /tmp/tmpp0hczo_p/build/com.example/baz/local.properties 448s INFO:root:Creating local.properties file at /tmp/tmpp0hczo_p/build/com.example/baz/bar/local.properties 448s DEBUG:root:Removing debuggable flags from /tmp/tmpp0hczo_p/build/com.example/baz/bar 448s INFO:root:Running 'prebuild' commands in /tmp/tmpp0hczo_p/build/com.example/baz/bar 448s DEBUG:root:Directory: /tmp/tmpp0hczo_p/build/com.example/baz/bar 448s DEBUG:root:> bash -e -u -o pipefail -x -c -- test -d /tmp/tmpp0hczo_p/build/srclib/FakeSrcLib/testdirshouldexist 449s ..INFO:root:Cleaned build.gradle of keysigning configs at source-files/com.seafile.seadroid2/app/build.gradle 449s INFO:root:Cleaned build.gradle of keysigning configs at source-files/eu.siacs.conversations/build.gradle 449s INFO:root:Cleaned build.gradle of keysigning configs at source-files/open-keychain/open-keychain/OpenKeychain/build.gradle 449s INFO:root:Cleaned build.gradle.kts of keysigning configs at source-files/org.tasks/app/build.gradle.kts 449s INFO:root:Cleaned build.gradle of keysigning configs at source-files/osmandapp/osmand/build.gradle 449s INFO:root:Cleaned build.gradle of keysigning configs at source-files/ut.ewh.audiometrytest/app/build.gradle 449s .s..DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 449s .DEBUG:root:skip deploying full build logs: not enabled in config 449s .DEBUG:root:skip deploying full build logs: not enabled in config 449s DEBUG:root:skip deploying full build logs: not enabled in config 449s .DEBUG:root:Getting srclib vcs interface for TransportsRennes 449s .WARNING:root:config.py is deprecated, use config.yml 449s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 449s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 449s DOES NOT VERIFY 449s ERROR: Missing META-INF/MANIFEST.MF 449s ERROR:root: 449s /tmp/tmpx_zlaohv/urzip-release-unsigned.apk: 449s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpx_zlaohv/urzip-release-unsigned.apk --out /tmp/tmpx_zlaohv/urzip-release.apk 451s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpx_zlaohv/duplicate.permisssions_9999999-unsigned.apk --out /tmp/tmpx_zlaohv/duplicate.permisssions_9999999.apk 453s DOES NOT VERIFY 453s ERROR: No JAR signatures 453s ERROR:root: 453s /tmp/tmpx_zlaohv/minimal_targetsdk_30_unsigned.apk: 453s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpx_zlaohv/minimal_targetsdk_30_unsigned.apk --out /tmp/tmpx_zlaohv/minimal_targetsdk_30.apk 455s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpx_zlaohv/no_targetsdk_minsdk30_unsigned.apk --out /tmp/tmpx_zlaohv/no_targetsdk_minsdk30_signed.apk 457s DOES NOT VERIFY 457s ERROR: No JAR signatures 457s ERROR:root: 457s /tmp/tmpx_zlaohv/no_targetsdk_minsdk1_unsigned.apk: 457s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpx_zlaohv/no_targetsdk_minsdk1_unsigned.apk --out /tmp/tmpx_zlaohv/no_targetsdk_minsdk1_signed.apk 459s .WARNING:root:config.py is deprecated, use config.yml 459s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 459s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 459s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp8qmt1da5/urzip-release-unsigned.apk --out /tmp/tmp8qmt1da5/urzip-release.apk 460s .WARNING:root:config.py is deprecated, use config.yml 460s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 460s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 460s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpyvww5k3f/urzip-release-unsigned.apk --out /tmp/tmpyvww5k3f/urzip-release.apk 460s .WARNING:root:config.py is deprecated, use config.yml 460s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 460s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 460s DEBUG:root:> /usr/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_signjarr00d6uxu/testy.jar sova -keypass:env FDROID_KEY_PASS 461s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase:511: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex/testy.jar'> 461s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 461s ResourceWarning: Enable tracemalloc to get the object allocation traceback 461s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase:511: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_signjarr00d6uxu/testy.jar'> 461s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 461s ResourceWarning: Enable tracemalloc to get the object allocation traceback 461s DEBUG:root:> /usr/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_signjarr00d6uxu/guardianproject.jar sova -keypass:env FDROID_KEY_PASS 462s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase:511: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex/guardianproject.jar'> 462s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 462s ResourceWarning: Enable tracemalloc to get the object allocation traceback 462s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/common.TestCase:511: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_signjarr00d6uxu/guardianproject.jar'> 462s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 462s ResourceWarning: Enable tracemalloc to get the object allocation traceback 462s ...CRITICAL:root:Android SDK path 'nothinghere' does not exist! 462s .ERROR:root:'sdk_path' not set in config.yml! 462s .CRITICAL:root:Android SDK path '/tmp/tmpa55ue0u9/testfile' is not a directory! 463s .CRITICAL:root:Android SDK path '/tmp/tmpd4qqukv2/non_existent' does not exist! 463s .DEBUG:root:Local Android SDK only has outdated apksigner versions 463s ERROR:root:'sdk_path' not set in config.yml! 463s .INFO:root:Using /tmp/tmpr9rb8owt/build-tools/30.0.0/apksigner 463s .DEBUG:root:Local Android SDK only has outdated apksigner versions 463s .INFO:root:Using /tmp/tmpi02xg7f6/build-tools/30.0.0/apksigner 463s .DEBUG:root:Directory: /tmp/tmplslhabhq 463s DEBUG:root:> git rev-parse --show-toplevel 463s DEBUG:root:Directory: /tmp/tmplslhabhq 463s DEBUG:root:> git rev-parse --show-toplevel 463s .DEBUG:root:Directory: /tmp/tmpzj3_c8ch 463s DEBUG:root:> git rev-parse --show-toplevel 463s .WARNING:root:config.py is deprecated, use config.yml 463s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 463s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 468s DOES NOT VERIFY 468s ERROR: JAR signer CERT.RSA: JAR signature META-INF/CERT.RSA did not verify against META-INF/CERT.SF 468s ERROR:root: 468s urzip-badcert.apk: 469s DOES NOT VERIFY 469s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 469s ERROR:root: 469s urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 469s 469s DOES NOT VERIFY 469s ERROR: Missing META-INF/MANIFEST.MF 469s ERROR:root: 469s urzip-release-unsigned.apk: 469s .WARNING:root:config.py is deprecated, use config.yml 469s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 469s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 471s INFO:root:...successfully verified 472s INFO:root:...successfully verified 472s /usr/lib/python3.12/zipfile/__init__.py:1607: UserWarning: Duplicate name: 'META-INF/MANIFEST.MF' 472s return self._open_to_write(zinfo, force_zip64=force_zip64) 472s /usr/lib/python3.12/zipfile/__init__.py:1607: UserWarning: Duplicate name: 'META-INF/CERT.SF' 472s return self._open_to_write(zinfo, force_zip64=force_zip64) 472s /usr/lib/python3.12/zipfile/__init__.py:1607: UserWarning: Duplicate name: 'META-INF/CERT.RSA' 472s return self._open_to_write(zinfo, force_zip64=force_zip64) 472s DOES NOT VERIFY 472s ERROR: Duplicate entry: META-INF/MANIFEST.MF 472s ERROR: Duplicate entry: META-INF/CERT.SF 472s ERROR: Duplicate entry: META-INF/CERT.RSA 472s ERROR:root: 472s /tmp/tmpwzmb4m7r/urzip-twosig.apk: 473s INFO:root:...successfully verified 473s .WARNING:root:config.py is deprecated, use config.yml 473s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 473s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 474s DEBUG:root:JAR signature verified: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex/testy.jar 475s DEBUG:root:JAR signature verified: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex/guardianproject.jar 475s .WARNING:root:config.py is deprecated, use config.yml 475s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 475s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 475s DEBUG:root:> /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 477s DEBUG:root:JAR signature verified: repo/entry.jar 477s .WARNING:root:config.py is deprecated, use config.yml 477s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 477s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 479s .WARNING:root:config.py is deprecated, use config.yml 479s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 479s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 480s DEBUG:root:JAR signature verified: bad-unicode-πÇÇ现代通用字-български-عربي1.apk 481s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_1.apk 482s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_2.apk 483s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_3.apk 484s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_4.apk 484s DEBUG:root:JAR signature verified: org.dyndns.fules.ck_20.apk 485s DEBUG:root:JAR signature verified: urzip.apk 486s DEBUG:root:JAR signature verified: urzip-release.apk 488s ..ERROR:root:Conflicting config files! Using config.yml, ignoring config.py! 488s DEBUG:root:Reading 'config.yml' 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .WARNING:root:config.py is deprecated, use config.yml 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .DEBUG:root:Reading 'config.yml' 488s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 488s apksigner: yml 488s 488s keypass: mysecretpassword 488s 488s 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .DEBUG:root:Reading 'config.yml' 488s .DEBUG:root:Reading 'config.yml' 488s .DEBUG:root:Reading 'config.yml' 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .DEBUG:root:Reading 'config.yml' 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .DEBUG:root:Reading 'config.yml' 488s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)! 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .DEBUG:root:Reading 'config.yml' 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s ..WARNING:root:config.py is deprecated, use config.yml 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s WARNING:root:config.py is deprecated, use config.yml 488s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s ..DEBUG:root:Reading 'config.yml' 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s DEBUG:root:Reading 'config.yml' 488s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)! 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .WARNING:root:config.py is deprecated, use config.yml 488s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .WARNING:root:config.py is deprecated, use config.yml 488s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 488s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 488s .....DEBUG:root:Using JAR Signature 488s DEBUG:root:Using APK Signature v3 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using APK Signature v3 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using APK Signature v2 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using APK Signature v2 488s DEBUG:root:Using APK Signature v2 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using APK Signature v2 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s .DEBUG:root:Using APK Signature v3 488s DEBUG:root:Using APK Signature v3 488s DEBUG:root:Using APK Signature v3 488s DEBUG:root:Using APK Signature v2 488s .DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s DEBUG:root:Using JAR Signature 488s .ERROR:root:No signing certificates found in signindex/unsigned.jar 488s .ss 488s ---------------------------------------------------------------------- 488s Ran 155 tests in 44.603s 488s 488s OK (skipped=6) 488s + for testcase in $WORKSPACE/tests/*.TestCase 488s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/deploy.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 488s ++ uname 488s + '[' Linux '!=' Linux ']' 488s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/deploy.TestCase 489s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/deploy.TestCase:1484: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 489s newSuite.addTest(unittest.makeSuite(DeployTest)) 489s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/deploy.TestCase:1485: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 489s newSuite.addTest(unittest.makeSuite(GitHubReleasesTest)) 489s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/deploy.TestCase:1486: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 489s newSuite.addTest(unittest.makeSuite(Test_UploadToGithubReleasesRepo)) 489s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 489s DEBUG:root:using Apache libcloud to sync with bucket 489s DEBUG:root: uploading "/tmp/tmpnqw0ttcg/repo/Sym.apk"... 489s INFO:root: uploading repo/Sym.apk to s3://bucket/fdroid/repo/Sym.apk 489s DEBUG:root: uploading "/tmp/tmpnqw0ttcg/repo/altstore-index.json"... 489s INFO:root: uploading repo/altstore-index.json to s3://bucket/fdroid/repo/altstore-index.json 489s WARNING:root: 489s WARNING:root: 489s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 489s DEBUG:root:using Apache libcloud to sync with bucket 489s DEBUG:root: uploading "/tmp/tmps6c9vib_/repo/altstore-index.json"... 489s INFO:root: uploading repo/altstore-index.json to s3://bucket/fdroid/repo/altstore-index.json 489s WARNING:root: 489s WARNING:root: 489s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 489s DEBUG:root:Using s3cmd to sync with: bucket 489s DEBUG:root:Creating ".fdroid-deploy-s3cfg" for configuring s3cmd. 489s DEBUG:root:s3cmd sync indexes repo to s3://bucket/fdroid/ and delete 489s DEBUG:root:s3cmd sync new files in repo to s3://bucket/fdroid/ 489s DEBUG:root:Running first pass with MD5 checking disabled 489s DEBUG:root:s3cmd sync all files in repo to s3://bucket/fdroid/ 489s DEBUG:root:s3cmd sync indexes repo to s3://bucket/fdroid/ and delete 489s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 489s DEBUG:root:Using s3cmd to sync with: bucket 489s DEBUG:root:Creating ".fdroid-deploy-s3cfg" for configuring s3cmd. 489s DEBUG:root:s3cmd sync indexes repo to s3://bucket/fdroid/ and delete 489s DEBUG:root:s3cmd syncs indexes from repo to s3://bucket/fdroid/ and deletes removed 489s .ssDEBUG:root:ipfs_cid not found, skipping CIDv1 generation 489s DEBUG:git.cmd:Popen(['git', 'init', '--initial-branch=master', '--bare'], cwd=/tmp/tmptw68zpkz/remote, universal_newlines=False, shell=None, istream=None) 489s DEBUG:git.cmd:Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=False, shell=None, istream=None) 489s DEBUG:git.cmd:Popen(['git', 'switch', '--orphan', 'full'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=False, shell=None, istream=None) 489s DEBUG:root:rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --quiet /tmp/tmptw68zpkz/repo/ /tmp/tmptw68zpkz/git-mirror/fdroid/repo/ 489s DEBUG:git.cmd:Popen(['git', 'remote', 'add', '--', 'tmptw68zpkz', '/tmp/tmptw68zpkz/remote'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=False, shell=None, istream=None) 489s INFO:root:Mirroring to: /tmp/tmptw68zpkz/remote 489s DEBUG:root:Adding all files to git mirror 489s DEBUG:git.cmd:Popen(['git', 'add', '--all'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=False, shell=None, istream=None) 489s DEBUG:root:Committing files into git mirror 489s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=False, shell=None, istream=) 489s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=False, shell=None, istream=) 489s DEBUG:root:Pushing to /tmp/tmptw68zpkz/remote 489s DEBUG:git.cmd:Popen(['git', 'push', '--porcelain', '--force', '--set-upstream', '--', 'tmptw68zpkz', 'full:master'], cwd=/tmp/tmptw68zpkz/git-mirror, universal_newlines=True, shell=None, istream=None) 489s DEBUG:root:/tmp/tmptw68zpkz/remote: [new branch] 489s 489s DEBUG:git.cmd:Popen(['git', 'clone', '-v', '--', '/tmp/tmptw68zpkz/remote', '/tmp/tmptw68zpkz/verify'], cwd=/tmp/tmptw68zpkz/remote, universal_newlines=True, shell=None, istream=None) 489s DEBUG:git.repo.base:Cmd(['git', 'clone', '-v', '--', '/tmp/tmptw68zpkz/remote', '/tmp/tmptw68zpkz/verify'])'s unused stdout: 489s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 489s DEBUG:git.cmd:Popen(['git', 'init', '--initial-branch=master', '--bare'], cwd=/tmp/tmpewixoddq/remote, universal_newlines=False, shell=None, istream=None) 489s DEBUG:git.cmd:Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/tmpewixoddq/git-mirror, universal_newlines=False, shell=None, istream=None) 489s DEBUG:git.cmd:Popen(['git', 'switch', '--orphan', 'index_only'], cwd=/tmp/tmpewixoddq/git-mirror, universal_newlines=False, shell=None, istream=None) 489s DEBUG:root:rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --quiet /tmp/tmpewixoddq/repo/altstore-index.json /tmp/tmpewixoddq/repo/altstore-index.json.asc /tmp/tmpewixoddq/repo/entry.jar /tmp/tmpewixoddq/repo/entry.json /tmp/tmpewixoddq/repo/entry.json.asc /tmp/tmpewixoddq/repo/index-v1.jar /tmp/tmpewixoddq/repo/index-v1.json /tmp/tmpewixoddq/repo/index-v1.json.asc /tmp/tmpewixoddq/repo/index-v2.json /tmp/tmpewixoddq/repo/index-v2.json.asc /tmp/tmpewixoddq/repo/index.css /tmp/tmpewixoddq/repo/index.html /tmp/tmpewixoddq/repo/index.jar /tmp/tmpewixoddq/repo/index.png /tmp/tmpewixoddq/repo/index.xml /tmp/tmpewixoddq/git-mirror/fdroid/repo/ 489s DEBUG:git.cmd:Popen(['git', 'remote', 'add', '--', 'tmpewixoddq', '/tmp/tmpewixoddq/remote'], cwd=/tmp/tmpewixoddq/git-mirror, universal_newlines=False, shell=None, istream=None) 489s INFO:root:Mirroring to: /tmp/tmpewixoddq/remote 489s DEBUG:root:Committing files into git mirror 489s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpewixoddq/git-mirror, universal_newlines=False, shell=None, istream=) 489s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch'], cwd=/tmp/tmpewixoddq/git-mirror, universal_newlines=False, shell=None, istream=) 489s DEBUG:root:Pushing to /tmp/tmpewixoddq/remote 489s DEBUG:git.cmd:Popen(['git', 'push', '--porcelain', '--force', '--set-upstream', '--', 'tmpewixoddq', 'index_only:master'], cwd=/tmp/tmpewixoddq/git-mirror, universal_newlines=True, shell=None, istream=None) 489s DEBUG:root:/tmp/tmpewixoddq/remote: [new branch] 489s 489s DEBUG:git.cmd:Popen(['git', 'clone', '-v', '--', '/tmp/tmpewixoddq/remote', '/tmp/tmpewixoddq/verify'], cwd=/tmp/tmpewixoddq/remote, universal_newlines=True, shell=None, istream=None) 489s DEBUG:git.repo.base:Cmd(['git', 'clone', '-v', '--', '/tmp/tmpewixoddq/remote', '/tmp/tmpewixoddq/verify'])'s unused stdout: 489s .INFO:root:rsyncing repo to url 489s .INFO:root:rsyncing repo to url 489s INFO:root:['rsync', '--archive', '--delete-after', '--safe-links', '--verbose', '--quiet', 'repo/altstore-index.json', 'url/repo/'] 491s .INFO:root:rsyncing repo to example.com:/var/www/fdroid 491s .INFO:root:rsyncing repo to example.com:/var/www/fdroid 491s INFO:root:['rsync', '--archive', '--delete-after', '--safe-links', '--quiet', 'repo/altstore-index.json', 'repo/altstore-index.json.asc', 'repo/entry.jar', 'repo/entry.json', 'repo/entry.json.asc', 'repo/index-v1.jar', 'repo/index-v1.json', 'repo/index-v1.json.asc', 'repo/index-v2.json', 'repo/index-v2.json.asc', 'repo/index.css', 'repo/index.html', 'repo/index.jar', 'repo/index.png', 'repo/index.xml', 'example.com:/var/www/fdroid/repo/'] 491s ..INFO:root:rsyncing archive to example.com:/var/www/fdroid 491s .INFO:root:rsyncing archive to example.com:/var/www/fdroid 491s INFO:root:['rsync', '--archive', '--delete-after', '--safe-links', '--verbose', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ./id_rsa', 'archive/altstore-index.json', 'archive/altstore-index.json.asc', 'archive/entry.jar', 'archive/entry.json', 'archive/entry.json.asc', 'archive/index-v1.jar', 'archive/index-v1.json', 'archive/index-v1.json.asc', 'archive/index-v2.json', 'archive/index-v2.json.asc', 'archive/index.css', 'archive/index.html', 'archive/index.jar', 'archive/index.png', 'archive/index.xml', 'example.com:/var/www/fdroid/archive/'] 491s .INFO:root:rsyncing repo to url0/fdroid 491s INFO:root:rsyncing repo to url1/fdroid 491s ....ERROR:root:Malformed serverwebroot line: f@b.ar::/path/to/fdroid 491s .ERROR:root:serverwebroot: path does not end with "fdroid", perhaps you meant one of these: 491s ssh://nope/fdroid 491s ssh://fdroid 491s .ERROR:root:serverwebroot: path does not end with "fdroid", perhaps you meant one of these: 491s url/fdroid 491s fdroid 491s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 491s DEBUG:git.cmd:Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/tmp6zdhhgj5/local, universal_newlines=False, shell=None, istream=None) 491s DEBUG:git.cmd:Popen(['git', 'init', '--initial-branch=master', '--bare'], cwd=/tmp/tmp6zdhhgj5/remote, universal_newlines=False, shell=None, istream=None) 491s DEBUG:git.cmd:Popen(['git', 'remote', 'add', '--', 'tmp6zdhhgj5', '/tmp/tmp6zdhhgj5/remote'], cwd=/tmp/tmp6zdhhgj5/local, universal_newlines=False, shell=None, istream=None) 491s INFO:root:Mirroring to: /tmp/tmp6zdhhgj5/remote 491s DEBUG:root:Committing files into git mirror 491s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmp6zdhhgj5/local, universal_newlines=False, shell=None, istream=) 491s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch'], cwd=/tmp/tmp6zdhhgj5/local, universal_newlines=False, shell=None, istream=) 491s DEBUG:root:Pushing to /tmp/tmp6zdhhgj5/remote 491s DEBUG:git.cmd:Popen(['git', 'version'], cwd=/tmp/tmp6zdhhgj5/local, universal_newlines=False, shell=None, istream=None) 491s DEBUG:git.cmd:Popen(['git', 'push', '--porcelain', '--force', '--set-upstream', '--progress', '--', 'tmp6zdhhgj5', 'master:master'], cwd=/tmp/tmp6zdhhgj5/local, universal_newlines=True, shell=None, istream=None) 491s DEBUG:root:/tmp/tmp6zdhhgj5/remote: [new branch] 491s 491s DEBUG:git.cmd:Popen(['git', 'clone', '-v', '--', '/tmp/tmp6zdhhgj5/remote', '/tmp/tmp6zdhhgj5/verify'], cwd=/tmp/tmp6zdhhgj5/remote, universal_newlines=True, shell=None, istream=None) 491s DEBUG:git.repo.base:Cmd(['git', 'clone', '-v', '--', '/tmp/tmp6zdhhgj5/remote', '/tmp/tmp6zdhhgj5/verify'])'s unused stdout: 491s .s.... 491s ---------------------------------------------------------------------- 491s Ran 29 tests in 1.104s 491s 491s OK (skipped=3) 491s + for testcase in $WORKSPACE/tests/*.TestCase 491s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/exception.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 491s ++ uname 491s + '[' Linux '!=' Linux ']' 491s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/exception.TestCase 491s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/exception.TestCase:73: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 491s newSuite.addTest(unittest.makeSuite(ExceptionTest)) 491s . 491s ---------------------------------------------------------------------- 491s Ran 1 test in 0.000s 491s 491s OK 491s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 491s + for testcase in $WORKSPACE/tests/*.TestCase 491s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/import_subcommand.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 491s ++ uname 491s + '[' Linux '!=' Linux ']' 491s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/import_subcommand.TestCase 492s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/import_subcommand.TestCase:176: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 492s newSuite.addTest(unittest.makeSuite(ImportTest)) 492s .INFO:root:tmp/importer 492s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/avenginekit/build.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/chat/build.gradle' 492s INFO:root:tmp/importer 492s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/app/build.gradle' 492s DEBUG:root:..got package=com.anpmech.launcher, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/app/src/main/AndroidManifest.xml' 492s DEBUG:root:..got package=com.anpmech.launcher, version=None, vercode=None 492s INFO:root:tmp/importer 492s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle' 492s DEBUG:root:..got package=None, version=None, vercode=None 492s DEBUG:root:Parsing manifest at 'tmp/importer/app/build.gradle' 492s DEBUG:root:..got package=None, version=1.65, vercode=14 492s DEBUG:root:Parsing manifest at 'tmp/importer/app/src/main/AndroidManifest.xml' 492s DEBUG:root:..got package=ut.ewh.audiometrytest, version=1.0, vercode=1 492s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 492s DEBUG:urllib3.connectionpool:Starting new HTTPS connection (1): gitlab.com:443 492s DEBUG:urllib3.connectionpool:https://gitlab.com:443 "HEAD /fdroid/ci-test-app HTTP/1.1" 200 0 492s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git tmp/importer 494s DEBUG:root:Directory: tmp/importer 494s DEBUG:root:> git rev-parse --show-toplevel 494s DEBUG:root:Directory: tmp/importer 494s DEBUG:root:> git checkout -f origin/HEAD 494s DEBUG:root:Directory: tmp/importer 494s DEBUG:root:> git clean -dffx 494s .DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpro338tc3/td, universal_newlines=False, shell=None, istream=None) 494s DEBUG:root:Parsing manifest at 'td/build.gradle' 494s DEBUG:root:..got package=com.example, version=None, vercode=None 494s WARNING:root:Could not find latest version code 494s INFO:root:Wrote metadata/com.example.yml 494s .ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 494s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 494s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 495s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 495s . 495s ---------------------------------------------------------------------- 495s Ran 5 tests in 3.045s 495s 495s OK 495s + for testcase in $WORKSPACE/tests/*.TestCase 495s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/index.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 495s ++ uname 495s + '[' Linux '!=' Linux ']' 495s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/index.TestCase 495s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/index.TestCase:957: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 495s newSuite.addTest(unittest.makeSuite(IndexTest)) 495s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/index.TestCase:958: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 495s newSuite.addTest(unittest.makeSuite(AltstoreIndexTest)) 496s ...ERROR:root:Bad entry type "" in mirrors config: 1 496s ERROR:root:Bad entry type "" in mirrors config: 2.3 496s ERROR:root:Bad entry type "" in mirrors config: b'asdf' 496s .mirrors: 496s - http://one/fdroid 496s repo_url: https://example.com/fdroid/repo 504s ...........ERROR:root:Duplicate entry "http://one/fdroid/repo" in mirrors config! 504s .ERROR:root:mirror 'https://foo.com' does not end with 'fdroid'! 510s ..............ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 510s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 510s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 514s .... 514s ---------------------------------------------------------------------- 514s Ran 34 tests in 18.450s 514s 514s OK 514s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 514s WARNING: skipping rest of test since html5print is missing! 514s + for testcase in $WORKSPACE/tests/*.TestCase 514s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/init.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 514s ++ uname 514s + '[' Linux '!=' Linux ']' 514s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/init.TestCase 515s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/init.TestCase:90: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 515s newSuite.addTest(unittest.makeSuite(InitTest)) 515s DEBUG:root:Reading 'config.yml' 515s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 515s DEBUG:root:Reading 'config.yml' 515s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 515s .localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 515s 515s Built repo based in "/tmp/tmpjj4pwem2" with this config: 515s 515s Android SDK: /usr/lib/android-sdk 515s Keystore for signing key: /tmp/tmpjj4pwem2/keystore.jks 515s Alias for key in store: sova 515s 515s To complete the setup, add your APKs to "/tmp/tmpjj4pwem2/repo" 515s then run "fdroid update -c; fdroid update". You might also want to edit 515s "config.yml" to set the URL, repo name, and more. You should also set up 515s a signing key (a temporary one might have been automatically generated). 515s 515s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 515s and https://f-droid.org/docs/Signing_Process 515s . 515s ---------------------------------------------------------------------- 515s Ran 2 tests in 0.035s 515s 515s OK 515s skipping install.TestCase, its too troublesome in CI builds 515s + for testcase in $WORKSPACE/tests/*.TestCase 515s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 515s + echo 'skipping install.TestCase, its too troublesome in CI builds' 515s + continue 515s + for testcase in $WORKSPACE/tests/*.TestCase 515s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/lint.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 515s ++ uname 515s + '[' Linux '!=' Linux ']' 515s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/lint.TestCase 516s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/lint.TestCase:556: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 516s newSuite.addTest(unittest.makeSuite(LintTest)) 516s ........DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s DEBUG:root:fake.app: Categories must be a 'list', but it is a 'str!' 516s DEBUG:root:fake.app: Categories must be a 'list', but it is a 'str!' 516s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'list'! 516s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'list'! 516s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'int'! 516s ..DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s .DEBUG:root:Reading 'config.yml' 516s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s ......DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s DEBUG:root:Unexpected license tag "Adobe-2006"! Only use FSF or OSI approved tags from https://spdx.org/license-list 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s DEBUG:root:Unexpected license tag "Apache-2.0"! Only use license tags configured in your config file 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s DEBUG:root:Unexpected license tag "Apache-2.0"! Only use license tags configured in your config file 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s DEBUG:root:Invalid VercodeOperation: ['o', 'p', 'e', 'n', '(', '"', '/', 'e', 't', 'c', '/', 'p', 'a', 's', 's', 'w', 'd', '"', ')'] 516s DEBUG:root:Invalid VercodeOperation: ['%', 'C', ' ', '+', ' ', '1'] 516s DEBUG:root:Invalid VercodeOperation: ['%', '%', 'c', ' ', '*', ' ', '1', '2', '3'] 516s DEBUG:root:Invalid VercodeOperation: ['1', '2', '3', ' ', '+', ' ', '%', '%'] 516s DEBUG:root:Invalid VercodeOperation: ['%', 'c', ' ', '%', ' ', '7'] 516s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 516s DEBUG:root:Description at line 'This way: ': Forbidden HTML tags 517s ............DEBUG:root:Known debug key is used in AllowedAPKSigningKeys: a40da80a59d170caa950cf15c18c454d47a39b26989d8b640ecd745ba71bf5dc 517s ..DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 517s DEBUG:root:bad urls: 517s DEBUG:root:SourceCode 'github.com/my/proj': URL must start with https:// or http:// 517s DEBUG:root:SourceCode 'http://github.com/not/secure': github.com URLs should always use https:// 517s DEBUG:root:SourceCode 'https://github.com/foo/bar.git': Appending .git is not necessary 517s DEBUG:root:SourceCode 'https://gitlab.com/group/subgroup/project.git': Appending .git is not necessary 517s DEBUG:root:SourceCode 'https://raw.githubusercontent.com/Seva-coder/Finder/master/ChangeLog.txt': Use /HEAD instead of /master or /main to point at a file in the default branch 517s DEBUG:root:SourceCode 'https://github.com/scoutant/blokish/blob/master/README.md#changelog': Use /HEAD instead of /master or /main to point at a file in the default branch 517s DEBUG:root:SourceCode 'http://htmlpreview.github.io/?https://github.com/my/project/blob/HEAD/index.html': github.io URLs should always use https:// 517s DEBUG:root:SourceCode 'http://fdroid.gitlab.io/fdroid-website': gitlab.io URLs should always use https:// 517s . 517s ---------------------------------------------------------------------- 517s Ran 39 tests in 0.610s 517s 517s OK 517s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 517s "metadata/apk/" has no matching metadata file! 517s "metadata/dump/" has no matching metadata file! 517s "metadata/org.adaway.json" is not a supported file format (use: metadata/*.yml) 517s mirrors.yml: "DEU" is not a valid ISO_3166-1 alpha-2 country code! Did you mean DE? 517s mirrors.yml: "WV" is not a valid ISO_3166-1 alpha-2 country code! Did you mean WS, ZW? 517s mirrors.yml: "WV" is not a valid ISO_3166-1 alpha-2 country code! Did you mean WS, ZW? 517s config/config.yml:2: no new line character at the end of file (new-line-at-end-of-file) 517s ERROR: repo:invalid_key in config/config.yml is not in allowed keys: name, description, icon! 517s config/en/antiFeatures.yml:2: no new line character at the end of file (new-line-at-end-of-file) 517s ERROR: NonFreeNet:icon in config/en/antiFeatures.yml is not in allowed keys: name, description! 517s + for testcase in $WORKSPACE/tests/*.TestCase 517s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/main.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 517s ++ uname 517s + '[' Linux '!=' Linux ']' 517s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/main.TestCase 518s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/main.TestCase:280: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 518s newSuite.addTest(unittest.makeSuite(MainTest)) 518s ....2024-11-13 22:59:43,259 CRITICAL: Unknown exception found! 518s ....ERROR: no APK supplied 518s .....localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 518s all good 518s all good 518s . 518s ---------------------------------------------------------------------- 518s Ran 14 tests in 0.380s 518s 518s OK 518s + for testcase in $WORKSPACE/tests/*.TestCase 518s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 518s ++ uname 518s + '[' Linux '!=' Linux ']' 518s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata.TestCase 519s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata.TestCase:2461: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 519s newSuite.addTest(unittest.makeSuite(MetadataTest)) 519s .........................DEBUG:root:Including metadata from build/test/.fdroid.yml 519s ...............WARNING:root:Moving Anti-Features declarations to localized files: 519s metadata/a/ko/antifeatures/Anti-🔥.txt 519s metadata/a/uz/antifeatures/Anti-🔥.txt 519s metadata/a/zh/antifeatures/Anti-🔥.txt 519s .........................................................WARNING:root:Ignoring 'Provides' in 'mock_filename.yaml' metadata because it is deprecated. 519s ..............DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 519s ......ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 519s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 519s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 520s .......................... 520s ---------------------------------------------------------------------- 520s Ran 143 tests in 0.735s 520s 520s OK 520s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 520s + for testcase in $WORKSPACE/tests/*.TestCase 520s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/nightly.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 520s ++ uname 520s + '[' Linux '!=' Linux ']' 520s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/nightly.TestCase 521s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/nightly.TestCase:379: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 521s newSuite.addTest(unittest.makeSuite(NightlyTest)) 522s ..WARNING:root:overwriting existing /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore 522s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/nightly.py:370: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 522s date=datetime.datetime.utcnow().strftime('%Y-%m-%d %H:%M:%S UTC')) 522s sending incremental file list 522s ./ 522s 522s sent 41 bytes received 19 bytes 120.00 bytes/sec 522s total size is 0 speedup is 0.00 522s Importing keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore to /tmp/.crgpvf8r/.keystore.p12... 523s 523s Warning: 523s uses the SHA1withRSA signature algorithm which is considered a security risk. 523s uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 523s writing RSA key 524s 2024-11-13 22:59:49,737 DEBUG: Reading 'config.yml' 524s 2024-11-13 22:59:49,742 DEBUG: ipfs_cid not found, skipping CIDv1 generation 524s 2024-11-13 22:59:49,744 DEBUG: skip deploying full build logs: not enabled in config 524s 2024-11-13 22:59:49,744 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 524s 2024-11-13 22:59:49,747 DEBUG: Processing urzip-debug.apk 524s 2024-11-13 22:59:49,896 DEBUG: Getting signature of urzip-debug.apk 524s 2024-11-13 22:59:49,901 DEBUG: Using APK Signature v3 524s 2024-11-13 22:59:49,907 DEBUG: Using APK Signature v3 524s 2024-11-13 22:59:49,910 WARNING: repo/urzip-debug.apk: debuggable or testOnly set in AndroidManifest.xml 525s 2024-11-13 22:59:50,500 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 525s Verified using v1 scheme (JAR signing): true 525s Verified using v2 scheme (APK Signature Scheme v2): true 525s Verified using v3 scheme (APK Signature Scheme v3): true 525s Verified using v4 scheme (APK Signature Scheme v4): false 525s Verified for SourceStamp: false 525s Number of signers: 1 525s 525s 2024-11-13 22:59:50,511 DEBUG: Density 120 not available, resizing down from 160 525s 2024-11-13 22:59:50,518 INFO: Generated skeleton metadata for info.guardianproject.urzip 525s 2024-11-13 22:59:50,524 DEBUG: Checking archiving for info.guardianproject.urzip - apks:1, keepversions:20, archapks:0 525s 2024-11-13 22:59:50,526 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 526s 526s Warning: 526s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 526s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 526s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -deststoretype pkcs12". 526s 2024-11-13 22:59:51,434 INFO: Creating signed index with this key (SHA256): 526s 2024-11-13 22:59:51,434 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 526s 2024-11-13 22:59:51,434 DEBUG: Directory: archive 526s 2024-11-13 22:59:51,434 DEBUG: > jar cf index.jar index.xml 526s 2024-11-13 22:59:51,838 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 527s jar signed. 527s 527s Warning: 527s The signer's certificate is self-signed. 527s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 527s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 527s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 527s 2024-11-13 22:59:52,844 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 527s 2024-11-13 22:59:52,860 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 528s jar signed. 528s 528s Warning: 528s The signer's certificate is self-signed. 528s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 528s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 528s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 528s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 528s 2024-11-13 22:59:53,871 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS archive/entry.jar 529s 2024-11-13 22:59:54,475 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 530s 530s Warning: 530s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 530s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 530s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -deststoretype pkcs12". 530s 2024-11-13 22:59:55,506 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 531s 531s Warning: 531s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 531s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 531s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -deststoretype pkcs12". 531s 2024-11-13 22:59:56,314 INFO: Creating signed index with this key (SHA256): 531s 2024-11-13 22:59:56,315 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 531s 2024-11-13 22:59:56,315 DEBUG: Directory: repo 531s 2024-11-13 22:59:56,315 DEBUG: > jar cf index.jar index.xml 531s 2024-11-13 22:59:56,719 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 532s jar signed. 532s 532s Warning: 532s The signer's certificate is self-signed. 532s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 532s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 532s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 532s 2024-11-13 22:59:57,524 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 532s 2024-11-13 22:59:57,538 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 533s jar signed. 533s 533s Warning: 533s The signer's certificate is self-signed. 533s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 533s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 533s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 533s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 533s 2024-11-13 22:59:58,548 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS repo/entry.jar 534s 2024-11-13 22:59:59,152 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 534s 534s Warning: 534s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 534s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 534s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/home/.android/debug.keystore -deststoretype pkcs12". 535s 2024-11-13 23:00:00,079 DEBUG: Outputting JSON 535s 2024-11-13 23:00:00,081 DEBUG: skip deploying full build logs: not enabled in config 535s 2024-11-13 23:00:00,082 DEBUG: skip deploying full build logs: not enabled in config 535s 2024-11-13 23:00:00,082 DEBUG: skip deploying full build logs: not enabled in config 535s 2024-11-13 23:00:00,083 INFO: Finished 535s sending incremental file list 535s created directory /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/fdroid/git-mirror/fdroid/metadata 535s ./ 535s info.guardianproject.urzip.yml 535s 535s sent 418 bytes received 190 bytes 1,216.00 bytes/sec 535s total size is 268 speedup is 0.44 535s sending incremental file list 535s created directory /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_github_actions_y_puxepi1731538787.2190132/fdroid/git-mirror/fdroid/stats 535s ./ 535s known_apks.txt 535s 535s sent 205 bytes received 187 bytes 784.00 bytes/sec 535s total size is 73 speedup is 0.19 535s .WARNING:root:overwriting existing /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore 535s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/nightly.py:370: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 535s date=datetime.datetime.utcnow().strftime('%Y-%m-%d %H:%M:%S UTC')) 535s sending incremental file list 535s ./ 535s 535s sent 42 bytes received 19 bytes 122.00 bytes/sec 535s total size is 0 speedup is 0.00 535s Importing keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore to /tmp/.fhi4f0os/.keystore.p12... 536s 536s Warning: 536s uses the SHA1withRSA signature algorithm which is considered a security risk. 536s uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 536s writing RSA key 537s 2024-11-13 23:00:02,625 DEBUG: Reading 'config.yml' 537s 2024-11-13 23:00:02,629 DEBUG: ipfs_cid not found, skipping CIDv1 generation 537s 2024-11-13 23:00:02,630 DEBUG: skip deploying full build logs: not enabled in config 537s 2024-11-13 23:00:02,630 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 537s 2024-11-13 23:00:02,632 DEBUG: Processing urzip-debug.apk 537s 2024-11-13 23:00:02,738 DEBUG: Getting signature of urzip-debug.apk 537s 2024-11-13 23:00:02,742 DEBUG: Using APK Signature v3 537s 2024-11-13 23:00:02,746 DEBUG: Using APK Signature v3 537s 2024-11-13 23:00:02,748 WARNING: repo/urzip-debug.apk: debuggable or testOnly set in AndroidManifest.xml 538s 2024-11-13 23:00:03,314 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 538s Verified using v1 scheme (JAR signing): true 538s Verified using v2 scheme (APK Signature Scheme v2): true 538s Verified using v3 scheme (APK Signature Scheme v3): true 538s Verified using v4 scheme (APK Signature Scheme v4): false 538s Verified for SourceStamp: false 538s Number of signers: 1 538s 538s 2024-11-13 23:00:03,320 DEBUG: Density 120 not available, resizing down from 160 538s 2024-11-13 23:00:03,324 INFO: Generated skeleton metadata for info.guardianproject.urzip 538s 2024-11-13 23:00:03,327 DEBUG: Checking archiving for info.guardianproject.urzip - apks:1, keepversions:20, archapks:0 538s 2024-11-13 23:00:03,328 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 538s 538s Warning: 538s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 538s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 538s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -deststoretype pkcs12". 539s 2024-11-13 23:00:04,235 INFO: Creating signed index with this key (SHA256): 539s 2024-11-13 23:00:04,235 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 539s 2024-11-13 23:00:04,235 DEBUG: Directory: archive 539s 2024-11-13 23:00:04,235 DEBUG: > jar cf index.jar index.xml 539s 2024-11-13 23:00:04,539 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 540s jar signed. 540s 540s Warning: 540s The signer's certificate is self-signed. 540s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 540s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 540s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 540s 2024-11-13 23:00:05,444 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 540s 2024-11-13 23:00:05,459 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 541s jar signed. 541s 541s Warning: 541s The signer's certificate is self-signed. 541s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 541s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 541s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 541s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 541s 2024-11-13 23:00:06,470 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS archive/entry.jar 542s 2024-11-13 23:00:07,074 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 542s 542s Warning: 542s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 542s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 542s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -deststoretype pkcs12". 543s 2024-11-13 23:00:08,104 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 543s 543s Warning: 543s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 543s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 543s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -deststoretype pkcs12". 543s 2024-11-13 23:00:08,910 INFO: Creating signed index with this key (SHA256): 543s 2024-11-13 23:00:08,911 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 543s 2024-11-13 23:00:08,911 DEBUG: Directory: repo 543s 2024-11-13 23:00:08,911 DEBUG: > jar cf index.jar index.xml 544s 2024-11-13 23:00:09,315 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 545s jar signed. 545s 545s Warning: 545s The signer's certificate is self-signed. 545s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 545s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 545s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 545s 2024-11-13 23:00:10,424 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 545s 2024-11-13 23:00:10,439 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 546s jar signed. 546s 546s Warning: 546s The signer's certificate is self-signed. 546s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 546s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 546s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 546s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 546s 2024-11-13 23:00:11,450 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS repo/entry.jar 547s 2024-11-13 23:00:11,955 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 547s 547s Warning: 547s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 547s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 547s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/home/.android/debug.keystore -deststoretype pkcs12". 548s 2024-11-13 23:00:12,980 DEBUG: Outputting JSON 548s 2024-11-13 23:00:12,981 DEBUG: skip deploying full build logs: not enabled in config 548s 2024-11-13 23:00:12,982 DEBUG: skip deploying full build logs: not enabled in config 548s 2024-11-13 23:00:12,983 DEBUG: skip deploying full build logs: not enabled in config 548s 2024-11-13 23:00:12,983 INFO: Finished 548s sending incremental file list 548s created directory /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/fdroid/git-mirror/fdroid/metadata 548s ./ 548s info.guardianproject.urzip.yml 548s 548s sent 413 bytes received 185 bytes 1,196.00 bytes/sec 548s total size is 263 speedup is 0.44 548s sending incremental file list 548s created directory /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_gitlab_ci_i3e6m5lx1731538800.5199647/fdroid/git-mirror/fdroid/stats 548s ./ 548s known_apks.txt 548s 548s sent 207 bytes received 182 bytes 778.00 bytes/sec 548s total size is 73 speedup is 0.19 548s .ERROR:root:/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_main_empty_dot_android_egbza1x_1731538813.39481/home/.android/debug.keystore does not exist! Create it by running: 548s keytool -genkey -v -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_main_empty_dot_android_egbza1x_1731538813.39481/home/.android/debug.keystore -storepass android \ 548s -alias androiddebugkey -keypass android -keyalg RSA -keysize 2048 -validity 10000 \ 548s -dname "CN=Android Debug,O=Android,C=US" 548s .Importing keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_main_empty_dot_ssh_iwyywhvi1731538813.3978357/home/.android/debug.keystore to /tmp/.du26vjd1/.keystore.p12... 549s 549s Warning: 549s uses the SHA1withRSA signature algorithm which is considered a security risk. 549s writing RSA key 549s .Importing keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/test_main_on_user_machine_xtvlf6up1731538814.6126451/home/.android/debug.keystore to /tmp/.f5bcdm8o/.keystore.p12... 550s 550s Warning: 550s uses the SHA1withRSA signature algorithm which is considered a security risk. 550s writing RSA key 550s ..Importing keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/aosp_testkey_debug.keystore to /tmp/.gkh3k8qd/.keystore.p12... 551s 551s Warning: 551s uses the SHA1withRSA signature algorithm which is considered a security risk. 551s writing RSA key 551s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 551s WARNING: only public git repos are supported! 551s . 551s ---------------------------------------------------------------------- 551s Ran 9 tests in 30.613s 551s 551s OK 552s + for testcase in $WORKSPACE/tests/*.TestCase 552s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/publish.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 552s ++ uname 552s + '[' Linux '!=' Linux ']' 552s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/publish.TestCase 552s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/publish.TestCase:430: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 552s newSuite.addTest(unittest.makeSuite(PublishTest)) 552s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 552s ERROR:root:There is a keyalias collision - publishing halted 552s .sINFO:root:Creating log directory 552s INFO:root:Creating temporary directory 552s INFO:root:Creating output directory 552s INFO:root:1 app, 1 key aliases 552s INFO:root:Processing unsigned/org.fdroid.ci_1.apk 552s INFO:root:Key alias: 59d3c650 552s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -alias 59d3c650 -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 553s INFO:root:Key does not exist - generating... 553s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -genkey -keystore keystore.jks -alias 59d3c650 -keyalg RSA -keysize 2048 -validity 10000 -storepass:env FDROID_KEY_STORE_PASS -dname CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US -keypass:env FDROID_KEY_PASS 555s DEBUG:root:> /usr/bin/apksigner sign --ks keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias 59d3c650 --in unsigned/org.fdroid.ci_1.apk --out repo/org.fdroid.ci_1.apk 556s DEBUG:root:...no source tarball for org.fdroid.ci_1.apk 556s INFO:root:Published org.fdroid.ci_1.apk 556s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 557s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS 558s DEBUG:root:Outputting JSON 558s DEBUG:root:skip deploying full build logs: not enabled in config 558s DEBUG:root:skip deploying full build logs: not enabled in config 558s DEBUG:root:skip deploying full build logs: not enabled in config 558s INFO:root:published list signing-key fingerprints 559s DOES NOT VERIFY 559s ERROR: APK Signature Scheme v3 signer #1: APK integrity check failed. CHUNKED_SHA256 digest mismatch. Expected: <6a84b4e5c4ab3bd913779469bede0efbb7c44a81d3f8f9e51dfbc93bca188d13>, actual: <175ee932ebb8e0e3bbedd16d627cfe47b0844cb08430a964e857403d73920c6c> 559s ERROR: 559s tmp/org.fdroid.ci_1_1ddeed1.apk: 559s ERROR: ...verification failed - skipping: org.fdroid.ci_1_1ddeed1.apk 561s ERROR: 1 APKs failed to be signed or verified! 561s DOES NOT VERIFY 561s ERROR: APK Signature Scheme v3 signer #1: APK integrity check failed. CHUNKED_SHA256 digest mismatch. Expected: <6a84b4e5c4ab3bd913779469bede0efbb7c44a81d3f8f9e51dfbc93bca188d13>, actual: <175ee932ebb8e0e3bbedd16d627cfe47b0844cb08430a964e857403d73920c6c> 561s ERROR: 561s tmp/org.fdroid.ci_1_1ddeed1.apk: 561s ERROR: ...verification failed - skipping: org.fdroid.ci_1_1ddeed1.apk 563s ERROR: 1 APKs failed to be signed or verified! 582s .......localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 582s . 582s ---------------------------------------------------------------------- 582s Ran 10 tests in 29.477s 582s 582s OK (skipped=1) 582s + for testcase in $WORKSPACE/tests/*.TestCase 582s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/rewritemeta.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 582s ++ uname 582s + '[' Linux '!=' Linux ']' 582s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/rewritemeta.TestCase 582s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/rewritemeta.TestCase:279: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 582s newSuite.addTest(unittest.makeSuite(RewriteMetaTest)) 582s .ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 582s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 582s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 582s .ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 582s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 582s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 583s .localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 583s .....DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 583s INFO:root:Rewriting 'a' 583s DEBUG:root:Finished 583s .INFO:root:Rewriting 'a' 583s DEBUG:root:Finished 583s .INFO:root:Rewriting 'a' 583s INFO:root:Rewriting 'b' 583s DEBUG:root:Finished 583s . 583s ---------------------------------------------------------------------- 583s Ran 11 tests in 0.044s 583s 583s OK 583s + for testcase in $WORKSPACE/tests/*.TestCase 583s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 583s ++ uname 583s + '[' Linux '!=' Linux ']' 583s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase 583s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase:838: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 583s unittest.makeSuite(ScannerTest), 583s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase:839: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 583s unittest.makeSuite(Test_scan_binary), 583s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase:840: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 583s unittest.makeSuite(Test_SignatureDataController), 583s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase:841: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 583s unittest.makeSuite(Test_main), 583s INFO:root:Getting source for revision 1.0 583s INFO:root:Creating local.properties file at /tmp/tmp3w0qdc2l/local.properties 583s INFO:root:Scanning source for common problems... 583s INFO:root:Ignoring shared library at baz.so 583s INFO:root:Ignoring Android AAR library at foo.aar 583s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar 583s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 591s ......INFO:root:Removing unknown maven repo 'https://maven.fabric.io/public' at build.gradle 591s INFO:root:Removing unknown maven repo 'https://evilcorp.com/maven' at build.gradle 591s .-rw-rw-r-- 1 ubuntu ubuntu 18 Nov 13 23:00 binary.out 591s -rwxr-xr-x 1 ubuntu ubuntu 18 Nov 13 23:00 fake.png 592s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/scanner.py:137: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 592s return datetime.utcnow() 592s ERROR:root:Found Java JAR file at arg.jar 592s ERROR:root:Found shared library at baz.so 592s ERROR:root:Found Android DEX code at classes.dex 592s ERROR:root:Found Android AAR library at sqlcipher.aar 592s ERROR:root:Found static library at static.a 592s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar 592s INFO:root:Removing gradlew at gradlew 592s INFO:root:Removing gradlew.bat at gradlew.bat 592s ERROR:root:Found binary at binary.out 592s WARNING:root:Found executable binary, possibly code at fake.png 592s WARNING:root:Found Android DEX code at src/test/resources/classes.dex 592s .ERROR:root:Found unknown maven repo '../../m2/repository' at syncthing-silk/build.gradle 592s ERROR:root:Found unknown maven repo 'http://developer.huawei.com/repo/' at build.gradle 592s ERROR:root:Found unknown maven repo 'https://dl.bintray.com/jenly/maven' at build.gradle 592s ERROR:root:Found usual suspect 'com.tencent.bugly' at chat/build.gradle 592s ERROR:root:Found usual suspect 'com.tencent.bugly' at chat/build.gradle 592s ERROR:root:Found usual suspect 'com.facebook.android' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'crashlytics' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com.google.api-client:google-api-client-android' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at oneSheeld/build.gradle 592s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at oneSheeld/build.gradle 592s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at oneSheeld/build.gradle 592s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at app/build.gradle 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at app/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at app/build.gradle 592s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at app/build.gradle 592s ERROR:root:Found dependency file without lock at rust/subdir2/Cargo.toml 592s ERROR:root:Found usual suspect 'com.google.android.gms(?!.oss-licenses-plugin)' at app/build.gradle 592s ERROR:root:Found usual suspect 'play-services' at app/build.gradle 592s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at build.gradle.kts 592s ERROR:root:Found usual suspect 'com.google.api-client:google-api-client-android' at app/build.gradle.kts 592s ERROR:root:Found usual suspect 'com\.mapbox(?!\.mapboxsdk:mapbox-sdk-(services|geojson|turf):([3-5]))' at app/build.gradle.kts 592s ERROR:root:Found unknown maven repo '$projectDir/../../tests/react-test-app/node_modules/react-native/android' at react-native/android/build.gradle 592s ERROR:root:Found dependency file without lock at package.json 592s ERROR:root:Found unknown maven repo '$rootDir/../node_modules/react-native/android' at android/build.gradle 592s ERROR:root:Found unknown maven repo '$rootDir/../node_modules/jsc-android/dist' at android/build.gradle 592s .ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at build.gradle 592s ERROR:root:Found unknown maven repo 'https://evilcorp.com/maven' at build.gradle 592s ..WARNING:root:config.py is deprecated, use config.yml 592s ..WARNING:root:config.py is deprecated, use config.yml 592s ..WARNING:root:config.py is deprecated, use config.yml 592s .../tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase:542: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 592s sdc.data['last_updated'] = (datetime.utcnow() - timedelta(days=30)).timestamp() 592s ..../tmp/autopkgtest.BGvKMW/build.5vX/src/tests/scanner.TestCase:534: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 592s sdc.data['last_updated'] = datetime.utcnow().timestamp() 592s ........INFO:root:Creating build directory 592s INFO:root:Finished 592s .INFO:root:Scanning APK with dexdump for known non-free classes. 593s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 593s .INFO:root:Scanning APK with dexdump for known non-free classes. 593s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/no_targetsdk_minsdk1_unsigned.apk 593s .INFO:root:Scanning APK with dexdump for known non-free classes. 593s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 593s basedir 593s 0 problems found 593s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 593s . 593s ---------------------------------------------------------------------- 593s Ran 34 tests in 10.145s 593s 593s OK 594s + for testcase in $WORKSPACE/tests/*.TestCase 594s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signatures.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 594s ++ uname 594s + '[' Linux '!=' Linux ']' 594s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signatures.TestCase 594s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signatures.TestCase:74: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 594s newSuite.addTest(unittest.makeSuite(SignaturesTest)) 594s WARNING:root:config.py is deprecated, use config.yml 594s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 595s DEBUG:root:signature okay: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 595s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 595s INFO:root:Fetched signatures for '/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk' -> 'metadata/com.politedroid/signatures/3' 595s . 595s ---------------------------------------------------------------------- 595s Ran 1 test in 0.625s 595s 595s OK 595s + for testcase in $WORKSPACE/tests/*.TestCase 595s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 595s ++ uname 595s + '[' Linux '!=' Linux ']' 595s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex.TestCase 595s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/signindex.TestCase:208: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 595s newSuite.addTest(unittest.makeSuite(SignindexTest)) 595s WARNING:root:config.py is deprecated, use config.yml 597s .......s 597s ---------------------------------------------------------------------- 597s Ran 8 tests in 1.728s 597s 597s OK (skipped=1) 597s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 597s + for testcase in $WORKSPACE/tests/*.TestCase 597s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 597s ++ uname 597s + '[' Linux '!=' Linux ']' 597s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase 598s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2286: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(UpdateTest)) 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2287: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(TestUpdateVersionStringToInt)) 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2288: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(TestScanRepoForIpas)) 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2289: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(TestParseIosScreenShotName)) 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2290: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(TestInsertLocalizedIosAppMetadata)) 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2291: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(TestDiscoverIosScreenshots)) 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/update.TestCase:2292: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 598s newSuite.addTest(unittest.makeSuite(TestGetIpaIcon)) 598s ........./usr/lib/python3/dist-packages/biplist/__init__.py:79: DeprecationWarning: datetime.datetime.utcfromtimestamp() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.fromtimestamp(timestamp, datetime.UTC). 598s apple_reference_date = datetime.datetime.utcfromtimestamp(978307200) 598s .....ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 598s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 598s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 598s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 598s default_date = datetime.utcnow() 600s WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 601s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 608s .WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 609s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 615s .WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 615s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 620s ...WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 620s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 620s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 620s INFO:root:Creating unsigned index in preparation for signing 621s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 621s INFO:root:Finished 621s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 621s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 621s default_date = datetime.utcnow() 621s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 621s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 621s INFO:root:Creating unsigned index in preparation for signing 622s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 622s INFO:root:Finished 622s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 622s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 622s default_date = datetime.utcnow() 623s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 623s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 623s INFO:root:Creating unsigned index in preparation for signing 623s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 623s INFO:root:Finished 623s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 623s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 623s default_date = datetime.utcnow() 623s WARNING:root:categories.txt (4097889236a2af26c293033feb964c4cf118c0224e0d063fec0a89e9d0569ef2) has no metadata! 623s deleting: repo/categories.txt 623s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 623s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 623s INFO:root:Creating unsigned index in preparation for signing 623s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 623s INFO:root:Ignoring package without metadata: categories.txt 623s INFO:root:Ignoring package without metadata: categories.txt 623s INFO:root:Finished 623s .WARNING:root:repo/urzip.apk: debuggable or testOnly set in AndroidManifest.xml 624s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 624s default_date = datetime.utcnow() 624s INFO:root:Generated skeleton metadata for info.guardianproject.urzip 624s INFO:root:Generated skeleton metadata for info.guardianproject.urzip 624s .WARNING:root:rocks.janicerand does not have a name! Using application ID instead. 624s INFO:root:Generated skeleton metadata for rocks.janicerand 624s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 624s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 624s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 624s INFO:root:Creating unsigned index in preparation for signing 625s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 625s WARNING:root:Category "System" defined but not used for any apps! 625s INFO:root:Finished 625s .../tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 625s default_date = datetime.utcnow() 627s WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 628s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 634s .WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 635s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 642s .WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 643s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 648s .ERROR:root:No signing certificates found in urzip-release-unsigned.apk 648s .....ERROR:root:Found bad funding file "build/fake.app.id/FUNDING.yml" for "fake.app.id": 648s ERROR:root:mapping values are not allowed in this context 648s in "build/fake.app.id/FUNDING.yml", line 4, column 12 648s ..ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 648s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 648s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 650s WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 651s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 656s WARNING:root:Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 656s WARNING:root:Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 656s WARNING:root:Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 656s WARNING:root:Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 656s .....WARNING:root:skipping test_insert_triple_t_metadata, import.TestCase must run first! 656s ..ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 656s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 656s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 658s WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 659s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 664s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 665s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 665s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 665s INFO:root:Creating unsigned index in preparation for signing 665s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 665s INFO:root:Finished 665s .WARNING:root:repo/../urzip.apk: debuggable or testOnly set in AndroidManifest.xml 666s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/common.py:2639: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 666s default_date = datetime.utcnow() 667s ..WARNING:androguard.apk:Missing AndroidManifest.xml. Is this an APK file? 667s ERROR:root:Failed to get APK information, skipping repo/fake.ota.update_1234.zip 667s WARNING:root:Skipping 'fake.ota.update_1234.zip' with invalid signature! 667s SKIPPING: apksigner installed and it allows MD5 signatures 669s .WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 670s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 674s .WARNING:root:Ignoring FUNDING.yml entry longer than 2048: NWYBEPBOFRSKHYAILCWMNTGPSOIQHIPPNWTHBBELEPEWGPIUINHXQIVSAHLUIAVCZFBPNGTSDXBMFEJNAFWSSMQAHCEKSOTAQHJAKCRGWJSZXMYFYRRRNKZZQDWWKJMFMNUIFPSWPZPNHZOWYUOBVAVLPWPCVJPCCIDPDQVIFSDTHTWSYNMMISWPPCDEMIXXKYBSFGPZSZJSQJRABYSBKBECQZYLBFRCXFHIFFILNKXOCDGWHWNWCPCMTPYQXVVJRJFURUZQXQINXIYSAGZEYTTSUATISHFKESRSNUUBDBPZXBRGYYEZHGRLFOCESUCMOUYRIOYWQSPETAOPYTPPCBLBNWINSUOQQIQORPAFYGJMOQNPEAAOBLPZZKBSSSMYAFAJYKZPLCHGEHALQCUZSURIPAEPNSKXUJRPVPCAPKQWSHLXOPCACNCGPZYFTVCSLSJZSAPNBYAVIHIJHOFRGEJHTPTWJUYOAKZSTNOFMMTQXPCBZMIHWXWBFYQXBAMCUPWYUMEXJNMSIQKZNLYUENGADJVRSIXEDZTXQBWOMMXBOGMUMVSWIDYGZNXNAESIFXNUUETMVSHOBIGKPBFUHISZEHPKDNFWDKXULXTAHIVAMIOBUIAOYNFNHODPFWFZXGYCBOGKCWQLDLQQUQQFBZFJJNEDGFHEETSISIFMDTINGDGFPWXQIPOTMYWNVKAUWJQJFAOUJRGTAOTMMHIZIABGGNUDCVQRLVCSNBDSQJDPXGOGDYMGGGHAYBEJLUMRVQJNWBLCTOEWYMUYBPRDHJCADCPOUSJCOTYTPZCAGOQJHRQJMBFYFWBOQMTSDXDEOOJBAUMWUBHTKPLQRTTLPIHEXRKEDMZQSHRXGYHXWNXGPOTDOKFHKBJELSFHXYTXYCHUTVYPNCUXNYIRZKHCFPCOLSMHMLJADTRUKGAQUSBTAWFCRBGUWMNYXXMSPDICVBWEJYWCNVPLNJSYHYBLQBOQRFLBHGPOQGDGDWNBVWTZFQBMMJWZAGXYABVWBJKRJZITCRMVQFRQZVGBQCNCYUHCYHMXJCRIXGBLBTNANXMYSETEWTVVMAZBCDXYQIKGYEOXSEHYKKZEACKEKDMOUUVIXRNEUQBEELUAMKUIWVYNXFYESGXNRBDFDVRSDTIEHWFOOIHVTUMUBLMKSZUVPIVWEAJWYOGPYMXXBCYAOHIOZTKHSDQVBYPBXHJFNNWTDTQLRGMELCACBTPZBCGHLSJOIOXWQKDBUJIVEDIWRWGBGSWTKAAWONVEMWIKNWJDHFNVXANVLJPVCJCDFJEOOMNPHGVZGRCPIVGFFOJLLXAYAKXZVBUUJEHAWFNGXUNBMHTRNSQYVVCFWBNMJPVHIHBRIIIKEWAQCIGPVMDCTCJEQTKYGGADGGXEXMXAVNIAGQXLUBJVRQPILBDCTNQHEBNFUTVJZRWQAMIHHXVBJGMFOHPFEMAUTMBPNJVTWVXIWSPBAVRXSYJXHXLWBLLFQPBIEPEYWKGLIXSCGNNRDVNQHTZZKGOEKQIJFWFOLHTRDWKBSVKUMGRWKITRGSRJFELYBZOTBGLBKDKFOVZBPUHPNPOUIOIWGAJZVYDSJCGQMCYZYFBAYAGFXGEAQUVUDAXYJIATMQFKPZYLMDRACFWQQMJGEXSGGEPJMBHMCUSBKJHPLMFVIEAZHZIOFLKFEXNFZIDOWUPJKZTJIJAYXGOYBCBXJLFBDIUAJDVDGZZDGELAJOESMXQPGZUXJDUOTKYSVPQURAXXTPTQMKPJBWKWNXIEOIFHTTFTQQOGILFTQFHLHUDIAWDUBGWJOAFFQHLXOILLWPFRKYQFMCSPAVRKLDJLBMXBDQFOICNLPQHITWXQBHEJGAPSICIQHKXQFBSPCVRSAZQHLKUAZVCMXJTFTSPZMVDMNLCPEJANPUQLEQSTWWOUKLGDMYUBBPNSSYSRLNPXBRZZDXRRRHFPHSEAEUZJKLXNYQTVFEOYIHNWMXDJOMZWPSBMWLSLDWHNBKYDALLYRJIHDYZVDDAUPQVOSICDOOZHLHCNQRGTXTHW 674s .WARNING:root:No minimum SDK version found in SpeedoMeterApp.main_1.apk, using default (3). 674s .s.ERROR:root:Could not open APK repo/badzip_1.apk for analysis: File is not a zip file 674s .WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 674s .ERROR:root:No signing certificates found in urzip-release-unsigned.apk 674s ...ERROR:root:badlink.txt: [Errno 2] No such file or directory: 'badlink.txt' 674s .ERROR:root:badlink-full-description.txt: [Errno 2] No such file or directory: 'badlink-full-description.txt' 674s ERROR:root:badlink-short-description.txt: [Errno 2] No such file or directory: 'badlink-short-description.txt' 674s ERROR:root:badlink-title.txt: [Errno 2] No such file or directory: 'badlink-title.txt' 674s ERROR:root:badlink-video-url.txt: [Errno 2] No such file or directory: 'badlink-video-url.txt' 674s ..ERROR:root:Failed copying /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/corrupt-featureGraphic.png: cannot identify image file <_io.BufferedReader name='/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/corrupt-featureGraphic.png'> 674s .ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 674s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 674s ERROR:root:Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 676s WARNING:root:repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 677s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 681s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 681s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 681s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 682s INFO:root:Creating signed index with this key (SHA256): 682s INFO:root:F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 683s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 685s INFO:root:Finished 685s WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 685s WARNING:root:"com.politedroid_6.apk" is signed by a key that is not allowed: 685s 32a23624c201b949f085996ba5ed53d40f703aca4989476949cae891022e0ed6 685s WARNING:root:Removing repo/com.politedroid_6.apk" 685s /tmp/autopkgtest.BGvKMW/build.5vX/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 685s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 686s INFO:root:Creating signed index with this key (SHA256): 686s INFO:root:F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 687s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 689s INFO:root:Finished 689s . 689s ---------------------------------------------------------------------- 689s Ran 66 tests in 91.329s 689s 689s OK (skipped=1) 689s + for testcase in $WORKSPACE/tests/*.TestCase 689s + '[' /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/vcs.TestCase == /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/install.TestCase ']' 689s ++ uname 689s + '[' Linux '!=' Linux ']' 689s + /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/vcs.TestCase 690s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/vcs.TestCase:103: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 690s newSuite.addTest(unittest.makeSuite(VCSTest)) 690s DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpv9pkupl0/upstream_repo, universal_newlines=False, shell=None, istream=None) 690s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpv9pkupl0/upstream_repo, universal_newlines=False, shell=None, istream=) 690s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch'], cwd=/tmp/tmpv9pkupl0/upstream_repo, universal_newlines=False, shell=None, istream=) 690s DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpv9pkupl0/clone1, universal_newlines=False, shell=None, istream=None) 690s DEBUG:git.cmd:Popen(['git', 'remote', 'add', '--', 'upstream', 'file:///tmp/tmpv9pkupl0/upstream_repo'], cwd=/tmp/tmpv9pkupl0/clone1, universal_newlines=False, shell=None, istream=None) 690s DEBUG:git.cmd:Popen(['git', 'fetch', '-v', '--', 'upstream'], cwd=/tmp/tmpv9pkupl0/clone1, universal_newlines=True, shell=None, istream=None) 690s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpv9pkupl0/clone1, universal_newlines=False, shell=None, istream=) 690s DEBUG:git.cmd:Popen(['git', 'reset', '--hard', 'HEAD', '--'], cwd=/tmp/tmpv9pkupl0/clone1, universal_newlines=False, shell=None, istream=None) 690s DEBUG:root:Getting git vcs interface for /tmp/tmpv9pkupl0/clone1 690s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- /tmp/tmpv9pkupl0/clone1 build/com.gpl.rpg.AndorsTrail 690s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 690s DEBUG:root:> git rev-parse --show-toplevel 690s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 690s DEBUG:root:> git checkout -f 6e64a63dfe9c82a110c2a6e66b4391c4cb60af7f 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git clean -dffx 691s INFO:root:Getting source for revision 6e64a63dfe9c82a110c2a6e66b4391c4cb60af7f 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git rev-parse --show-toplevel 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git submodule foreach --recursive git reset --hard 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git reset --hard 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git submodule foreach --recursive git clean -dffx 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git clean -dffx 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --prune-tags --force origin 691s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 691s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin 692s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 692s DEBUG:root:> git remote set-head origin --auto 692s WARNING:root:Git remote set-head failed: "error: Cannot determine remote HEAD" 692s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 692s DEBUG:root:> git checkout -f 6e64a63dfe9c82a110c2a6e66b4391c4cb60af7f 692s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 692s DEBUG:root:> git clean -dffx 692s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 692s DEBUG:root:> git rev-parse --show-toplevel 692s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 692s DEBUG:root:> git submodule deinit --all --force 692s INFO:root:Creating local.properties file at build/com.gpl.rpg.AndorsTrail/local.properties 692s DEBUG:root:Removing debuggable flags from build/com.gpl.rpg.AndorsTrail 692s localmodule: /tmp/autopkgtest.BGvKMW/build.5vX/src 692s . 692s ---------------------------------------------------------------------- 692s Ran 1 test in 2.488s 692s 692s OK 693s + echo_header 'print fdroid version' 693s + /usr/bin/fdroid --version 693s ============================================================================== 693s print fdroid version 693s 2.3a2 693s + echo_header 'run process when building and signing are on separate machines' 693s + use_apksigner 693s + python3 -c ' 693s import sys 693s sys.path.insert(0, '\''/tmp/autopkgtest.BGvKMW/build.5vX/src'\'') 693s from fdroidserver import common 693s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 693s common.find_apksigner(c) 693s exit(c.get('\''apksigner'\'') is None) 693s ' 693s ============================================================================== 693s run process when building and signing are on separate machines 694s ++ create_test_dir 694s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 694s ++ mkdir /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 694s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 694s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs 694s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs 694s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/ 694s + /usr/bin/fdroid init --keystore keystore.jks --repo-keyalias=sova 694s 694s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs" with this config: 694s 694s Android SDK: /usr/lib/android-sdk 694s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks 694s Alias for key in store: sova 694s 694s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/repo" 694s then run "fdroid update -c; fdroid update". You might also want to edit 694s "config.yml" to set the URL, repo name, and more. You should also set up 694s a signing key (a temporary one might have been automatically generated). 694s 694s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 694s and https://f-droid.org/docs/Signing_Process 694s + echo 'make_current_version_link: true' 694s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 694s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 694s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"' 694s + test -d archive 694s + mkdir archive 694s + test -d metadata 694s + mkdir metadata 694s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/info.guardianproject.urzip.yml metadata/ 694s + test -d repo 694s + test -d unsigned 694s + mkdir unsigned 694s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release-unsigned.apk unsigned/info.guardianproject.urzip_100.apk 694s + /usr/bin/fdroid publish --verbose 695s 2024-11-13 23:02:40,198 DEBUG: Reading 'config.yml' 695s 2024-11-13 23:02:40,212 DEBUG: ipfs_cid not found, skipping CIDv1 generation 695s 2024-11-13 23:02:40,213 INFO: Creating log directory 695s 2024-11-13 23:02:40,213 INFO: Creating temporary directory 695s 2024-11-13 23:02:40,216 INFO: 1 app, 1 key aliases 695s 2024-11-13 23:02:40,217 INFO: Processing unsigned/info.guardianproject.urzip_100.apk 695s 2024-11-13 23:02:40,217 INFO: Key alias: d0299f24 695s 2024-11-13 23:02:40,217 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -list -alias d0299f24 -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 695s keytool error: java.lang.Exception: Alias does not exist 695s 2024-11-13 23:02:40,720 INFO: Key does not exist - generating... 695s 2024-11-13 23:02:40,720 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -genkey -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -alias d0299f24 -keyalg RSA -keysize 2048 -validity 10000 -storepass:env FDROID_KEY_STORE_PASS -dname CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US -keypass:env FDROID_KEY_PASS 698s Generating 2,048 bit RSA key pair and self-signed certificate (SHA384withRSA) with a validity of 10,000 days 698s for: CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, ST=California, C=US 698s 698s Warning: 698s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -deststoretype pkcs12". 698s 2024-11-13 23:02:43,227 DEBUG: > /usr/bin/apksigner sign --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias d0299f24 --in unsigned/info.guardianproject.urzip_100.apk --out repo/info.guardianproject.urzip_100.apk 698s 2024-11-13 23:02:43,829 DEBUG: ...no source tarball for info.guardianproject.urzip_100.apk 698s 2024-11-13 23:02:43,830 INFO: Published info.guardianproject.urzip_100.apk 698s 2024-11-13 23:02:43,830 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 699s 2024-11-13 23:02:44,433 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS 700s jar signed. 700s 700s Warning: 700s The signer's certificate is self-signed. 700s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 700s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 700s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 700s 2024-11-13 23:02:45,337 DEBUG: Outputting JSON 700s 2024-11-13 23:02:45,337 DEBUG: skip deploying full build logs: not enabled in config 700s 2024-11-13 23:02:45,338 DEBUG: skip deploying full build logs: not enabled in config 700s 2024-11-13 23:02:45,338 DEBUG: skip deploying full build logs: not enabled in config 700s 2024-11-13 23:02:45,338 INFO: published list signing-key fingerprints 700s + /usr/bin/fdroid update --verbose --nosign 700s 2024-11-13 23:02:45,922 DEBUG: Reading 'config.yml' 700s 2024-11-13 23:02:45,938 DEBUG: ipfs_cid not found, skipping CIDv1 generation 700s 2024-11-13 23:02:45,939 DEBUG: skip deploying full build logs: not enabled in config 700s 2024-11-13 23:02:45,939 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 700s 2024-11-13 23:02:45,943 DEBUG: Processing info.guardianproject.urzip_100.apk 701s 2024-11-13 23:02:46,046 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 701s 2024-11-13 23:02:46,049 DEBUG: Using APK Signature v3 701s 2024-11-13 23:02:46,054 DEBUG: Using APK Signature v3 701s 2024-11-13 23:02:46,468 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 701s Verified using v1 scheme (JAR signing): true 701s Verified using v2 scheme (APK Signature Scheme v2): true 701s Verified using v3 scheme (APK Signature Scheme v3): true 701s Verified using v4 scheme (APK Signature Scheme v4): false 701s Verified for SourceStamp: false 701s Number of signers: 1 701s 701s 2024-11-13 23:02:46,474 DEBUG: Density 120 not available, resizing down from 160 702s 2024-11-13 23:02:47,019 DEBUG: JAR signature verified: stats/publishsigkeys.jar 702s 2024-11-13 23:02:47,020 WARNING: Missing AndroidManifest.xml. Is this an APK file? 702s 2024-11-13 23:02:47,022 DEBUG: Using JAR Signature 702s 2024-11-13 23:02:47,022 WARNING: repo_key_sha256 not in config.yml, setting it to the signature key fingerprint of 'stats/publishsigkeys.jar' 702s 2024-11-13 23:02:47,024 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 702s 702s Warning: 702s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -deststoretype pkcs12". 702s 2024-11-13 23:02:47,629 INFO: Creating unsigned index in preparation for signing 702s 2024-11-13 23:02:47,629 DEBUG: Directory: repo 702s 2024-11-13 23:02:47,629 DEBUG: > jar cf index_unsigned.jar index.xml 702s 2024-11-13 23:02:47,931 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 702s 2024-11-13 23:02:47,940 DEBUG: index-v1 must have a signature, use `fdroid signindex` to create it! 702s 2024-11-13 23:02:47,942 DEBUG: index-v2 must have a signature, use `fdroid signindex` to create it! 702s 2024-11-13 23:02:47,943 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 703s 703s Warning: 703s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -deststoretype pkcs12". 703s 2024-11-13 23:02:48,560 DEBUG: Outputting JSON 703s 2024-11-13 23:02:48,561 DEBUG: skip deploying full build logs: not enabled in config 703s 2024-11-13 23:02:48,561 DEBUG: skip deploying full build logs: not enabled in config 703s 2024-11-13 23:02:48,561 DEBUG: skip deploying full build logs: not enabled in config 703s 2024-11-13 23:02:48,562 INFO: Finished 703s + /usr/bin/fdroid signindex --verbose 704s 2024-11-13 23:02:49,176 DEBUG: Reading 'config.yml' 704s 2024-11-13 23:02:49,191 DEBUG: ipfs_cid not found, skipping CIDv1 generation 704s 2024-11-13 23:02:49,191 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/index_unsigned.jar 704s 2024-11-13 23:02:49,794 INFO: Signed index in repo 704s 2024-11-13 23:02:49,796 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 705s jar signed. 705s 705s Warning: 705s The signer's certificate is self-signed. 705s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 705s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 705s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 705s 2024-11-13 23:02:50,700 INFO: Signed repo/index-v1.json 705s 2024-11-13 23:02:50,701 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.MLHs/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 706s 2024-11-13 23:02:51,304 INFO: Signed repo/entry.json 706s 2024-11-13 23:02:51,304 DEBUG: Outputting JSON 706s 2024-11-13 23:02:51,305 DEBUG: skip deploying full build logs: not enabled in config 706s 2024-11-13 23:02:51,305 DEBUG: skip deploying full build logs: not enabled in config 706s 2024-11-13 23:02:51,306 DEBUG: skip deploying full build logs: not enabled in config 706s ============================================================================== 706s test UTF-8 metadata 706s + test -e repo/index.xml 706s + test -e repo/index.jar 706s + test -e repo/index-v1.jar 706s + test -e tmp/apkcache.json 706s + test -z tmp/apkcache.json 706s + test -L urzip.apk 706s + grep -F ') 714s 2024-11-13 23:02:59,878 DEBUG: Including metadata from build/org.fdroid.ci.test.app/.fdroid.yml@723e955be8fa0647c021992040f0ae8ae8c4569d 714s 2024-11-13 23:02:59,880 INFO: Processing org.fdroid.ci.test.app 714s 2024-11-13 23:02:59,881 INFO: ...scanning version 0.3 714s 2024-11-13 23:02:59,881 INFO: Getting source for revision 0.3 714s 2024-11-13 23:02:59,881 INFO: Repository details for build/org.fdroid.ci.test.app missing - deleting 714s 2024-11-13 23:02:59,896 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git build/org.fdroid.ci.test.app 715s Cloning into 'build/org.fdroid.ci.test.app'... 716s 2024-11-13 23:03:01,501 DEBUG: Directory: build/org.fdroid.ci.test.app 716s 2024-11-13 23:03:01,501 DEBUG: > git rev-parse --show-toplevel 716s 2024-11-13 23:03:01,703 DEBUG: Directory: build/org.fdroid.ci.test.app 716s 2024-11-13 23:03:01,703 DEBUG: > git checkout -f 0.3 716s 2024-11-13 23:03:01,905 DEBUG: Directory: build/org.fdroid.ci.test.app 716s 2024-11-13 23:03:01,905 DEBUG: > git clean -dffx 717s 2024-11-13 23:03:02,007 DEBUG: Directory: build/org.fdroid.ci.test.app 717s 2024-11-13 23:03:02,007 DEBUG: > git rev-parse --show-toplevel 717s 2024-11-13 23:03:02,209 DEBUG: Directory: build/org.fdroid.ci.test.app 717s 2024-11-13 23:03:02,210 DEBUG: > git submodule deinit --all --force 717s 2024-11-13 23:03:02,311 INFO: Creating local.properties file at build/org.fdroid.ci.test.app/local.properties 717s 2024-11-13 23:03:02,312 INFO: Creating local.properties file at build/org.fdroid.ci.test.app/app/local.properties 717s 2024-11-13 23:03:02,312 DEBUG: Removing debuggable flags from build/org.fdroid.ci.test.app/app 717s 2024-11-13 23:03:02,319 DEBUG: scanner is configured to use signature data from: 'suss' 717s 2024-11-13 23:03:02,320 DEBUG: next suss.json cache update due in 23:57:55.113618 717s 2024-11-13 23:03:02,355 INFO: Finished 717s 0 problems found 717s + echo_header 'copy tests/repo, generate java/gpg keys, update, and gpgsign' 717s ++ create_test_dir 717s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 717s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 717s ============================================================================== 717s copy tests/repo, generate java/gpg keys, update, and gpgsign 717s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR 717s + GNUPGHOME=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR/gnupghome 717s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR 717s + fdroid_init_with_prebuilt_keystore 717s + '[' -z '' ']' 717s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 717s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 718s 718s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR" with this config: 718s 718s Android SDK: /usr/lib/android-sdk 718s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 718s Alias for key in store: sova 718s 718s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR/repo" 718s then run "fdroid update -c; fdroid update". You might also want to edit 718s "config.yml" to set the URL, repo name, and more. You should also set up 718s a signing key (a temporary one might have been automatically generated). 718s 718s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 718s and https://f-droid.org/docs/Signing_Process 718s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 718s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 718s + cp -a /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/config /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/stats /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR/ 718s + cp -a /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/gnupghome /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR/gnupghome 718s + chmod 0700 /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR/gnupghome 718s + echo 'install_list: org.adaway' 718s + echo 'uninstall_list: [com.android.vending, com.facebook.orca]' 718s + echo 'gpghome: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.kCzR/gnupghome' 718s + echo 'gpgkey: CE71F7FB' 718s + echo 'mirrors: ['\''http://foobarfoobarfoobar.onion/fdroid'\'', '\''https://foo.bar/fdroid'\'']' 718s + /usr/bin/fdroid update --verbose --pretty 719s 2024-11-13 23:03:04,150 DEBUG: Reading 'config.yml' 719s 2024-11-13 23:03:04,167 DEBUG: ipfs_cid not found, skipping CIDv1 generation 719s 2024-11-13 23:03:04,168 DEBUG: skip deploying full build logs: not enabled in config 719s 2024-11-13 23:03:04,168 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 719s 2024-11-13 23:03:04,177 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 719s 2024-11-13 23:03:04,177 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 719s 2024-11-13 23:03:04,177 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 719s 2024-11-13 23:03:04,314 DEBUG: Processing com.example.test.helloworld_1.apk 719s 2024-11-13 23:03:04,391 DEBUG: Getting signature of com.example.test.helloworld_1.apk 719s 2024-11-13 23:03:04,395 DEBUG: Using JAR Signature 719s 2024-11-13 23:03:04,400 DEBUG: Using JAR Signature 719s 2024-11-13 23:03:04,762 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 719s Verified using v1 scheme (JAR signing): true 719s Verified using v2 scheme (APK Signature Scheme v2): false 719s Verified using v3 scheme (APK Signature Scheme v3): false 719s Verified using v4 scheme (APK Signature Scheme v4): false 719s Verified for SourceStamp: false 719s Number of signers: 1 719s 719s 2024-11-13 23:03:04,763 DEBUG: Processing com.politedroid_3.apk 719s 2024-11-13 23:03:04,768 DEBUG: Getting signature of com.politedroid_3.apk 719s 2024-11-13 23:03:04,771 DEBUG: Using JAR Signature 719s 2024-11-13 23:03:04,774 DEBUG: Using JAR Signature 720s 2024-11-13 23:03:05,146 DEBUG: repo/com.politedroid_3.apk: Verifies 720s Verified using v1 scheme (JAR signing): true 720s Verified using v2 scheme (APK Signature Scheme v2): false 720s Verified using v3 scheme (APK Signature Scheme v3): false 720s Verified using v4 scheme (APK Signature Scheme v4): false 720s Verified for SourceStamp: false 720s Number of signers: 1 720s 720s 2024-11-13 23:03:05,153 DEBUG: Processing com.politedroid_4.apk 720s 2024-11-13 23:03:05,158 DEBUG: Getting signature of com.politedroid_4.apk 720s 2024-11-13 23:03:05,161 DEBUG: Using JAR Signature 720s 2024-11-13 23:03:05,165 DEBUG: Using JAR Signature 720s 2024-11-13 23:03:05,538 DEBUG: repo/com.politedroid_4.apk: Verifies 720s Verified using v1 scheme (JAR signing): true 720s Verified using v2 scheme (APK Signature Scheme v2): false 720s Verified using v3 scheme (APK Signature Scheme v3): false 720s Verified using v4 scheme (APK Signature Scheme v4): false 720s Verified for SourceStamp: false 720s Number of signers: 1 720s 720s 2024-11-13 23:03:05,541 DEBUG: Processing com.politedroid_5.apk 720s 2024-11-13 23:03:05,545 DEBUG: Getting signature of com.politedroid_5.apk 720s 2024-11-13 23:03:05,548 DEBUG: Using JAR Signature 720s 2024-11-13 23:03:05,552 DEBUG: Using JAR Signature 720s 2024-11-13 23:03:05,932 DEBUG: repo/com.politedroid_5.apk: Verifies 720s Verified using v1 scheme (JAR signing): true 720s Verified using v2 scheme (APK Signature Scheme v2): false 720s Verified using v3 scheme (APK Signature Scheme v3): false 720s Verified using v4 scheme (APK Signature Scheme v4): false 720s Verified for SourceStamp: false 720s Number of signers: 1 720s 720s 2024-11-13 23:03:05,934 DEBUG: Processing com.politedroid_6.apk 720s 2024-11-13 23:03:05,940 DEBUG: Getting signature of com.politedroid_6.apk 720s 2024-11-13 23:03:05,944 DEBUG: Using JAR Signature 720s 2024-11-13 23:03:05,949 DEBUG: Using JAR Signature 721s 2024-11-13 23:03:06,329 DEBUG: repo/com.politedroid_6.apk: Verifies 721s Verified using v1 scheme (JAR signing): true 721s Verified using v2 scheme (APK Signature Scheme v2): false 721s Verified using v3 scheme (APK Signature Scheme v3): false 721s Verified using v4 scheme (APK Signature Scheme v4): false 721s Verified for SourceStamp: false 721s Number of signers: 1 721s 721s 2024-11-13 23:03:06,332 DEBUG: Processing duplicate.permisssions_9999999.apk 721s 2024-11-13 23:03:06,339 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 721s 2024-11-13 23:03:06,343 DEBUG: Using APK Signature v2 721s 2024-11-13 23:03:06,348 DEBUG: Using APK Signature v2 721s 2024-11-13 23:03:06,350 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 721s 2024-11-13 23:03:06,718 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 721s Verified using v1 scheme (JAR signing): true 721s Verified using v2 scheme (APK Signature Scheme v2): true 721s Verified using v3 scheme (APK Signature Scheme v3): false 721s Verified using v4 scheme (APK Signature Scheme v4): false 721s Verified for SourceStamp: false 721s Number of signers: 1 721s 721s 2024-11-13 23:03:06,719 DEBUG: Density 120 not available, resizing down from 160 721s 2024-11-13 23:03:06,721 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 721s 2024-11-13 23:03:06,726 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 721s 2024-11-13 23:03:06,730 DEBUG: Using JAR Signature 721s 2024-11-13 23:03:06,733 DEBUG: Using JAR Signature 722s 2024-11-13 23:03:07,093 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 722s Verified using v1 scheme (JAR signing): true 722s Verified using v2 scheme (APK Signature Scheme v2): false 722s Verified using v3 scheme (APK Signature Scheme v3): false 722s Verified using v4 scheme (APK Signature Scheme v4): false 722s Verified for SourceStamp: false 722s Number of signers: 1 722s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 722s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 722s 722s 2024-11-13 23:03:07,094 DEBUG: Processing no.min.target.sdk_987.apk 722s 2024-11-13 23:03:07,098 DEBUG: Getting signature of no.min.target.sdk_987.apk 722s 2024-11-13 23:03:07,102 DEBUG: Using APK Signature v2 722s 2024-11-13 23:03:07,105 DEBUG: Using APK Signature v2 722s 2024-11-13 23:03:07,106 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 722s 2024-11-13 23:03:07,497 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 722s Verified using v1 scheme (JAR signing): true 722s Verified using v2 scheme (APK Signature Scheme v2): true 722s Verified using v3 scheme (APK Signature Scheme v3): false 722s Verified using v4 scheme (APK Signature Scheme v4): false 722s Verified for SourceStamp: false 722s Number of signers: 1 722s 722s 2024-11-13 23:03:07,498 DEBUG: Density 120 not available, resizing down from 160 722s 2024-11-13 23:03:07,500 DEBUG: Processing obb.main.oldversion_1444412523.apk 722s 2024-11-13 23:03:07,506 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 722s 2024-11-13 23:03:07,510 DEBUG: Using APK Signature v2 722s 2024-11-13 23:03:07,514 DEBUG: Using APK Signature v2 722s 2024-11-13 23:03:07,914 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 722s Verified using v1 scheme (JAR signing): true 722s Verified using v2 scheme (APK Signature Scheme v2): true 722s Verified using v3 scheme (APK Signature Scheme v3): false 722s Verified using v4 scheme (APK Signature Scheme v4): false 722s Verified for SourceStamp: false 722s Number of signers: 1 722s 722s 2024-11-13 23:03:07,915 DEBUG: Density 120 not available, resizing down from 160 722s 2024-11-13 23:03:07,918 DEBUG: Processing obb.main.twoversions_1101613.apk 722s 2024-11-13 23:03:07,922 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 722s 2024-11-13 23:03:07,926 DEBUG: Using JAR Signature 722s 2024-11-13 23:03:07,930 DEBUG: Using JAR Signature 723s 2024-11-13 23:03:08,283 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 723s Verified using v1 scheme (JAR signing): true 723s Verified using v2 scheme (APK Signature Scheme v2): false 723s Verified using v3 scheme (APK Signature Scheme v3): false 723s Verified using v4 scheme (APK Signature Scheme v4): false 723s Verified for SourceStamp: false 723s Number of signers: 1 723s 723s 2024-11-13 23:03:08,284 DEBUG: Density 120 not available, resizing down from 160 723s 2024-11-13 23:03:08,286 DEBUG: Processing obb.main.twoversions_1101615.apk 723s 2024-11-13 23:03:08,291 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 723s 2024-11-13 23:03:08,295 DEBUG: Using JAR Signature 723s 2024-11-13 23:03:08,299 DEBUG: Using JAR Signature 723s 2024-11-13 23:03:08,651 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 723s Verified using v1 scheme (JAR signing): true 723s Verified using v2 scheme (APK Signature Scheme v2): false 723s Verified using v3 scheme (APK Signature Scheme v3): false 723s Verified using v4 scheme (APK Signature Scheme v4): false 723s Verified for SourceStamp: false 723s Number of signers: 1 723s 723s 2024-11-13 23:03:08,652 DEBUG: Density 120 not available, resizing down from 160 723s 2024-11-13 23:03:08,654 DEBUG: Processing obb.main.twoversions_1101617.apk 723s 2024-11-13 23:03:08,659 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 723s 2024-11-13 23:03:08,663 DEBUG: Using JAR Signature 723s 2024-11-13 23:03:08,667 DEBUG: Using JAR Signature 724s 2024-11-13 23:03:09,049 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 724s Verified using v1 scheme (JAR signing): true 724s Verified using v2 scheme (APK Signature Scheme v2): false 724s Verified using v3 scheme (APK Signature Scheme v3): false 724s Verified using v4 scheme (APK Signature Scheme v4): false 724s Verified for SourceStamp: false 724s Number of signers: 1 724s 724s 2024-11-13 23:03:09,051 DEBUG: Density 120 not available, resizing down from 160 724s 2024-11-13 23:03:09,053 DEBUG: Processing obb.mainpatch.current_1619.apk 724s 2024-11-13 23:03:09,058 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 724s 2024-11-13 23:03:09,062 DEBUG: Using JAR Signature 724s 2024-11-13 23:03:09,066 DEBUG: Using JAR Signature 724s 2024-11-13 23:03:09,434 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 724s Verified using v1 scheme (JAR signing): true 724s Verified using v2 scheme (APK Signature Scheme v2): false 724s Verified using v3 scheme (APK Signature Scheme v3): false 724s Verified using v4 scheme (APK Signature Scheme v4): false 724s Verified for SourceStamp: false 724s Number of signers: 1 724s 724s 2024-11-13 23:03:09,436 DEBUG: Density 120 not available, resizing down from 160 724s 2024-11-13 23:03:09,438 DEBUG: Processing obb.mainpatch.current_1619_another-release-key.apk 724s 2024-11-13 23:03:09,443 DEBUG: Getting signature of obb.mainpatch.current_1619_another-release-key.apk 724s 2024-11-13 23:03:09,447 DEBUG: Using JAR Signature 724s 2024-11-13 23:03:09,451 DEBUG: Using JAR Signature 724s 2024-11-13 23:03:09,814 DEBUG: repo/obb.mainpatch.current_1619_another-release-key.apk: Verifies 724s Verified using v1 scheme (JAR signing): true 724s Verified using v2 scheme (APK Signature Scheme v2): false 724s Verified using v3 scheme (APK Signature Scheme v3): false 724s Verified using v4 scheme (APK Signature Scheme v4): false 724s Verified for SourceStamp: false 724s Number of signers: 1 724s 724s 2024-11-13 23:03:09,815 DEBUG: Density 120 not available, resizing down from 160 724s 2024-11-13 23:03:09,817 DEBUG: Processing souch.smsbypass_9.apk 724s 2024-11-13 23:03:09,825 DEBUG: Getting signature of souch.smsbypass_9.apk 724s 2024-11-13 23:03:09,829 DEBUG: Using JAR Signature 724s 2024-11-13 23:03:09,833 DEBUG: Using JAR Signature 725s 2024-11-13 23:03:10,215 DEBUG: repo/souch.smsbypass_9.apk: Verifies 725s Verified using v1 scheme (JAR signing): true 725s Verified using v2 scheme (APK Signature Scheme v2): false 725s Verified using v3 scheme (APK Signature Scheme v3): false 725s Verified using v4 scheme (APK Signature Scheme v4): false 725s Verified for SourceStamp: false 725s Number of signers: 1 725s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 725s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 725s 725s 2024-11-13 23:03:10,217 DEBUG: Density 120 not available, resizing down from 160 725s 2024-11-13 23:03:10,220 DEBUG: Processing urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 725s 2024-11-13 23:03:10,225 DEBUG: Getting signature of urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 725s 2024-11-13 23:03:10,229 DEBUG: Using JAR Signature 725s 2024-11-13 23:03:10,233 DEBUG: Using JAR Signature 725s 2024-11-13 23:03:10,590 DEBUG: repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk: Verifies 725s Verified using v1 scheme (JAR signing): true 725s Verified using v2 scheme (APK Signature Scheme v2): false 725s Verified using v3 scheme (APK Signature Scheme v3): false 725s Verified using v4 scheme (APK Signature Scheme v4): false 725s Verified for SourceStamp: false 725s Number of signers: 1 725s 725s 2024-11-13 23:03:10,591 DEBUG: Density 120 not available, resizing down from 160 725s 2024-11-13 23:03:10,593 DEBUG: Processing v1.v2.sig_1020.apk 725s 2024-11-13 23:03:10,598 DEBUG: Getting signature of v1.v2.sig_1020.apk 725s 2024-11-13 23:03:10,601 DEBUG: Using APK Signature v2 725s 2024-11-13 23:03:10,605 DEBUG: Using APK Signature v2 726s 2024-11-13 23:03:10,981 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 726s Verified using v1 scheme (JAR signing): true 726s Verified using v2 scheme (APK Signature Scheme v2): true 726s Verified using v3 scheme (APK Signature Scheme v3): false 726s Verified using v4 scheme (APK Signature Scheme v4): false 726s Verified for SourceStamp: false 726s Number of signers: 1 726s 726s 2024-11-13 23:03:10,982 DEBUG: Density 120 not available, resizing down from 160 726s 2024-11-13 23:03:10,985 DEBUG: Processing fake.ota.update_1234.zip 726s 2024-11-13 23:03:10,985 DEBUG: skipping source tarball: repo/obb.main.twoversions_1101617_src.tar.gz 726s 2024-11-13 23:03:10,986 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 726s Use `fdroid update -c` to create it. 726s 2024-11-13 23:03:10,986 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 726s Use `fdroid update -c` to create it. 726s 2024-11-13 23:03:10,988 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:10,989 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/featureGraphic.png repo/info.guardianproject.urzip/en-US 726s 2024-11-13 23:03:11,081 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/icon.png repo/info.guardianproject.urzip/en-US 726s 2024-11-13 23:03:11,082 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:11,082 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:11,082 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 726s 2024-11-13 23:03:11,083 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 726s 2024-11-13 23:03:11,084 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 726s 2024-11-13 23:03:11,089 DEBUG: adding to phoneScreenshots: repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 726s 2024-11-13 23:03:11,090 DEBUG: adding to sevenInchScreenshots: repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 726s 2024-11-13 23:03:11,092 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,093 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,094 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 726s 2024-11-13 23:03:11,095 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 726s 726s Warning: 726s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 726s 2024-11-13 23:03:11,804 INFO: Creating signed index with this key (SHA256): 726s 2024-11-13 23:03:11,804 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 726s 2024-11-13 23:03:11,805 DEBUG: Directory: repo 726s 2024-11-13 23:03:11,805 DEBUG: > jar cf index.jar index.xml 727s 2024-11-13 23:03:12,006 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 727s jar signed. 727s 727s Warning: 727s The signer's certificate is self-signed. 727s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 727s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 727s 2024-11-13 23:03:12,912 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 727s 2024-11-13 23:03:12,921 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 727s 2024-11-13 23:03:12,921 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 727s 2024-11-13 23:03:12,924 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 728s jar signed. 728s 728s Warning: 728s The signer's certificate is self-signed. 728s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 728s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 728s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 728s 2024-11-13 23:03:13,866 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 728s 2024-11-13 23:03:13,868 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 728s 2024-11-13 23:03:13,875 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 729s 2024-11-13 23:03:14,678 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 730s 730s Warning: 730s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 730s 2024-11-13 23:03:15,296 DEBUG: Outputting JSON 730s 2024-11-13 23:03:15,296 DEBUG: skip deploying full build logs: not enabled in config 730s 2024-11-13 23:03:15,297 DEBUG: skip deploying full build logs: not enabled in config 730s 2024-11-13 23:03:15,298 DEBUG: skip deploying full build logs: not enabled in config 730s 2024-11-13 23:03:15,298 INFO: Finished 730s + test -e repo/index.xml 730s + test -e repo/index.jar 730s + test -e repo/index-v1.jar 730s + grep -F '' archive/index.xml 740s ++ wc -l 740s + test 2 -eq 2 740s ++ wc -l 740s ++ grep '' repo/index.xml 740s + test 10 -eq 10 740s + use_apksigner 740s + python3 -c ' 740s import sys 740s sys.path.insert(0, '\''/tmp/autopkgtest.BGvKMW/build.5vX/src'\'') 740s from fdroidserver import common 740s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 740s common.find_apksigner(c) 740s exit(c.get('\''apksigner'\'') is None) 740s ' 741s + echo_header 'test moving old APKs to and from the archive' 741s ============================================================================== 741s test moving old APKs to and from the archive 741s ++ create_test_dir 741s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 741s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 741s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ocqk 741s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ocqk 741s + fdroid_init_with_prebuilt_keystore 741s + '[' -z '' ']' 741s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 741s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 741s 741s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ocqk" with this config: 741s 741s Android SDK: /usr/lib/android-sdk 741s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 741s Alias for key in store: sova 741s 741s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ocqk/repo" 741s then run "fdroid update -c; fdroid update". You might also want to edit 741s "config.yml" to set the URL, repo name, and more. You should also set up 741s a signing key (a temporary one might have been automatically generated). 741s 741s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 741s and https://f-droid.org/docs/Signing_Process 741s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 741s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 741s + test -d metadata 741s + mkdir metadata 741s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/com.politedroid.yml metadata/ 741s + sed -i.tmp /ArchivePolicy:/d metadata/com.politedroid.yml 741s + test -d repo 741s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk repo/ 741s + printf '\narchive_older: 3\n' 741s + /usr/bin/fdroid update --pretty --nosign 742s 2024-11-13 23:03:27,256 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 743s 2024-11-13 23:03:28,893 INFO: Moving com.politedroid_3.apk from repo to archive 744s 2024-11-13 23:03:29,497 INFO: Creating unsigned index in preparation for signing 744s 2024-11-13 23:03:29,800 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 746s 2024-11-13 23:03:31,033 INFO: Creating unsigned index in preparation for signing 746s 2024-11-13 23:03:31,436 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 747s 2024-11-13 23:03:32,063 INFO: Finished 747s ++ grep '' archive/index.xml 747s ++ wc -l 747s + test 1 -eq 1 747s ++ grep '' repo/index.xml 747s ++ wc -l 747s + test 3 -eq 3 747s + grep -F com.politedroid_3.apk archive/index.xml 747s + grep -F com.politedroid_4.apk repo/index.xml 747s + grep -F com.politedroid_5.apk repo/index.xml 747s com.politedroid_3.apk 747s com.politedroid_4.apk 747s + grep -F com.politedroid_6.apk repo/index.xml 747s com.politedroid_5.apk 747s com.politedroid_6.apk 747s + test -e archive/com.politedroid_3.apk 747s + test -e repo/com.politedroid_4.apk 747s + test -e repo/com.politedroid_5.apk 747s + test -e repo/com.politedroid_6.apk 747s + sed -i.tmp 's,archive_older: 3,archive_older: 1,' config.yml 747s + /usr/bin/fdroid update --pretty --nosign 747s 2024-11-13 23:03:32,707 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 747s 2024-11-13 23:03:32,713 INFO: Moving com.politedroid_5.apk from repo to archive 747s 2024-11-13 23:03:32,713 INFO: Moving com.politedroid_4.apk from repo to archive 748s 2024-11-13 23:03:33,318 INFO: Creating unsigned index in preparation for signing 748s 2024-11-13 23:03:33,620 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 749s 2024-11-13 23:03:34,860 INFO: Creating unsigned index in preparation for signing 750s 2024-11-13 23:03:35,163 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 750s 2024-11-13 23:03:35,792 INFO: Finished 750s ++ grep '' archive/index.xml 750s ++ wc -l 750s + test 3 -eq 3 750s ++ grep '' repo/index.xml 750s ++ wc -l 750s + test 1 -eq 1 750s + grep -F com.politedroid_3.apk archive/index.xml 750s + grep -F com.politedroid_4.apk archive/index.xml 750s com.politedroid_3.apk 750s com.politedroid_4.apk 750s + grep -F com.politedroid_5.apk archive/index.xml 750s + grep -F com.politedroid_6.apk repo/index.xml 750s com.politedroid_5.apk 750s com.politedroid_6.apk 751s + test -e archive/com.politedroid_3.apk 751s + test -e archive/com.politedroid_4.apk 751s + test -e archive/com.politedroid_5.apk 751s + test -e repo/com.politedroid_6.apk 751s + sed -i.tmp 's/\(versionCode: 4\)/\1\n disable: testing deletion/' metadata/com.politedroid.yml 751s + /usr/bin/fdroid update --pretty --nosign 751s 2024-11-13 23:03:36,444 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 751s 2024-11-13 23:03:36,448 INFO: Deleting disabled build output repo/icons-640/com.politedroid.4.png 751s 2024-11-13 23:03:36,448 INFO: Deleting disabled build output repo/icons-480/com.politedroid.4.png 751s 2024-11-13 23:03:36,449 INFO: Deleting disabled build output archive/com.politedroid_4.apk 751s 2024-11-13 23:03:36,449 INFO: Deleting disabled build output archive/icons/com.politedroid.4.png 751s 2024-11-13 23:03:36,449 INFO: Deleting disabled build output archive/icons-320/com.politedroid.4.png 751s 2024-11-13 23:03:36,449 INFO: Deleting disabled build output archive/icons-240/com.politedroid.4.png 751s 2024-11-13 23:03:36,449 INFO: Deleting disabled build output archive/icons-160/com.politedroid.4.png 751s 2024-11-13 23:03:36,449 INFO: Deleting disabled build output archive/icons-120/com.politedroid.4.png 752s 2024-11-13 23:03:37,056 INFO: Creating unsigned index in preparation for signing 752s 2024-11-13 23:03:37,358 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 753s 2024-11-13 23:03:38,599 INFO: Creating unsigned index in preparation for signing 753s 2024-11-13 23:03:38,901 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 754s 2024-11-13 23:03:39,531 INFO: Finished 754s ++ grep '' archive/index.xml 754s ++ wc -l 754s + test 2 -eq 2 754s ++ grep '' repo/index.xml 754s ++ wc -l 754s + test 1 -eq 1 754s + grep -F com.politedroid_3.apk archive/index.xml 754s + grep -F com.politedroid_4.apk archive/index.xml 754s com.politedroid_3.apk 754s + grep -F com.politedroid_5.apk archive/index.xml 754s com.politedroid_5.apk 754s + grep -F com.politedroid_6.apk repo/index.xml 754s + test -e archive/com.politedroid_3.apk 754s + test -e archive/com.politedroid_4.apk 754s + test -e archive/com.politedroid_5.apk 754s + test -e repo/com.politedroid_6.apk 754s + sed -i.tmp 's/\(versionCode: 6\)/\1\n disable: testing deletion/' metadata/com.politedroid.yml 754s com.politedroid_6.apk 754s + /usr/bin/fdroid update --pretty --nosign 755s 2024-11-13 23:03:40,486 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 755s 2024-11-13 23:03:40,493 INFO: Deleting disabled build output repo/com.politedroid_6.apk 755s 2024-11-13 23:03:40,494 INFO: Deleting disabled build output repo/icons/com.politedroid.6.png 755s 2024-11-13 23:03:40,494 INFO: Deleting disabled build output repo/icons-640/com.politedroid.6.png 755s 2024-11-13 23:03:40,494 INFO: Deleting disabled build output repo/icons-480/com.politedroid.6.png 755s 2024-11-13 23:03:40,494 INFO: Deleting disabled build output repo/icons-320/com.politedroid.6.png 755s 2024-11-13 23:03:40,495 INFO: Deleting disabled build output repo/icons-240/com.politedroid.6.png 755s 2024-11-13 23:03:40,495 INFO: Deleting disabled build output repo/icons-160/com.politedroid.6.png 755s 2024-11-13 23:03:40,495 INFO: Deleting disabled build output repo/icons-120/com.politedroid.6.png 755s 2024-11-13 23:03:40,498 INFO: Moving com.politedroid_5.apk from archive to repo 756s 2024-11-13 23:03:41,106 INFO: Creating unsigned index in preparation for signing 756s 2024-11-13 23:03:41,410 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 757s 2024-11-13 23:03:42,667 INFO: Creating unsigned index in preparation for signing 758s 2024-11-13 23:03:42,971 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 758s 2024-11-13 23:03:43,611 INFO: Finished 758s ++ grep '' archive/index.xml 758s ++ wc -l 758s + test 1 -eq 1 758s ++ grep '' repo/index.xml 758s ++ wc -l 758s com.politedroid_3.apk 758s com.politedroid_5.apk 758s + test 1 -eq 1 758s + grep -F com.politedroid_3.apk archive/index.xml 758s + grep -F com.politedroid_5.apk repo/index.xml 758s ============================================================================== 758s test that verify can succeed and fail 758s + grep -F com.politedroid_6.apk repo/index.xml 758s + test -e archive/com.politedroid_3.apk 758s + test -e repo/com.politedroid_5.apk 758s + test -e repo/com.politedroid_6.apk 758s + echo_header 'test that verify can succeed and fail' 758s ++ create_test_dir 758s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 758s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 758s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.HCa9 758s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.HCa9 758s + test -d tmp 758s + mkdir tmp 758s + test -d unsigned 758s + mkdir unsigned 758s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk tmp/ 758s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk unsigned/ 758s + /usr/bin/fdroid verify --reuse-remote-apk --verbose com.politedroid 759s 2024-11-13 23:03:44,367 DEBUG: ipfs_cid not found, skipping CIDv1 generation 759s 2024-11-13 23:03:44,367 INFO: Processing com.politedroid_6.apk 759s 2024-11-13 23:03:44,735 DEBUG: tmp/com.politedroid_6.apk: Verifies 759s Verified using v1 scheme (JAR signing): true 759s Verified using v2 scheme (APK Signature Scheme v2): false 759s Verified using v3 scheme (APK Signature Scheme v3): false 759s Verified using v4 scheme (APK Signature Scheme v4): false 759s Verified for SourceStamp: false 759s Number of signers: 1 759s 760s 2024-11-13 23:03:45,115 DEBUG: tmp/sigcp_com.politedroid_6.apk: Verifies 760s Verified using v1 scheme (JAR signing): true 760s Verified using v2 scheme (APK Signature Scheme v2): false 760s Verified using v3 scheme (APK Signature Scheme v3): false 760s Verified using v4 scheme (APK Signature Scheme v4): false 760s Verified for SourceStamp: false 760s Number of signers: 1 760s 760s 2024-11-13 23:03:45,115 INFO: ...successfully verified 760s 2024-11-13 23:03:45,115 INFO: ...successfully verified 760s 2024-11-13 23:03:45,115 INFO: 1 successfully verified 760s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk unsigned/com.politedroid_6.apk 760s + /usr/bin/fdroid verify --reuse-remote-apk --verbose com.politedroid 760s 2024-11-13 23:03:45,708 DEBUG: ipfs_cid not found, skipping CIDv1 generation 760s 2024-11-13 23:03:45,709 INFO: Processing com.politedroid_6.apk 761s 2024-11-13 23:03:46,153 DEBUG: tmp/com.politedroid_6.apk: Verifies 761s Verified using v1 scheme (JAR signing): true 761s Verified using v2 scheme (APK Signature Scheme v2): false 761s Verified using v3 scheme (APK Signature Scheme v3): false 761s Verified using v4 scheme (APK Signature Scheme v4): false 761s Verified for SourceStamp: false 761s Number of signers: 1 761s 761s DOES NOT VERIFY 761s ERROR: res/drawable-ldpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 761s ERROR: res/drawable-mdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 761s ERROR: res/drawable-hdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 761s ERROR: res/drawable-xhdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 761s 2024-11-13 23:03:46,395 ERROR: 761s tmp/sigcp_com.politedroid_6.apk: 761s 2024-11-13 23:03:46,395 INFO: ...NOT verified - tmp/sigcp_com.politedroid_6.apk 761s 2024-11-13 23:03:46,399 DEBUG: > diff -r tmp/tmp_com.politedroid_6 tmp/tmp_sigcp_com.politedroid_6 761s 2024-11-13 23:03:46,602 INFO: ...NOT verified - verification of APK with copied signature failed 761s Comparing reference APK to APK with copied signature... 761s Unexpected diff output: 761s Binary files tmp/tmp_com.politedroid_6/content/AndroidManifest.xml and tmp/tmp_sigcp_com.politedroid_6/content/AndroidManifest.xml differ 761s Binary files tmp/tmp_com.politedroid_6/content/classes.dex and tmp/tmp_sigcp_com.politedroid_6/content/classes.dex differ 761s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-hdpi 761s Only in tmp/tmp_com.politedroid_6/content/res: drawable-hdpi-v4 761s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-ldpi 761s Only in tmp/tmp_com.politedroid_6/content/res: drawable-ldpi-v4 761s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-mdpi 761s Only in tmp/tmp_com.politedroid_6/content/res: drawable-mdpi-v4 761s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-xhdpi 761s Only in tmp/tmp_com.politedroid_6/content/res: drawable-xhdpi-v4 761s Binary files tmp/tmp_com.politedroid_6/content/res/xml/preferences.xml and tmp/tmp_sigcp_com.politedroid_6/content/res/xml/preferences.xml differ 761s Binary files tmp/tmp_com.politedroid_6/content/resources.arsc and tmp/tmp_sigcp_com.politedroid_6/content/resources.arsc differ 761s 761s 2024-11-13 23:03:46,602 INFO: 1 NOT verified 761s + echo_header 'test allowing disabled signatures in repo and archive' 761s ++ create_test_dir 761s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 761s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 761s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.N2g4 761s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.N2g4 761s + fdroid_init_with_prebuilt_keystore 761s + '[' -z '' ']' 761s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 761s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 761s ============================================================================== 761s test allowing disabled signatures in repo and archive 762s 762s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.N2g4" with this config: 762s 762s Android SDK: /usr/lib/android-sdk 762s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 762s Alias for key in store: sova 762s 762s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.N2g4/repo" 762s then run "fdroid update -c; fdroid update". You might also want to edit 762s "config.yml" to set the URL, repo name, and more. You should also set up 762s a signing key (a temporary one might have been automatically generated). 762s 762s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 762s and https://f-droid.org/docs/Signing_Process 762s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 762s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 762s + echo 'allow_disabled_algorithms: true' 762s + printf '\narchive_older: 3\n' 762s + test -d metadata 762s + mkdir metadata 762s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/com.politedroid.yml metadata/ 762s + echo 'Summary: good test version of urzip' 762s + echo 'Summary: good MD5 sig, disabled algorithm' 762s + sed -i.tmp /ArchivePolicy:/d metadata/com.politedroid.yml metadata/info.guardianproject.urzip.yml metadata/org.bitbucket.tickytacky.mirrormirror.yml 762s + test -d repo 762s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-badsig.apk repo/ 762s + /usr/bin/fdroid update --pretty --nosign 762s 2024-11-13 23:03:47,855 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 766s 2024-11-13 23:03:51,297 WARNING: repo/urzip-badsig.apk: debuggable or testOnly set in AndroidManifest.xml 766s DOES NOT VERIFY 766s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 766s 2024-11-13 23:03:51,631 ERROR: 766s repo/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 766s 767s 2024-11-13 23:03:52,057 WARNING: Archiving urzip-badsig.apk with invalid signature! 767s 2024-11-13 23:03:52,057 INFO: Moving urzip-badsig.apk from repo to archive 767s 2024-11-13 23:03:52,071 WARNING: archive/urzip-badsig.apk: debuggable or testOnly set in AndroidManifest.xml 767s DOES NOT VERIFY 767s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 767s 2024-11-13 23:03:52,402 ERROR: 767s archive/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 767s 767s 2024-11-13 23:03:52,815 WARNING: Archiving urzip-badsig.apk with invalid signature! 767s 2024-11-13 23:03:52,817 INFO: Moving com.politedroid_3.apk from repo to archive 767s 2024-11-13 23:03:52,817 INFO: Moving org.bitbucket.tickytacky.mirrormirror_1.apk from repo to archive 768s 2024-11-13 23:03:53,322 INFO: Creating unsigned index in preparation for signing 768s 2024-11-13 23:03:53,624 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 770s 2024-11-13 23:03:54,963 INFO: Creating unsigned index in preparation for signing 770s 2024-11-13 23:03:55,266 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 770s 2024-11-13 23:03:55,898 INFO: Finished 771s ++ wc -l 771s ++ grep '' archive/index.xml 771s + test 2 -eq 2 771s ++ grep '' repo/index.xml 771s ++ wc -l 771s + test 6 -eq 6 771s + grep -F com.politedroid_3.apk archive/index.xml 771s com.politedroid_3.apk 771s + grep -F com.politedroid_4.apk repo/index.xml 771s com.politedroid_4.apk 771s + grep -F com.politedroid_5.apk repo/index.xml 771s com.politedroid_5.apk 771s + grep -F com.politedroid_6.apk repo/index.xml 771s com.politedroid_6.apk 771s + grep -F org.bitbucket.tickytacky.mirrormirror_1.apk archive/index.xml 771s org.bitbucket.tickytacky.mirrormirror_1.apk 771s + grep -F org.bitbucket.tickytacky.mirrormirror_2.apk repo/index.xml 771s org.bitbucket.tickytacky.mirrormirror_2.apk 771s org.bitbucket.tickytacky.mirrormirror_3.apk 771s org.bitbucket.tickytacky.mirrormirror_4.apk 771s + grep -F org.bitbucket.tickytacky.mirrormirror_3.apk repo/index.xml 771s + grep -F org.bitbucket.tickytacky.mirrormirror_4.apk repo/index.xml 771s + grep -F urzip-badsig.apk repo/index.xml 771s + grep -F urzip-badsig.apk archive/index.xml 771s + test -e archive/com.politedroid_3.apk 771s + test -e repo/com.politedroid_4.apk 771s + test -e repo/com.politedroid_5.apk 771s + test -e repo/com.politedroid_6.apk 771s + test -e archive/org.bitbucket.tickytacky.mirrormirror_1.apk 771s + test -e repo/org.bitbucket.tickytacky.mirrormirror_2.apk 771s + test -e repo/org.bitbucket.tickytacky.mirrormirror_3.apk 771s + test -e repo/org.bitbucket.tickytacky.mirrormirror_4.apk 771s + test -e archive/urzip-badsig.apk 771s + sed -i.tmp /apksigner:/d config.yml 771s + use_apksigner 771s + python3 -c ' 771s import sys 771s sys.path.insert(0, '\''/tmp/autopkgtest.BGvKMW/build.5vX/src'\'') 771s from fdroidserver import common 771s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 771s common.find_apksigner(c) 771s exit(c.get('\''apksigner'\'') is None) 771s ' 771s + echo 'allow_disabled_algorithms: true' 771s + /usr/bin/fdroid update --pretty --nosign 772s 2024-11-13 23:03:57,093 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 772s 2024-11-13 23:03:57,211 WARNING: archive/urzip-badsig.apk: debuggable or testOnly set in AndroidManifest.xml 772s DOES NOT VERIFY 772s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 772s 2024-11-13 23:03:57,548 ERROR: 772s archive/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 772s 773s 2024-11-13 23:03:57,974 WARNING: Archiving urzip-badsig.apk with invalid signature! 773s 2024-11-13 23:03:58,579 INFO: Creating unsigned index in preparation for signing 773s 2024-11-13 23:03:58,881 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 775s 2024-11-13 23:04:00,022 INFO: Creating unsigned index in preparation for signing 775s 2024-11-13 23:04:00,324 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 775s 2024-11-13 23:04:00,852 INFO: Finished 776s ++ grep '' archive/index.xml 776s ++ wc -l 776s com.politedroid_3.apk 776s + test 2 -eq 2 776s ++ grep '' repo/index.xml 776s ++ wc -l 776s + test 6 -eq 6 776s + grep -F com.politedroid_3.apk archive/index.xml 776s + grep -F com.politedroid_4.apk repo/index.xml 776s com.politedroid_4.apk 776s + grep -F com.politedroid_5.apk repo/index.xml 776s + grep -F com.politedroid_6.apk repo/index.xml 776s + grep -F org.bitbucket.tickytacky.mirrormirror_1.apk archive/index.xml 776s com.politedroid_5.apk 776s com.politedroid_6.apk 776s org.bitbucket.tickytacky.mirrormirror_1.apk 776s org.bitbucket.tickytacky.mirrormirror_2.apk 776s org.bitbucket.tickytacky.mirrormirror_3.apk 776s org.bitbucket.tickytacky.mirrormirror_4.apk 776s ============================================================================== 776s rename apks with `fdroid update --rename-apks`, --nosign for speed 776s + grep -F org.bitbucket.tickytacky.mirrormirror_2.apk repo/index.xml 776s + grep -F org.bitbucket.tickytacky.mirrormirror_3.apk repo/index.xml 776s + grep -F org.bitbucket.tickytacky.mirrormirror_4.apk repo/index.xml 776s + grep -F urzip-badsig.apk repo/index.xml 776s + grep -F urzip-badsig.apk archive/index.xml 776s + test -e archive/com.politedroid_3.apk 776s + test -e repo/com.politedroid_4.apk 776s + test -e repo/com.politedroid_5.apk 776s + test -e repo/com.politedroid_6.apk 776s + test -e archive/org.bitbucket.tickytacky.mirrormirror_1.apk 776s + test -e repo/org.bitbucket.tickytacky.mirrormirror_2.apk 776s + test -e repo/org.bitbucket.tickytacky.mirrormirror_3.apk 776s + test -e repo/org.bitbucket.tickytacky.mirrormirror_4.apk 776s + test -e archive/urzip-badsig.apk 776s + echo_header 'rename apks with `fdroid update --rename-apks`, --nosign for speed' 776s ++ create_test_dir 776s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 776s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 776s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.n5j0 776s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.n5j0 776s + fdroid_init_with_prebuilt_keystore 776s + '[' -z '' ']' 776s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 776s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 776s 776s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.n5j0" with this config: 776s 776s Android SDK: /usr/lib/android-sdk 776s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 776s Alias for key in store: sova 776s 776s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.n5j0/repo" 776s then run "fdroid update -c; fdroid update". You might also want to edit 776s "config.yml" to set the URL, repo name, and more. You should also set up 776s a signing key (a temporary one might have been automatically generated). 776s 776s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 776s and https://f-droid.org/docs/Signing_Process 776s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 776s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 776s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"' 776s + test -d metadata 776s + mkdir metadata 776s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/info.guardianproject.urzip.yml metadata/ 776s + test -d repo 776s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 'repo/asdfiuhk urzip-πÇÇπÇÇ现代汉语通用字-български-عربي1234 ö.apk' 776s + /usr/bin/fdroid update --rename-apks --pretty --nosign 777s 2024-11-13 23:04:02,123 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 777s 2024-11-13 23:04:02,241 WARNING: repo/asdfiuhk urzip-πÇÇπÇÇ现代汉语通用字-български-عربي1234 ö.apk: debuggable or testOnly set in AndroidManifest.xml 778s 2024-11-13 23:04:03,244 INFO: Creating unsigned index in preparation for signing 778s 2024-11-13 23:04:03,547 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 779s 2024-11-13 23:04:04,175 INFO: Finished 779s repo/index-v1.json: "apkName": "info.guardianproject.urzip_100.apk", 779s repo/index.xml: info.guardianproject.urzip_100.apk 779s + test -e repo/info.guardianproject.urzip_100.apk 779s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml 779s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk repo/ 779s + /usr/bin/fdroid update --rename-apks --pretty --nosign 780s 2024-11-13 23:04:04,973 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 780s 2024-11-13 23:04:05,091 WARNING: repo/info.guardianproject.urzip_100.apk: debuggable or testOnly set in AndroidManifest.xml 781s 2024-11-13 23:04:06,727 INFO: Creating unsigned index in preparation for signing 782s 2024-11-13 23:04:07,030 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 782s 2024-11-13 23:04:07,665 INFO: Finished 782s + test -e repo/info.guardianproject.urzip_100.apk 782s + test -e repo/info.guardianproject.urzip_100_b4964fd.apk 782s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml 782s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index-v1.json 782s repo/index-v1.json: "apkName": "info.guardianproject.urzip_100.apk", 782s repo/index.xml: info.guardianproject.urzip_100.apk 782s "apkName": "info.guardianproject.urzip_100_b4964fd.apk", 782s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index.xml 782s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk repo/ 782s + /usr/bin/fdroid update --rename-apks --pretty --nosign 783s 2024-11-13 23:04:08,296 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 783s 2024-11-13 23:04:08,410 WARNING: repo/info.guardianproject.urzip_100.apk: debuggable or testOnly set in AndroidManifest.xml 784s 2024-11-13 23:04:09,170 WARNING: Moving duplicate repo/info.guardianproject.urzip_100_b4964fd.apk to duplicates/repo/info.guardianproject.urzip_100_b4964fd.apk 784s 2024-11-13 23:04:09,776 INFO: Creating unsigned index in preparation for signing 785s 2024-11-13 23:04:10,079 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 785s 2024-11-13 23:04:10,709 INFO: Finished 785s + test -e repo/info.guardianproject.urzip_100.apk 785s + test -e repo/info.guardianproject.urzip_100_b4964fd.apk 785s + test -e duplicates/repo/info.guardianproject.urzip_100_b4964fd.apk 785s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml 785s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index-v1.json 785s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index.xml 785s + echo_header 'test for added date being set correctly for repo and archive' 785s ++ create_test_dir 785s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 785s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 785s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nava 785s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nava 785s + fdroid_init_with_prebuilt_keystore 785s + '[' -z '' ']' 785s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 785s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 785s repo/index-v1.json: "apkName": "info.guardianproject.urzip_100.apk", 785s repo/index.xml: info.guardianproject.urzip_100.apk 785s "apkName": "info.guardianproject.urzip_100_b4964fd.apk", 785s ============================================================================== 785s test for added date being set correctly for repo and archive 786s 786s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nava" with this config: 786s 786s Android SDK: /usr/lib/android-sdk 786s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 786s Alias for key in store: sova 786s 786s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nava/repo" 786s then run "fdroid update -c; fdroid update". You might also want to edit 786s "config.yml" to set the URL, repo name, and more. You should also set up 786s a signing key (a temporary one might have been automatically generated). 786s 786s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 786s and https://f-droid.org/docs/Signing_Process 786s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 786s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 786s + printf '\narchive_older: 3\n' 786s + mkdir -p repo archive metadata stats 786s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk archive 786s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk repo 786s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/com.politedroid.yml metadata 786s + echo 'com.politedroid_4.apk com.politedroid 2016-01-01' 786s + echo 'com.politedroid_5.apk com.politedroid 2017-01-01' 786s + echo 'com.politedroid_6.apk com.politedroid 2018-01-01' 786s + sed -i -e 's/ArchivePolicy:.*/ArchivePolicy: 1 versions/' metadata/com.politedroid.yml 786s + timestamp=1483228800 786s + /usr/bin/fdroid update --pretty --nosign 787s 2024-11-13 23:04:11,986 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 788s 2024-11-13 23:04:13,364 INFO: Creating unsigned index in preparation for signing 788s 2024-11-13 23:04:13,666 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 789s 2024-11-13 23:04:14,899 INFO: Creating unsigned index in preparation for signing 790s 2024-11-13 23:04:15,201 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 790s 2024-11-13 23:04:15,829 INFO: Finished 791s + grep -F '"added": 1483228800' repo/index-v1.json 791s "added": 1483228800000, 791s ++ grep -F '"added": 1483228800' archive/index-v1.json 791s ++ wc -l 791s + '[' 2 == 2 ']' 791s + true 791s ============================================================================== 791s test whatsnew from fastlane without CVC set 791s + echo_header 'test whatsnew from fastlane without CVC set' 791s ++ create_test_dir 791s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 791s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 791s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.BLea 791s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.BLea 791s + fdroid_init_with_prebuilt_keystore 791s + '[' -z '' ']' 791s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 791s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 791s 791s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.BLea" with this config: 791s 791s Android SDK: /usr/lib/android-sdk 791s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 791s Alias for key in store: sova 791s 791s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.BLea/repo" 791s then run "fdroid update -c; fdroid update". You might also want to edit 791s "config.yml" to set the URL, repo name, and more. You should also set up 791s a signing key (a temporary one might have been automatically generated). 791s 791s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 791s and https://f-droid.org/docs/Signing_Process 791s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 791s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 791s + mkdir -p metadata/com.politedroid/en-US/changelogs/ 791s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk repo 791s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/com.politedroid.yml metadata 791s + echo 'whatsnew test' 791s + sed -i -e /CurrentVersion/d metadata/com.politedroid.yml 791s + /usr/bin/fdroid update --pretty --nosign 792s 2024-11-13 23:04:17,091 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 793s 2024-11-13 23:04:18,188 INFO: Creating unsigned index in preparation for signing 793s 2024-11-13 23:04:18,490 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 794s 2024-11-13 23:04:19,120 INFO: Finished 794s + grep -F whatsnew repo/index-v1.json 794s + echo_header 'test metadata checks' 794s ++ create_test_dir 794s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 794s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 794s "whatsNew": "whatsnew test\n" 794s ============================================================================== 794s test metadata checks 794s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.vzxh 794s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.vzxh 794s + mkdir repo 794s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.vzxh/repo/ 794s + set +e 794s + /usr/bin/fdroid build 794s 2024-11-13 23:04:19,847 CRITICAL: No app metadata found, nothing to process! 795s testing metadata checks passed 795s + '[' 1 -eq 0 ']' 795s + echo 'testing metadata checks passed' 795s + set -e 795s + mkdir /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.vzxh/metadata/ 795s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/org.smssecure.smssecure.yml /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.vzxh/metadata/ 795s + /usr/bin/fdroid readmeta 795s + echo_header 'ensure commands that don'\''t need the JDK work without a JDK configed' 795s ============================================================================== 795s ensure commands that don't need the JDK work without a JDK configed 795s ++ create_test_dir 795s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 795s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 795s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.dgzK 795s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.dgzK 795s + mkdir repo 795s + mkdir metadata 795s + echo 'License: GPL-2.0-only' 795s + echo 'Summary: Yup still fake' 795s + echo 'Categories: [Internet]' 795s + echo 'Description: |' 795s + echo ' this is fake' 795s + cat 795s ++ create_test_dir 795s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 795s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 795s + LOCAL_COPY_DIR=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.2zwx/fdroid 795s + mkdir -p /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.2zwx/fdroid/repo 795s + echo 'local_copy_dir: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.2zwx/fdroid' 795s + /usr/bin/fdroid checkupdates --allow-dirty 796s 2024-11-13 23:04:21,087 INFO: Processing fake 796s + which gpg 796s + /usr/bin/fdroid gpgsign 796s /usr/bin/gpg 796s + /usr/bin/fdroid lint 797s + /usr/bin/fdroid readmeta 798s + /usr/bin/fdroid rewritemeta fake 798s 2024-11-13 23:04:23,482 INFO: Rewriting 'fake' 798s + /usr/bin/fdroid deploy 799s + /usr/bin/fdroid deploy 799s + /usr/bin/fdroid scanner 800s + /usr/bin/fdroid build 801s usage: fdroid build [options] [APPID[:VERCODE] [APPID[:VERCODE] ...]] 801s fdroid build: error: option all: If you really want to build all the apps, use --all 801s + true 801s + /usr/bin/fdroid import 801s 2024-11-13 23:04:26,638 CRITICAL: Specify project url. 801s + true 801s + /usr/bin/fdroid install 802s usage: fdroid install [options] [APPID[:VERCODE] [APPID[:VERCODE] ...]] 802s fdroid install: error: option all: If you really want to install all the signed apps, use --all 802s ============================================================================== 802s test config checks of local_copy_dir 802s + true 802s + '[' -e .git/config ']' 802s + echo_header 'test config checks of local_copy_dir' 802s ++ create_test_dir 802s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 802s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 802s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.VF1w 802s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.VF1w 802s + /usr/bin/fdroid init 850s 850s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.VF1w" with this config: 850s 850s Android SDK: /usr/lib/android-sdk 850s Keystore for signing key: keystore.p12 850s 850s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.VF1w/repo" 850s then run "fdroid update -c; fdroid update". You might also want to edit 850s "config.yml" to set the URL, repo name, and more. You should also set up 850s a signing key (a temporary one might have been automatically generated). 850s 850s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 850s and https://f-droid.org/docs/Signing_Process 851s + /usr/bin/fdroid update --create-metadata --verbose 851s 2024-11-13 23:05:16,406 DEBUG: Reading 'config.yml' 851s 2024-11-13 23:05:16,421 DEBUG: ipfs_cid not found, skipping CIDv1 generation 851s 2024-11-13 23:05:16,422 DEBUG: skip deploying full build logs: not enabled in config 851s 2024-11-13 23:05:16,422 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 851s 2024-11-13 23:05:16,424 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 852s 2024-11-13 23:05:17,328 INFO: Creating signed index with this key (SHA256): 852s 2024-11-13 23:05:17,329 INFO: 21 63 3F 40 29 32 24 E3 82 60 2C 60 67 95 0A 02 9C 8E ED 04 9C 55 BB 70 96 64 D1 4F 1A 9A FE 18 852s 2024-11-13 23:05:17,329 DEBUG: Directory: repo 852s 2024-11-13 23:05:17,329 DEBUG: > jar cf index.jar index.xml 852s 2024-11-13 23:05:17,631 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 853s jar signed. 853s 853s Warning: 853s The signer's certificate is self-signed. 853s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 853s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 853s 2024-11-13 23:05:18,738 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 853s 2024-11-13 23:05:18,751 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 854s jar signed. 854s 854s Warning: 854s The signer's certificate is self-signed. 854s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 854s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 854s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 854s 2024-11-13 23:05:19,758 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias autopkgtest-lxd-fepetf.lxd --key-pass env:FDROID_KEY_PASS repo/entry.jar 855s 2024-11-13 23:05:20,561 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 856s 2024-11-13 23:05:21,278 DEBUG: Outputting JSON 856s 2024-11-13 23:05:21,279 DEBUG: skip deploying full build logs: not enabled in config 856s 2024-11-13 23:05:21,279 DEBUG: skip deploying full build logs: not enabled in config 856s 2024-11-13 23:05:21,279 DEBUG: skip deploying full build logs: not enabled in config 856s 2024-11-13 23:05:21,280 INFO: Finished 856s + /usr/bin/fdroid readmeta 857s ++ create_test_dir 857s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 857s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 857s + LOCAL_COPY_DIR=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.7OKm/fdroid 857s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.7OKm/fdroid 857s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.7OKm/fdroid --verbose 858s 2024-11-13 23:05:23,060 DEBUG: Reading 'config.yml' 858s 2024-11-13 23:05:23,075 DEBUG: ipfs_cid not found, skipping CIDv1 generation 858s 2024-11-13 23:05:23,075 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.7OKm/fdroid/ 858s sending incremental file list 858s repo/status/ 858s repo/status/deploy.json 858s repo/status/running.json 858s 858s sent 1,421 bytes received 70 bytes 2,982.00 bytes/sec 858s total size is 25,773 speedup is 17.29 858s 2024-11-13 23:05:23,124 DEBUG: skip deploying full build logs: not enabled in config 858s 2024-11-13 23:05:23,124 DEBUG: skip deploying full build logs: not enabled in config 858s 2024-11-13 23:05:23,124 DEBUG: skip deploying full build logs: not enabled in config 858s + set +e 858s + /usr/bin/fdroid deploy --local-copy-dir=thisisnotanabsolutepath 858s 2024-11-13 23:05:23,706 ERROR: The root dir for local_copy_dir "" does not exist! 858s + '[' 1 -eq 0 ']' 858s + echo 'testing absolute path checker passed' 858s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/IReallyDoubtThisPathExistsasdfasdf 858s testing absolute path checker passed 859s 2024-11-13 23:05:24,290 ERROR: local_copy_dir does not end with "fdroid", perhaps you meant: "/tmp/IReallyDoubtThisPathExistsasdfasdf/fdroid" 859s + '[' 1 -eq 0 ']' 859s + echo 'testing dirname exists checker passed' 859s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/IReallyDoubtThisPathExistsasdfasdf/fdroid 859s testing dirname exists checker passed 859s 2024-11-13 23:05:24,860 ERROR: The root dir for local_copy_dir "/tmp/IReallyDoubtThisPathExistsasdfasdf" does not exist! 860s + '[' 1 -eq 0 ']' 860s + echo 'testing dirname exists checker passed' 860s + set -e 860s + echo_header 'setup a new repo from scratch using ANDROID_HOME and do a local sync' 860s ++ create_test_dir 860s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 860s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 860s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.j8KP 860s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.j8KP 860s + fdroid_init_with_prebuilt_keystore 860s + '[' -z '' ']' 860s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 860s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 860s testing dirname exists checker passed 860s ============================================================================== 860s setup a new repo from scratch using ANDROID_HOME and do a local sync 860s 860s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.j8KP" with this config: 860s 860s Android SDK: /usr/lib/android-sdk 860s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 860s Alias for key in store: sova 860s 860s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.j8KP/repo" 860s then run "fdroid update -c; fdroid update". You might also want to edit 860s "config.yml" to set the URL, repo name, and more. You should also set up 860s a signing key (a temporary one might have been automatically generated). 860s 860s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 860s and https://f-droid.org/docs/Signing_Process 860s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 860s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 860s + copy_apks_into_repo /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.j8KP 860s + set +x 860s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/SpeedoMeterApp.main_1.apk 861s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 861s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 861s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 861s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk 862s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk --> repo/org.fdroid.ci_1.apk 862s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk 863s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk --> repo/android.appsecurity.cts.tinyapp_10.apk 863s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc2.apk 863s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3a.apk 864s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3b.apk 864s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 865s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 865s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 866s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 866s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 866s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 866s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 867s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 867s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk 867s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 867s [INFO ] androguard.apk: APK file was successfully validated! 867s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 867s [INFO ] androguard.apk: APK file was successfully validated! 867s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 867s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk 868s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk --> repo/org.sajeg.fallingblocks_3.apk 868s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk 869s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 869s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 869s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 869s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk 870s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 870s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk 870s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 870s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk 871s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 871s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk 871s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 871s [INFO ] androguard.apk: APK file was successfully validated! 872s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 872s [INFO ] androguard.apk: APK file was successfully validated! 872s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 872s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 872s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 872s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk 873s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 873s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk 874s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 874s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk 874s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 874s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk 875s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 875s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk 876s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 876s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk 876s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 876s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 877s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk 877s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 877s [INFO ] androguard.apk: APK file was successfully validated! 878s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 878s [INFO ] androguard.apk: APK file was successfully validated! 878s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 878s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 878s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 878s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk 879s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 879s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk 879s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 880s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk 881s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 881s + /usr/bin/fdroid update --create-metadata --verbose 882s 2024-11-13 23:05:47,292 DEBUG: Reading 'config.yml' 882s 2024-11-13 23:05:47,307 DEBUG: ipfs_cid not found, skipping CIDv1 generation 882s 2024-11-13 23:05:47,309 DEBUG: skip deploying full build logs: not enabled in config 882s 2024-11-13 23:05:47,309 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 882s 2024-11-13 23:05:47,311 DEBUG: Processing SpeedoMeterApp.main_1.apk 882s 2024-11-13 23:05:47,459 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 882s 2024-11-13 23:05:47,463 DEBUG: Using JAR Signature 882s 2024-11-13 23:05:47,468 DEBUG: Using JAR Signature 882s 2024-11-13 23:05:47,469 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 882s 2024-11-13 23:05:47,806 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 882s Verified using v1 scheme (JAR signing): true 882s Verified using v2 scheme (APK Signature Scheme v2): false 882s Verified using v3 scheme (APK Signature Scheme v3): false 882s Verified using v4 scheme (APK Signature Scheme v4): false 882s Verified for SourceStamp: false 882s Number of signers: 1 882s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 882s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 882s 882s 2024-11-13 23:05:47,807 DEBUG: Processing android.appsecurity.cts.tinyapp_10.apk 882s 2024-11-13 23:05:47,810 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 882s 2024-11-13 23:05:47,813 DEBUG: Getting signature of android.appsecurity.cts.tinyapp_10.apk 882s 2024-11-13 23:05:47,815 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 882s 2024-11-13 23:05:47,818 DEBUG: Using APK Signature v3 882s 2024-11-13 23:05:47,821 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 882s 2024-11-13 23:05:47,823 DEBUG: Using APK Signature v3 883s 2024-11-13 23:05:48,305 DEBUG: repo/android.appsecurity.cts.tinyapp_10.apk: Verifies 883s Verified using v1 scheme (JAR signing): false 883s Verified using v2 scheme (APK Signature Scheme v2): false 883s Verified using v3 scheme (APK Signature Scheme v3): true 883s Verified using v4 scheme (APK Signature Scheme v4): false 883s Verified for SourceStamp: false 883s Number of signers: 1 883s 883s 2024-11-13 23:05:48,306 DEBUG: Processing apk.embedded_1.apk 883s 2024-11-13 23:05:48,307 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 883s 2024-11-13 23:05:48,310 DEBUG: Getting signature of apk.embedded_1.apk 883s 2024-11-13 23:05:48,311 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 883s 2024-11-13 23:05:48,313 DEBUG: Using APK Signature v3 883s 2024-11-13 23:05:48,315 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 883s 2024-11-13 23:05:48,317 DEBUG: Using APK Signature v3 883s 2024-11-13 23:05:48,930 DEBUG: repo/apk.embedded_1.apk: Verifies 883s Verified using v1 scheme (JAR signing): true 883s Verified using v2 scheme (APK Signature Scheme v2): true 883s Verified using v3 scheme (APK Signature Scheme v3): true 883s Verified using v4 scheme (APK Signature Scheme v4): false 883s Verified for SourceStamp: false 883s Number of signers: 1 883s 883s 2024-11-13 23:05:48,930 DEBUG: Processing com.example.test.helloworld_1.apk 883s 2024-11-13 23:05:48,934 DEBUG: Getting signature of com.example.test.helloworld_1.apk 883s 2024-11-13 23:05:48,938 DEBUG: Using JAR Signature 883s 2024-11-13 23:05:48,942 DEBUG: Using JAR Signature 884s 2024-11-13 23:05:49,493 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 884s Verified using v1 scheme (JAR signing): true 884s Verified using v2 scheme (APK Signature Scheme v2): false 884s Verified using v3 scheme (APK Signature Scheme v3): false 884s Verified using v4 scheme (APK Signature Scheme v4): false 884s Verified for SourceStamp: false 884s Number of signers: 1 884s 884s 2024-11-13 23:05:49,495 DEBUG: Processing com.politedroid_3.apk 884s 2024-11-13 23:05:49,498 DEBUG: Getting signature of com.politedroid_3.apk 884s 2024-11-13 23:05:49,501 DEBUG: Using JAR Signature 884s 2024-11-13 23:05:49,505 DEBUG: Using JAR Signature 885s 2024-11-13 23:05:50,080 DEBUG: repo/com.politedroid_3.apk: Verifies 885s Verified using v1 scheme (JAR signing): true 885s Verified using v2 scheme (APK Signature Scheme v2): false 885s Verified using v3 scheme (APK Signature Scheme v3): false 885s Verified using v4 scheme (APK Signature Scheme v4): false 885s Verified for SourceStamp: false 885s Number of signers: 1 885s 885s 2024-11-13 23:05:50,089 DEBUG: Processing com.politedroid_4.apk 885s 2024-11-13 23:05:50,092 DEBUG: Getting signature of com.politedroid_4.apk 885s 2024-11-13 23:05:50,095 DEBUG: Using JAR Signature 885s 2024-11-13 23:05:50,098 DEBUG: Using JAR Signature 885s 2024-11-13 23:05:50,468 DEBUG: repo/com.politedroid_4.apk: Verifies 885s Verified using v1 scheme (JAR signing): true 885s Verified using v2 scheme (APK Signature Scheme v2): false 885s Verified using v3 scheme (APK Signature Scheme v3): false 885s Verified using v4 scheme (APK Signature Scheme v4): false 885s Verified for SourceStamp: false 885s Number of signers: 1 885s 885s 2024-11-13 23:05:50,470 DEBUG: Processing com.politedroid_5.apk 885s 2024-11-13 23:05:50,474 DEBUG: Getting signature of com.politedroid_5.apk 885s 2024-11-13 23:05:50,477 DEBUG: Using JAR Signature 885s 2024-11-13 23:05:50,480 DEBUG: Using JAR Signature 886s 2024-11-13 23:05:51,028 DEBUG: repo/com.politedroid_5.apk: Verifies 886s Verified using v1 scheme (JAR signing): true 886s Verified using v2 scheme (APK Signature Scheme v2): false 886s Verified using v3 scheme (APK Signature Scheme v3): false 886s Verified using v4 scheme (APK Signature Scheme v4): false 886s Verified for SourceStamp: false 886s Number of signers: 1 886s 886s 2024-11-13 23:05:51,031 DEBUG: Processing com.politedroid_6.apk 886s 2024-11-13 23:05:51,036 DEBUG: Getting signature of com.politedroid_6.apk 886s 2024-11-13 23:05:51,040 DEBUG: Using JAR Signature 886s 2024-11-13 23:05:51,044 DEBUG: Using JAR Signature 886s 2024-11-13 23:05:51,604 DEBUG: repo/com.politedroid_6.apk: Verifies 886s Verified using v1 scheme (JAR signing): true 886s Verified using v2 scheme (APK Signature Scheme v2): false 886s Verified using v3 scheme (APK Signature Scheme v3): false 886s Verified using v4 scheme (APK Signature Scheme v4): false 886s Verified for SourceStamp: false 886s Number of signers: 1 886s 886s 2024-11-13 23:05:51,608 DEBUG: Processing duplicate.permisssions_9999999.apk 886s 2024-11-13 23:05:51,617 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 886s 2024-11-13 23:05:51,622 DEBUG: Using APK Signature v2 886s 2024-11-13 23:05:51,629 DEBUG: Using APK Signature v2 886s 2024-11-13 23:05:51,632 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 887s 2024-11-13 23:05:52,060 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 887s Verified using v1 scheme (JAR signing): true 887s Verified using v2 scheme (APK Signature Scheme v2): true 887s Verified using v3 scheme (APK Signature Scheme v3): false 887s Verified using v4 scheme (APK Signature Scheme v4): false 887s Verified for SourceStamp: false 887s Number of signers: 1 887s 887s 2024-11-13 23:05:52,062 DEBUG: Density 120 not available, resizing down from 160 887s 2024-11-13 23:05:52,067 DEBUG: Processing info.guardianproject.urzip_100.apk 887s 2024-11-13 23:05:52,073 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 887s 2024-11-13 23:05:52,079 DEBUG: Using JAR Signature 887s 2024-11-13 23:05:52,085 DEBUG: Using JAR Signature 887s 2024-11-13 23:05:52,469 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 887s Verified using v1 scheme (JAR signing): true 887s Verified using v2 scheme (APK Signature Scheme v2): false 887s Verified using v3 scheme (APK Signature Scheme v3): false 887s Verified using v4 scheme (APK Signature Scheme v4): false 887s Verified for SourceStamp: false 887s Number of signers: 1 887s 887s 2024-11-13 23:05:52,470 DEBUG: Density 120 not available, resizing down from 160 887s 2024-11-13 23:05:52,473 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 887s 2024-11-13 23:05:52,477 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 887s 2024-11-13 23:05:52,480 DEBUG: Using JAR Signature 887s 2024-11-13 23:05:52,484 DEBUG: Using JAR Signature 888s 2024-11-13 23:05:53,045 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 888s Verified using v1 scheme (JAR signing): true 888s Verified using v2 scheme (APK Signature Scheme v2): false 888s Verified using v3 scheme (APK Signature Scheme v3): false 888s Verified using v4 scheme (APK Signature Scheme v4): false 888s Verified for SourceStamp: false 888s Number of signers: 1 888s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 888s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 888s 888s 2024-11-13 23:05:53,046 DEBUG: Processing no.min.target.sdk_987.apk 888s 2024-11-13 23:05:53,049 DEBUG: Getting signature of no.min.target.sdk_987.apk 888s 2024-11-13 23:05:53,053 DEBUG: Using APK Signature v2 888s 2024-11-13 23:05:53,056 DEBUG: Using APK Signature v2 888s 2024-11-13 23:05:53,057 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 888s 2024-11-13 23:05:53,649 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 888s Verified using v1 scheme (JAR signing): true 888s Verified using v2 scheme (APK Signature Scheme v2): true 888s Verified using v3 scheme (APK Signature Scheme v3): false 888s Verified using v4 scheme (APK Signature Scheme v4): false 888s Verified for SourceStamp: false 888s Number of signers: 1 888s 888s 2024-11-13 23:05:53,651 DEBUG: Density 120 not available, resizing down from 160 888s 2024-11-13 23:05:53,654 DEBUG: Processing obb.main.oldversion_1444412523.apk 888s 2024-11-13 23:05:53,661 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 888s 2024-11-13 23:05:53,667 DEBUG: Using APK Signature v2 888s 2024-11-13 23:05:53,673 DEBUG: Using APK Signature v2 889s 2024-11-13 23:05:54,096 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 889s Verified using v1 scheme (JAR signing): true 889s Verified using v2 scheme (APK Signature Scheme v2): true 889s Verified using v3 scheme (APK Signature Scheme v3): false 889s Verified using v4 scheme (APK Signature Scheme v4): false 889s Verified for SourceStamp: false 889s Number of signers: 1 889s 889s 2024-11-13 23:05:54,097 DEBUG: Density 120 not available, resizing down from 160 889s 2024-11-13 23:05:54,099 DEBUG: Processing obb.main.twoversions_1101613.apk 889s 2024-11-13 23:05:54,103 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 889s 2024-11-13 23:05:54,107 DEBUG: Using JAR Signature 889s 2024-11-13 23:05:54,111 DEBUG: Using JAR Signature 889s 2024-11-13 23:05:54,485 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 889s Verified using v1 scheme (JAR signing): true 889s Verified using v2 scheme (APK Signature Scheme v2): false 889s Verified using v3 scheme (APK Signature Scheme v3): false 889s Verified using v4 scheme (APK Signature Scheme v4): false 889s Verified for SourceStamp: false 889s Number of signers: 1 889s 889s 2024-11-13 23:05:54,486 DEBUG: Density 120 not available, resizing down from 160 889s 2024-11-13 23:05:54,488 DEBUG: Processing obb.main.twoversions_1101615.apk 889s 2024-11-13 23:05:54,492 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 889s 2024-11-13 23:05:54,496 DEBUG: Using JAR Signature 889s 2024-11-13 23:05:54,500 DEBUG: Using JAR Signature 889s 2024-11-13 23:05:54,862 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 889s Verified using v1 scheme (JAR signing): true 889s Verified using v2 scheme (APK Signature Scheme v2): false 889s Verified using v3 scheme (APK Signature Scheme v3): false 889s Verified using v4 scheme (APK Signature Scheme v4): false 889s Verified for SourceStamp: false 889s Number of signers: 1 889s 889s 2024-11-13 23:05:54,863 DEBUG: Density 120 not available, resizing down from 160 889s 2024-11-13 23:05:54,865 DEBUG: Processing obb.main.twoversions_1101617.apk 889s 2024-11-13 23:05:54,869 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 889s 2024-11-13 23:05:54,873 DEBUG: Using JAR Signature 889s 2024-11-13 23:05:54,877 DEBUG: Using JAR Signature 890s 2024-11-13 23:05:55,253 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 890s Verified using v1 scheme (JAR signing): true 890s Verified using v2 scheme (APK Signature Scheme v2): false 890s Verified using v3 scheme (APK Signature Scheme v3): false 890s Verified using v4 scheme (APK Signature Scheme v4): false 890s Verified for SourceStamp: false 890s Number of signers: 1 890s 890s 2024-11-13 23:05:55,254 DEBUG: Density 120 not available, resizing down from 160 890s 2024-11-13 23:05:55,256 DEBUG: Processing obb.mainpatch.current_1619.apk 890s 2024-11-13 23:05:55,261 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 890s 2024-11-13 23:05:55,264 DEBUG: Using JAR Signature 890s 2024-11-13 23:05:55,268 DEBUG: Using JAR Signature 890s 2024-11-13 23:05:55,684 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 890s Verified using v1 scheme (JAR signing): true 890s Verified using v2 scheme (APK Signature Scheme v2): false 890s Verified using v3 scheme (APK Signature Scheme v3): false 890s Verified using v4 scheme (APK Signature Scheme v4): false 890s Verified for SourceStamp: false 890s Number of signers: 1 890s 890s 2024-11-13 23:05:55,685 DEBUG: Density 120 not available, resizing down from 160 890s 2024-11-13 23:05:55,687 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 890s 2024-11-13 23:05:55,690 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 890s 2024-11-13 23:05:55,693 DEBUG: Using JAR Signature 890s 2024-11-13 23:05:55,696 DEBUG: Using JAR Signature 891s 2024-11-13 23:05:56,059 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 891s Verified using v1 scheme (JAR signing): true 891s Verified using v2 scheme (APK Signature Scheme v2): false 891s Verified using v3 scheme (APK Signature Scheme v3): false 891s Verified using v4 scheme (APK Signature Scheme v4): false 891s Verified for SourceStamp: false 891s Number of signers: 1 891s 891s 2024-11-13 23:05:56,060 DEBUG: Density 120 not available, resizing down from 160 891s 2024-11-13 23:05:56,062 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 891s 2024-11-13 23:05:56,065 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 891s 2024-11-13 23:05:56,068 DEBUG: Using JAR Signature 891s 2024-11-13 23:05:56,072 DEBUG: Using JAR Signature 891s 2024-11-13 23:05:56,425 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 891s Verified using v1 scheme (JAR signing): true 891s Verified using v2 scheme (APK Signature Scheme v2): false 891s Verified using v3 scheme (APK Signature Scheme v3): false 891s Verified using v4 scheme (APK Signature Scheme v4): false 891s Verified for SourceStamp: false 891s Number of signers: 1 891s 891s 2024-11-13 23:05:56,425 DEBUG: Density 120 not available, resizing down from 160 891s 2024-11-13 23:05:56,427 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 891s 2024-11-13 23:05:56,431 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 891s 2024-11-13 23:05:56,434 DEBUG: Using JAR Signature 891s 2024-11-13 23:05:56,437 DEBUG: Using JAR Signature 892s 2024-11-13 23:05:57,056 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 892s Verified using v1 scheme (JAR signing): true 892s Verified using v2 scheme (APK Signature Scheme v2): false 892s Verified using v3 scheme (APK Signature Scheme v3): false 892s Verified using v4 scheme (APK Signature Scheme v4): false 892s Verified for SourceStamp: false 892s Number of signers: 1 892s 892s 2024-11-13 23:05:57,057 DEBUG: Density 120 not available, resizing down from 160 892s 2024-11-13 23:05:57,059 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 892s 2024-11-13 23:05:57,063 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 892s 2024-11-13 23:05:57,066 DEBUG: Using JAR Signature 892s 2024-11-13 23:05:57,070 DEBUG: Using JAR Signature 892s 2024-11-13 23:05:57,442 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 892s Verified using v1 scheme (JAR signing): true 892s Verified using v2 scheme (APK Signature Scheme v2): false 892s Verified using v3 scheme (APK Signature Scheme v3): false 892s Verified using v4 scheme (APK Signature Scheme v4): false 892s Verified for SourceStamp: false 892s Number of signers: 1 892s 892s 2024-11-13 23:05:57,443 DEBUG: Density 120 not available, resizing down from 160 892s 2024-11-13 23:05:57,445 DEBUG: Processing org.dyndns.fules.ck_20.apk 892s 2024-11-13 23:05:57,452 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 892s 2024-11-13 23:05:57,455 DEBUG: Using JAR Signature 892s 2024-11-13 23:05:57,459 DEBUG: Using JAR Signature 892s 2024-11-13 23:05:57,905 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 892s Verified using v1 scheme (JAR signing): true 892s Verified using v2 scheme (APK Signature Scheme v2): false 892s Verified using v3 scheme (APK Signature Scheme v3): false 892s Verified using v4 scheme (APK Signature Scheme v4): false 892s Verified for SourceStamp: false 892s Number of signers: 1 892s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 892s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 892s 892s 2024-11-13 23:05:57,910 DEBUG: Processing org.fdroid.ci_1.apk 892s 2024-11-13 23:05:57,913 DEBUG: Getting signature of org.fdroid.ci_1.apk 892s 2024-11-13 23:05:57,915 DEBUG: Using APK Signature v3 892s 2024-11-13 23:05:57,917 DEBUG: Using APK Signature v3 893s 2024-11-13 23:05:58,261 DEBUG: repo/org.fdroid.ci_1.apk: Verifies 893s Verified using v1 scheme (JAR signing): false 893s Verified using v2 scheme (APK Signature Scheme v2): false 893s Verified using v3 scheme (APK Signature Scheme v3): true 893s Verified using v4 scheme (APK Signature Scheme v4): false 893s Verified for SourceStamp: false 893s Number of signers: 1 893s 893s 2024-11-13 23:05:58,261 DEBUG: Processing org.sajeg.fallingblocks_3.apk 893s 2024-11-13 23:05:58,264 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 893s 2024-11-13 23:05:58,276 DEBUG: Ignoring bad element in manifest: 893s 2024-11-13 23:05:58,276 DEBUG: Ignoring bad element in manifest: 893s 2024-11-13 23:05:58,277 DEBUG: Ignoring bad element in manifest: 893s 2024-11-13 23:05:58,277 DEBUG: Getting signature of org.sajeg.fallingblocks_3.apk 893s 2024-11-13 23:05:58,280 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 893s 2024-11-13 23:05:58,282 DEBUG: Using APK Signature v3 893s 2024-11-13 23:05:58,285 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 893s 2024-11-13 23:05:58,287 DEBUG: Using APK Signature v3 893s 2024-11-13 23:05:58,892 DEBUG: repo/org.sajeg.fallingblocks_3.apk: Verifies 893s Verified using v1 scheme (JAR signing): true 893s Verified using v2 scheme (APK Signature Scheme v2): true 893s Verified using v3 scheme (APK Signature Scheme v3): true 893s Verified using v4 scheme (APK Signature Scheme v4): false 893s Verified for SourceStamp: false 893s Number of signers: 1 893s 893s 2024-11-13 23:05:58,892 DEBUG: Processing souch.smsbypass_9.apk 893s 2024-11-13 23:05:58,898 DEBUG: Getting signature of souch.smsbypass_9.apk 893s 2024-11-13 23:05:58,902 DEBUG: Using JAR Signature 893s 2024-11-13 23:05:58,906 DEBUG: Using JAR Signature 894s 2024-11-13 23:05:59,291 DEBUG: repo/souch.smsbypass_9.apk: Verifies 894s Verified using v1 scheme (JAR signing): true 894s Verified using v2 scheme (APK Signature Scheme v2): false 894s Verified using v3 scheme (APK Signature Scheme v3): false 894s Verified using v4 scheme (APK Signature Scheme v4): false 894s Verified for SourceStamp: false 894s Number of signers: 1 894s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 894s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 894s 894s 2024-11-13 23:05:59,292 DEBUG: Density 120 not available, resizing down from 160 894s 2024-11-13 23:05:59,295 DEBUG: Processing v1.v2.sig_1020.apk 894s 2024-11-13 23:05:59,299 DEBUG: Getting signature of v1.v2.sig_1020.apk 894s 2024-11-13 23:05:59,302 DEBUG: Using APK Signature v2 894s 2024-11-13 23:05:59,305 DEBUG: Using APK Signature v2 894s 2024-11-13 23:05:59,705 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 894s Verified using v1 scheme (JAR signing): true 894s Verified using v2 scheme (APK Signature Scheme v2): true 894s Verified using v3 scheme (APK Signature Scheme v3): false 894s Verified using v4 scheme (APK Signature Scheme v4): false 894s Verified for SourceStamp: false 894s Number of signers: 1 894s 894s 2024-11-13 23:05:59,705 DEBUG: Density 120 not available, resizing down from 160 894s 2024-11-13 23:05:59,708 DEBUG: Processing v2.only.sig_2.apk 894s 2024-11-13 23:05:59,711 DEBUG: Getting signature of v2.only.sig_2.apk 894s 2024-11-13 23:05:59,714 DEBUG: Using APK Signature v2 894s 2024-11-13 23:05:59,718 DEBUG: Using APK Signature v2 895s 2024-11-13 23:06:00,203 DEBUG: repo/v2.only.sig_2.apk: Verifies 895s Verified using v1 scheme (JAR signing): false 895s Verified using v2 scheme (APK Signature Scheme v2): true 895s Verified using v3 scheme (APK Signature Scheme v3): false 895s Verified using v4 scheme (APK Signature Scheme v4): false 895s Verified for SourceStamp: false 895s Number of signers: 1 895s 895s 2024-11-13 23:06:00,204 DEBUG: Density 120 not available, resizing down from 160 895s 2024-11-13 23:06:00,207 INFO: Generated skeleton metadata for SpeedoMeterApp.main 895s 2024-11-13 23:06:00,211 INFO: Generated skeleton metadata for android.appsecurity.cts.tinyapp 895s 2024-11-13 23:06:00,214 INFO: Generated skeleton metadata for apk.embedded 895s 2024-11-13 23:06:00,217 INFO: Generated skeleton metadata for com.example.test.helloworld 895s 2024-11-13 23:06:00,220 INFO: Generated skeleton metadata for com.politedroid 895s 2024-11-13 23:06:00,225 INFO: Generated skeleton metadata for duplicate.permisssions 895s 2024-11-13 23:06:00,229 INFO: Generated skeleton metadata for info.guardianproject.urzip 895s 2024-11-13 23:06:00,235 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 895s 2024-11-13 23:06:00,241 INFO: Generated skeleton metadata for no.min.target.sdk 895s 2024-11-13 23:06:00,247 INFO: Generated skeleton metadata for obb.main.oldversion 895s 2024-11-13 23:06:00,254 INFO: Generated skeleton metadata for obb.main.twoversions 895s 2024-11-13 23:06:00,262 INFO: Generated skeleton metadata for obb.mainpatch.current 895s 2024-11-13 23:06:00,271 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 895s 2024-11-13 23:06:00,280 INFO: Generated skeleton metadata for org.dyndns.fules.ck 895s 2024-11-13 23:06:00,289 INFO: Generated skeleton metadata for org.fdroid.ci 895s 2024-11-13 23:06:00,299 INFO: Generated skeleton metadata for org.sajeg.fallingblocks 895s 2024-11-13 23:06:00,310 INFO: Generated skeleton metadata for souch.smsbypass 895s 2024-11-13 23:06:00,321 INFO: Generated skeleton metadata for v1.v2.sig 895s 2024-11-13 23:06:00,333 INFO: Generated skeleton metadata for v2.only.sig 895s 2024-11-13 23:06:00,349 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 895s 895s Warning: 895s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 896s 2024-11-13 23:06:01,161 INFO: Creating signed index with this key (SHA256): 896s 2024-11-13 23:06:01,161 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 896s 2024-11-13 23:06:01,161 DEBUG: Directory: repo 896s 2024-11-13 23:06:01,161 DEBUG: > jar cf index.jar index.xml 896s 2024-11-13 23:06:01,464 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 897s jar signed. 897s 897s Warning: 897s The signer's certificate is self-signed. 897s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 897s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 897s 2024-11-13 23:06:02,370 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 897s 2024-11-13 23:06:02,381 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 898s jar signed. 898s 898s Warning: 898s The signer's certificate is self-signed. 898s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 898s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 898s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 898s 2024-11-13 23:06:03,594 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 899s 2024-11-13 23:06:04,398 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 899s 899s Warning: 899s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 900s 2024-11-13 23:06:05,122 DEBUG: Outputting JSON 900s 2024-11-13 23:06:05,123 DEBUG: skip deploying full build logs: not enabled in config 900s 2024-11-13 23:06:05,124 DEBUG: skip deploying full build logs: not enabled in config 900s 2024-11-13 23:06:05,125 DEBUG: skip deploying full build logs: not enabled in config 900s 2024-11-13 23:06:05,125 INFO: Finished 900s + /usr/bin/fdroid readmeta 901s + grep -F ' repo/SpeedoMeterApp.main_1.apk 943s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 944s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 944s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk 945s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk --> repo/org.fdroid.ci_1.apk 945s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk 945s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk --> repo/android.appsecurity.cts.tinyapp_10.apk 945s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc2.apk 946s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3a.apk 947s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3b.apk 947s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 948s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 948s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 949s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 949s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 950s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 950s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 950s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 950s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk 950s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 950s [INFO ] androguard.apk: APK file was successfully validated! 951s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 951s [INFO ] androguard.apk: APK file was successfully validated! 951s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 951s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk 952s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk --> repo/org.sajeg.fallingblocks_3.apk 952s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk 953s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 953s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 954s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 954s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk 954s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 954s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk 955s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 955s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk 956s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 956s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk 956s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 956s [INFO ] androguard.apk: APK file was successfully validated! 957s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 957s [INFO ] androguard.apk: APK file was successfully validated! 957s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 957s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 958s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 958s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk 959s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 959s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk 959s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 959s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk 960s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 960s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk 961s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 961s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk 961s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 961s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk 962s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 962s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 963s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk 963s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 963s [INFO ] androguard.apk: APK file was successfully validated! 964s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 964s [INFO ] androguard.apk: APK file was successfully validated! 964s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 964s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 964s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 964s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk 965s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 965s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk 966s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 966s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk 967s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 967s + /usr/bin/fdroid update --create-metadata --verbose 968s 2024-11-13 23:07:13,051 DEBUG: Reading 'config.yml' 968s 2024-11-13 23:07:13,068 DEBUG: ipfs_cid not found, skipping CIDv1 generation 968s 2024-11-13 23:07:13,070 DEBUG: skip deploying full build logs: not enabled in config 968s 2024-11-13 23:07:13,070 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 968s 2024-11-13 23:07:13,072 DEBUG: Processing SpeedoMeterApp.main_1.apk 968s 2024-11-13 23:07:13,227 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 968s 2024-11-13 23:07:13,231 DEBUG: Using JAR Signature 968s 2024-11-13 23:07:13,236 DEBUG: Using JAR Signature 968s 2024-11-13 23:07:13,237 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 968s 2024-11-13 23:07:13,594 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 968s Verified using v1 scheme (JAR signing): true 968s Verified using v2 scheme (APK Signature Scheme v2): false 968s Verified using v3 scheme (APK Signature Scheme v3): false 968s Verified using v4 scheme (APK Signature Scheme v4): false 968s Verified for SourceStamp: false 968s Number of signers: 1 968s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 968s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 968s 968s 2024-11-13 23:07:13,595 DEBUG: Processing android.appsecurity.cts.tinyapp_10.apk 968s 2024-11-13 23:07:13,598 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 968s 2024-11-13 23:07:13,601 DEBUG: Getting signature of android.appsecurity.cts.tinyapp_10.apk 968s 2024-11-13 23:07:13,604 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 968s 2024-11-13 23:07:13,606 DEBUG: Using APK Signature v3 968s 2024-11-13 23:07:13,609 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 968s 2024-11-13 23:07:13,611 DEBUG: Using APK Signature v3 969s 2024-11-13 23:07:14,116 DEBUG: repo/android.appsecurity.cts.tinyapp_10.apk: Verifies 969s Verified using v1 scheme (JAR signing): false 969s Verified using v2 scheme (APK Signature Scheme v2): false 969s Verified using v3 scheme (APK Signature Scheme v3): true 969s Verified using v4 scheme (APK Signature Scheme v4): false 969s Verified for SourceStamp: false 969s Number of signers: 1 969s 969s 2024-11-13 23:07:14,117 DEBUG: Processing apk.embedded_1.apk 969s 2024-11-13 23:07:14,120 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 969s 2024-11-13 23:07:14,123 DEBUG: Getting signature of apk.embedded_1.apk 969s 2024-11-13 23:07:14,125 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 969s 2024-11-13 23:07:14,128 DEBUG: Using APK Signature v3 969s 2024-11-13 23:07:14,131 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 969s 2024-11-13 23:07:14,134 DEBUG: Using APK Signature v3 969s 2024-11-13 23:07:14,536 DEBUG: repo/apk.embedded_1.apk: Verifies 969s Verified using v1 scheme (JAR signing): true 969s Verified using v2 scheme (APK Signature Scheme v2): true 969s Verified using v3 scheme (APK Signature Scheme v3): true 969s Verified using v4 scheme (APK Signature Scheme v4): false 969s Verified for SourceStamp: false 969s Number of signers: 1 969s 969s 2024-11-13 23:07:14,537 DEBUG: Processing com.example.test.helloworld_1.apk 969s 2024-11-13 23:07:14,543 DEBUG: Getting signature of com.example.test.helloworld_1.apk 969s 2024-11-13 23:07:14,548 DEBUG: Using JAR Signature 969s 2024-11-13 23:07:14,554 DEBUG: Using JAR Signature 969s 2024-11-13 23:07:14,910 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 969s Verified using v1 scheme (JAR signing): true 969s Verified using v2 scheme (APK Signature Scheme v2): false 969s Verified using v3 scheme (APK Signature Scheme v3): false 969s Verified using v4 scheme (APK Signature Scheme v4): false 969s Verified for SourceStamp: false 969s Number of signers: 1 969s 969s 2024-11-13 23:07:14,911 DEBUG: Processing com.politedroid_3.apk 969s 2024-11-13 23:07:14,917 DEBUG: Getting signature of com.politedroid_3.apk 969s 2024-11-13 23:07:14,921 DEBUG: Using JAR Signature 969s 2024-11-13 23:07:14,926 DEBUG: Using JAR Signature 970s 2024-11-13 23:07:15,328 DEBUG: repo/com.politedroid_3.apk: Verifies 970s Verified using v1 scheme (JAR signing): true 970s Verified using v2 scheme (APK Signature Scheme v2): false 970s Verified using v3 scheme (APK Signature Scheme v3): false 970s Verified using v4 scheme (APK Signature Scheme v4): false 970s Verified for SourceStamp: false 970s Number of signers: 1 970s 970s 2024-11-13 23:07:15,346 DEBUG: Processing com.politedroid_4.apk 970s 2024-11-13 23:07:15,354 DEBUG: Getting signature of com.politedroid_4.apk 970s 2024-11-13 23:07:15,359 DEBUG: Using JAR Signature 970s 2024-11-13 23:07:15,364 DEBUG: Using JAR Signature 970s 2024-11-13 23:07:15,897 DEBUG: repo/com.politedroid_4.apk: Verifies 970s Verified using v1 scheme (JAR signing): true 970s Verified using v2 scheme (APK Signature Scheme v2): false 970s Verified using v3 scheme (APK Signature Scheme v3): false 970s Verified using v4 scheme (APK Signature Scheme v4): false 970s Verified for SourceStamp: false 970s Number of signers: 1 970s 970s 2024-11-13 23:07:15,900 DEBUG: Processing com.politedroid_5.apk 970s 2024-11-13 23:07:15,904 DEBUG: Getting signature of com.politedroid_5.apk 970s 2024-11-13 23:07:15,906 DEBUG: Using JAR Signature 970s 2024-11-13 23:07:15,909 DEBUG: Using JAR Signature 971s 2024-11-13 23:07:16,283 DEBUG: repo/com.politedroid_5.apk: Verifies 971s Verified using v1 scheme (JAR signing): true 971s Verified using v2 scheme (APK Signature Scheme v2): false 971s Verified using v3 scheme (APK Signature Scheme v3): false 971s Verified using v4 scheme (APK Signature Scheme v4): false 971s Verified for SourceStamp: false 971s Number of signers: 1 971s 971s 2024-11-13 23:07:16,288 DEBUG: Processing com.politedroid_6.apk 971s 2024-11-13 23:07:16,295 DEBUG: Getting signature of com.politedroid_6.apk 971s 2024-11-13 23:07:16,302 DEBUG: Using JAR Signature 971s 2024-11-13 23:07:16,309 DEBUG: Using JAR Signature 971s 2024-11-13 23:07:16,921 DEBUG: repo/com.politedroid_6.apk: Verifies 971s Verified using v1 scheme (JAR signing): true 971s Verified using v2 scheme (APK Signature Scheme v2): false 971s Verified using v3 scheme (APK Signature Scheme v3): false 971s Verified using v4 scheme (APK Signature Scheme v4): false 971s Verified for SourceStamp: false 971s Number of signers: 1 971s 971s 2024-11-13 23:07:16,925 DEBUG: Processing duplicate.permisssions_9999999.apk 971s 2024-11-13 23:07:16,934 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 971s 2024-11-13 23:07:16,940 DEBUG: Using APK Signature v2 972s 2024-11-13 23:07:16,957 DEBUG: Using APK Signature v2 972s 2024-11-13 23:07:16,960 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 972s 2024-11-13 23:07:17,370 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 972s Verified using v1 scheme (JAR signing): true 972s Verified using v2 scheme (APK Signature Scheme v2): true 972s Verified using v3 scheme (APK Signature Scheme v3): false 972s Verified using v4 scheme (APK Signature Scheme v4): false 972s Verified for SourceStamp: false 972s Number of signers: 1 972s 972s 2024-11-13 23:07:17,371 DEBUG: Density 120 not available, resizing down from 160 972s 2024-11-13 23:07:17,376 DEBUG: Processing info.guardianproject.urzip_100.apk 972s 2024-11-13 23:07:17,383 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 972s 2024-11-13 23:07:17,388 DEBUG: Using JAR Signature 972s 2024-11-13 23:07:17,394 DEBUG: Using JAR Signature 973s 2024-11-13 23:07:17,998 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 973s Verified using v1 scheme (JAR signing): true 973s Verified using v2 scheme (APK Signature Scheme v2): false 973s Verified using v3 scheme (APK Signature Scheme v3): false 973s Verified using v4 scheme (APK Signature Scheme v4): false 973s Verified for SourceStamp: false 973s Number of signers: 1 973s 973s 2024-11-13 23:07:17,999 DEBUG: Density 120 not available, resizing down from 160 973s 2024-11-13 23:07:18,003 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 973s 2024-11-13 23:07:18,007 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 973s 2024-11-13 23:07:18,011 DEBUG: Using JAR Signature 973s 2024-11-13 23:07:18,014 DEBUG: Using JAR Signature 973s 2024-11-13 23:07:18,582 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 973s Verified using v1 scheme (JAR signing): true 973s Verified using v2 scheme (APK Signature Scheme v2): false 973s Verified using v3 scheme (APK Signature Scheme v3): false 973s Verified using v4 scheme (APK Signature Scheme v4): false 973s Verified for SourceStamp: false 973s Number of signers: 1 973s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 973s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 973s 973s 2024-11-13 23:07:18,584 DEBUG: Processing no.min.target.sdk_987.apk 973s 2024-11-13 23:07:18,588 DEBUG: Getting signature of no.min.target.sdk_987.apk 973s 2024-11-13 23:07:18,591 DEBUG: Using APK Signature v2 973s 2024-11-13 23:07:18,595 DEBUG: Using APK Signature v2 973s 2024-11-13 23:07:18,596 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 974s 2024-11-13 23:07:19,205 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 974s Verified using v1 scheme (JAR signing): true 974s Verified using v2 scheme (APK Signature Scheme v2): true 974s Verified using v3 scheme (APK Signature Scheme v3): false 974s Verified using v4 scheme (APK Signature Scheme v4): false 974s Verified for SourceStamp: false 974s Number of signers: 1 974s 974s 2024-11-13 23:07:19,206 DEBUG: Density 120 not available, resizing down from 160 974s 2024-11-13 23:07:19,208 DEBUG: Processing obb.main.oldversion_1444412523.apk 974s 2024-11-13 23:07:19,214 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 974s 2024-11-13 23:07:19,218 DEBUG: Using APK Signature v2 974s 2024-11-13 23:07:19,222 DEBUG: Using APK Signature v2 974s 2024-11-13 23:07:19,632 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 974s Verified using v1 scheme (JAR signing): true 974s Verified using v2 scheme (APK Signature Scheme v2): true 974s Verified using v3 scheme (APK Signature Scheme v3): false 974s Verified using v4 scheme (APK Signature Scheme v4): false 974s Verified for SourceStamp: false 974s Number of signers: 1 974s 974s 2024-11-13 23:07:19,633 DEBUG: Density 120 not available, resizing down from 160 974s 2024-11-13 23:07:19,635 DEBUG: Processing obb.main.twoversions_1101613.apk 974s 2024-11-13 23:07:19,640 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 974s 2024-11-13 23:07:19,643 DEBUG: Using JAR Signature 974s 2024-11-13 23:07:19,647 DEBUG: Using JAR Signature 975s 2024-11-13 23:07:20,220 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 975s Verified using v1 scheme (JAR signing): true 975s Verified using v2 scheme (APK Signature Scheme v2): false 975s Verified using v3 scheme (APK Signature Scheme v3): false 975s Verified using v4 scheme (APK Signature Scheme v4): false 975s Verified for SourceStamp: false 975s Number of signers: 1 975s 975s 2024-11-13 23:07:20,221 DEBUG: Density 120 not available, resizing down from 160 975s 2024-11-13 23:07:20,223 DEBUG: Processing obb.main.twoversions_1101615.apk 975s 2024-11-13 23:07:20,228 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 975s 2024-11-13 23:07:20,231 DEBUG: Using JAR Signature 975s 2024-11-13 23:07:20,235 DEBUG: Using JAR Signature 975s 2024-11-13 23:07:20,833 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 975s Verified using v1 scheme (JAR signing): true 975s Verified using v2 scheme (APK Signature Scheme v2): false 975s Verified using v3 scheme (APK Signature Scheme v3): false 975s Verified using v4 scheme (APK Signature Scheme v4): false 975s Verified for SourceStamp: false 975s Number of signers: 1 975s 975s 2024-11-13 23:07:20,834 DEBUG: Density 120 not available, resizing down from 160 975s 2024-11-13 23:07:20,836 DEBUG: Processing obb.main.twoversions_1101617.apk 975s 2024-11-13 23:07:20,840 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 975s 2024-11-13 23:07:20,843 DEBUG: Using JAR Signature 975s 2024-11-13 23:07:20,847 DEBUG: Using JAR Signature 976s 2024-11-13 23:07:21,266 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 976s Verified using v1 scheme (JAR signing): true 976s Verified using v2 scheme (APK Signature Scheme v2): false 976s Verified using v3 scheme (APK Signature Scheme v3): false 976s Verified using v4 scheme (APK Signature Scheme v4): false 976s Verified for SourceStamp: false 976s Number of signers: 1 976s 976s 2024-11-13 23:07:21,268 DEBUG: Density 120 not available, resizing down from 160 976s 2024-11-13 23:07:21,272 DEBUG: Processing obb.mainpatch.current_1619.apk 976s 2024-11-13 23:07:21,278 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 976s 2024-11-13 23:07:21,284 DEBUG: Using JAR Signature 976s 2024-11-13 23:07:21,289 DEBUG: Using JAR Signature 976s 2024-11-13 23:07:21,891 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 976s Verified using v1 scheme (JAR signing): true 976s Verified using v2 scheme (APK Signature Scheme v2): false 976s Verified using v3 scheme (APK Signature Scheme v3): false 976s Verified using v4 scheme (APK Signature Scheme v4): false 976s Verified for SourceStamp: false 976s Number of signers: 1 976s 976s 2024-11-13 23:07:21,892 DEBUG: Density 120 not available, resizing down from 160 976s 2024-11-13 23:07:21,897 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 976s 2024-11-13 23:07:21,903 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 976s 2024-11-13 23:07:21,908 DEBUG: Using JAR Signature 976s 2024-11-13 23:07:21,913 DEBUG: Using JAR Signature 977s 2024-11-13 23:07:22,327 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 977s Verified using v1 scheme (JAR signing): true 977s Verified using v2 scheme (APK Signature Scheme v2): false 977s Verified using v3 scheme (APK Signature Scheme v3): false 977s Verified using v4 scheme (APK Signature Scheme v4): false 977s Verified for SourceStamp: false 977s Number of signers: 1 977s 977s 2024-11-13 23:07:22,329 DEBUG: Density 120 not available, resizing down from 160 977s 2024-11-13 23:07:22,333 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 977s 2024-11-13 23:07:22,339 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 977s 2024-11-13 23:07:22,344 DEBUG: Using JAR Signature 977s 2024-11-13 23:07:22,348 DEBUG: Using JAR Signature 977s 2024-11-13 23:07:22,914 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 977s Verified using v1 scheme (JAR signing): true 977s Verified using v2 scheme (APK Signature Scheme v2): false 977s Verified using v3 scheme (APK Signature Scheme v3): false 977s Verified using v4 scheme (APK Signature Scheme v4): false 977s Verified for SourceStamp: false 977s Number of signers: 1 977s 977s 2024-11-13 23:07:22,915 DEBUG: Density 120 not available, resizing down from 160 977s 2024-11-13 23:07:22,917 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 977s 2024-11-13 23:07:22,921 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 977s 2024-11-13 23:07:22,924 DEBUG: Using JAR Signature 977s 2024-11-13 23:07:22,927 DEBUG: Using JAR Signature 978s 2024-11-13 23:07:23,506 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 978s Verified using v1 scheme (JAR signing): true 978s Verified using v2 scheme (APK Signature Scheme v2): false 978s Verified using v3 scheme (APK Signature Scheme v3): false 978s Verified using v4 scheme (APK Signature Scheme v4): false 978s Verified for SourceStamp: false 978s Number of signers: 1 978s 978s 2024-11-13 23:07:23,507 DEBUG: Density 120 not available, resizing down from 160 978s 2024-11-13 23:07:23,509 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 978s 2024-11-13 23:07:23,513 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 978s 2024-11-13 23:07:23,516 DEBUG: Using JAR Signature 978s 2024-11-13 23:07:23,519 DEBUG: Using JAR Signature 978s 2024-11-13 23:07:23,893 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 978s Verified using v1 scheme (JAR signing): true 978s Verified using v2 scheme (APK Signature Scheme v2): false 978s Verified using v3 scheme (APK Signature Scheme v3): false 978s Verified using v4 scheme (APK Signature Scheme v4): false 978s Verified for SourceStamp: false 978s Number of signers: 1 978s 978s 2024-11-13 23:07:23,894 DEBUG: Density 120 not available, resizing down from 160 978s 2024-11-13 23:07:23,896 DEBUG: Processing org.dyndns.fules.ck_20.apk 978s 2024-11-13 23:07:23,903 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 978s 2024-11-13 23:07:23,907 DEBUG: Using JAR Signature 978s 2024-11-13 23:07:23,911 DEBUG: Using JAR Signature 979s 2024-11-13 23:07:24,558 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 979s Verified using v1 scheme (JAR signing): true 979s Verified using v2 scheme (APK Signature Scheme v2): false 979s Verified using v3 scheme (APK Signature Scheme v3): false 979s Verified using v4 scheme (APK Signature Scheme v4): false 979s Verified for SourceStamp: false 979s Number of signers: 1 979s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 979s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 979s 979s 2024-11-13 23:07:24,561 DEBUG: Processing org.fdroid.ci_1.apk 979s 2024-11-13 23:07:24,564 DEBUG: Getting signature of org.fdroid.ci_1.apk 979s 2024-11-13 23:07:24,566 DEBUG: Using APK Signature v3 979s 2024-11-13 23:07:24,569 DEBUG: Using APK Signature v3 980s 2024-11-13 23:07:25,082 DEBUG: repo/org.fdroid.ci_1.apk: Verifies 980s Verified using v1 scheme (JAR signing): false 980s Verified using v2 scheme (APK Signature Scheme v2): false 980s Verified using v3 scheme (APK Signature Scheme v3): true 980s Verified using v4 scheme (APK Signature Scheme v4): false 980s Verified for SourceStamp: false 980s Number of signers: 1 980s 980s 2024-11-13 23:07:25,083 DEBUG: Processing org.sajeg.fallingblocks_3.apk 980s 2024-11-13 23:07:25,086 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 980s 2024-11-13 23:07:25,099 DEBUG: Ignoring bad element in manifest: 980s 2024-11-13 23:07:25,099 DEBUG: Ignoring bad element in manifest: 980s 2024-11-13 23:07:25,100 DEBUG: Ignoring bad element in manifest: 980s 2024-11-13 23:07:25,100 DEBUG: Getting signature of org.sajeg.fallingblocks_3.apk 980s 2024-11-13 23:07:25,103 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 980s 2024-11-13 23:07:25,105 DEBUG: Using APK Signature v3 980s 2024-11-13 23:07:25,108 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 980s 2024-11-13 23:07:25,110 DEBUG: Using APK Signature v3 980s 2024-11-13 23:07:25,557 DEBUG: repo/org.sajeg.fallingblocks_3.apk: Verifies 980s Verified using v1 scheme (JAR signing): true 980s Verified using v2 scheme (APK Signature Scheme v2): true 980s Verified using v3 scheme (APK Signature Scheme v3): true 980s Verified using v4 scheme (APK Signature Scheme v4): false 980s Verified for SourceStamp: false 980s Number of signers: 1 980s 980s 2024-11-13 23:07:25,557 DEBUG: Processing souch.smsbypass_9.apk 980s 2024-11-13 23:07:25,564 DEBUG: Getting signature of souch.smsbypass_9.apk 980s 2024-11-13 23:07:25,568 DEBUG: Using JAR Signature 980s 2024-11-13 23:07:25,572 DEBUG: Using JAR Signature 981s 2024-11-13 23:07:26,224 DEBUG: repo/souch.smsbypass_9.apk: Verifies 981s Verified using v1 scheme (JAR signing): true 981s Verified using v2 scheme (APK Signature Scheme v2): false 981s Verified using v3 scheme (APK Signature Scheme v3): false 981s Verified using v4 scheme (APK Signature Scheme v4): false 981s Verified for SourceStamp: false 981s Number of signers: 1 981s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 981s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 981s 981s 2024-11-13 23:07:26,226 DEBUG: Density 120 not available, resizing down from 160 981s 2024-11-13 23:07:26,228 DEBUG: Processing v1.v2.sig_1020.apk 981s 2024-11-13 23:07:26,232 DEBUG: Getting signature of v1.v2.sig_1020.apk 981s 2024-11-13 23:07:26,235 DEBUG: Using APK Signature v2 981s 2024-11-13 23:07:26,239 DEBUG: Using APK Signature v2 981s 2024-11-13 23:07:26,895 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 981s Verified using v1 scheme (JAR signing): true 981s Verified using v2 scheme (APK Signature Scheme v2): true 981s Verified using v3 scheme (APK Signature Scheme v3): false 981s Verified using v4 scheme (APK Signature Scheme v4): false 981s Verified for SourceStamp: false 981s Number of signers: 1 981s 981s 2024-11-13 23:07:26,896 DEBUG: Density 120 not available, resizing down from 160 981s 2024-11-13 23:07:26,898 DEBUG: Processing v2.only.sig_2.apk 981s 2024-11-13 23:07:26,902 DEBUG: Getting signature of v2.only.sig_2.apk 981s 2024-11-13 23:07:26,906 DEBUG: Using APK Signature v2 981s 2024-11-13 23:07:26,909 DEBUG: Using APK Signature v2 982s 2024-11-13 23:07:27,446 DEBUG: repo/v2.only.sig_2.apk: Verifies 982s Verified using v1 scheme (JAR signing): false 982s Verified using v2 scheme (APK Signature Scheme v2): true 982s Verified using v3 scheme (APK Signature Scheme v3): false 982s Verified using v4 scheme (APK Signature Scheme v4): false 982s Verified for SourceStamp: false 982s Number of signers: 1 982s 982s 2024-11-13 23:07:27,447 DEBUG: Density 120 not available, resizing down from 160 982s 2024-11-13 23:07:27,454 INFO: Generated skeleton metadata for SpeedoMeterApp.main 982s 2024-11-13 23:07:27,459 INFO: Generated skeleton metadata for android.appsecurity.cts.tinyapp 982s 2024-11-13 23:07:27,463 INFO: Generated skeleton metadata for apk.embedded 982s 2024-11-13 23:07:27,469 INFO: Generated skeleton metadata for com.example.test.helloworld 982s 2024-11-13 23:07:27,475 INFO: Generated skeleton metadata for com.politedroid 982s 2024-11-13 23:07:27,484 INFO: Generated skeleton metadata for duplicate.permisssions 982s 2024-11-13 23:07:27,492 INFO: Generated skeleton metadata for info.guardianproject.urzip 982s 2024-11-13 23:07:27,503 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 982s 2024-11-13 23:07:27,513 INFO: Generated skeleton metadata for no.min.target.sdk 982s 2024-11-13 23:07:27,526 INFO: Generated skeleton metadata for obb.main.oldversion 982s 2024-11-13 23:07:27,540 INFO: Generated skeleton metadata for obb.main.twoversions 982s 2024-11-13 23:07:27,555 INFO: Generated skeleton metadata for obb.mainpatch.current 982s 2024-11-13 23:07:27,570 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 982s 2024-11-13 23:07:27,586 INFO: Generated skeleton metadata for org.dyndns.fules.ck 982s 2024-11-13 23:07:27,603 INFO: Generated skeleton metadata for org.fdroid.ci 982s 2024-11-13 23:07:27,622 INFO: Generated skeleton metadata for org.sajeg.fallingblocks 982s 2024-11-13 23:07:27,642 INFO: Generated skeleton metadata for souch.smsbypass 982s 2024-11-13 23:07:27,663 INFO: Generated skeleton metadata for v1.v2.sig 982s 2024-11-13 23:07:27,685 INFO: Generated skeleton metadata for v2.only.sig 982s 2024-11-13 23:07:27,714 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.nhxt/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 983s 2024-11-13 23:07:28,931 INFO: Creating signed index with this key (SHA256): 983s 2024-11-13 23:07:28,932 INFO: 91 C3 10 41 18 18 14 92 01 66 34 98 98 19 13 9B 03 84 D1 DB 3A 94 40 71 4D 85 0B E2 A7 36 3D 4F 983s 2024-11-13 23:07:28,932 DEBUG: Directory: repo 983s 2024-11-13 23:07:28,932 DEBUG: > jar cf index.jar index.xml 984s 2024-11-13 23:07:29,339 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.nhxt/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 985s jar signed. 985s 985s Warning: 985s The signer's certificate is self-signed. 985s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 985s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 985s 2024-11-13 23:07:30,463 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 985s 2024-11-13 23:07:30,478 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.nhxt/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 986s jar signed. 986s 986s Warning: 986s The signer's certificate is self-signed. 986s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 986s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 986s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 986s 2024-11-13 23:07:31,899 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.nhxt/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias autopkgtest-lxd-fepetf.lxd --key-pass env:FDROID_KEY_PASS repo/entry.jar 988s 2024-11-13 23:07:33,004 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.nhxt/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 989s 2024-11-13 23:07:34,227 DEBUG: Outputting JSON 989s 2024-11-13 23:07:34,228 DEBUG: skip deploying full build logs: not enabled in config 989s 2024-11-13 23:07:34,229 DEBUG: skip deploying full build logs: not enabled in config 989s 2024-11-13 23:07:34,230 DEBUG: skip deploying full build logs: not enabled in config 989s 2024-11-13 23:07:34,230 INFO: Finished 989s + /usr/bin/fdroid readmeta 990s + grep -F ' repo/SpeedoMeterApp.main_1.apk 1006s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 1007s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 1007s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk 1008s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk --> repo/org.fdroid.ci_1.apk 1008s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk 1008s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk --> repo/android.appsecurity.cts.tinyapp_10.apk 1008s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc2.apk 1009s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3a.apk 1010s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3b.apk 1011s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 1012s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 1012s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 1013s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 1013s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 1014s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 1014s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 1015s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 1015s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk 1015s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1015s [INFO ] androguard.apk: APK file was successfully validated! 1015s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1015s [INFO ] androguard.apk: APK file was successfully validated! 1015s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 1015s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk 1016s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk --> repo/org.sajeg.fallingblocks_3.apk 1016s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk 1017s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 1017s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 1018s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 1018s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk 1019s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 1019s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk 1020s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 1020s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk 1020s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 1020s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk 1021s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1021s [INFO ] androguard.apk: APK file was successfully validated! 1021s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1021s [INFO ] androguard.apk: APK file was successfully validated! 1021s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 1021s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 1022s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 1022s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk 1023s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 1023s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk 1024s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 1024s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk 1024s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 1024s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk 1025s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 1025s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk 1026s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 1026s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk 1027s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 1027s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 1028s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk 1028s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1028s [INFO ] androguard.apk: APK file was successfully validated! 1028s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1028s [INFO ] androguard.apk: APK file was successfully validated! 1029s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 1029s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1030s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 1030s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk 1031s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 1031s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk 1031s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 1032s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk 1033s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 1033s + fdroid_init_with_prebuilt_keystore 1033s + '[' -z '' ']' 1033s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 1033s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 1033s 1033s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.L66L" with this config: 1033s 1033s Android SDK: /usr/lib/android-sdk 1033s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 1033s Alias for key in store: sova 1033s 1033s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.L66L/repo" 1033s then run "fdroid update -c; fdroid update". You might also want to edit 1033s "config.yml" to set the URL, repo name, and more. You should also set up 1033s a signing key (a temporary one might have been automatically generated). 1033s 1033s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 1033s and https://f-droid.org/docs/Signing_Process 1033s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 1033s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 1033s + /usr/bin/fdroid update --create-metadata --verbose 1034s 2024-11-13 23:08:19,267 DEBUG: Reading 'config.yml' 1034s 2024-11-13 23:08:19,281 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1034s 2024-11-13 23:08:19,282 DEBUG: skip deploying full build logs: not enabled in config 1034s 2024-11-13 23:08:19,282 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1034s 2024-11-13 23:08:19,283 DEBUG: Processing SpeedoMeterApp.main_1.apk 1034s 2024-11-13 23:08:19,380 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 1034s 2024-11-13 23:08:19,383 DEBUG: Using JAR Signature 1034s 2024-11-13 23:08:19,386 DEBUG: Using JAR Signature 1034s 2024-11-13 23:08:19,386 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 1034s 2024-11-13 23:08:19,733 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 1034s Verified using v1 scheme (JAR signing): true 1034s Verified using v2 scheme (APK Signature Scheme v2): false 1034s Verified using v3 scheme (APK Signature Scheme v3): false 1034s Verified using v4 scheme (APK Signature Scheme v4): false 1034s Verified for SourceStamp: false 1034s Number of signers: 1 1034s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1034s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1034s 1034s 2024-11-13 23:08:19,734 DEBUG: Processing android.appsecurity.cts.tinyapp_10.apk 1034s 2024-11-13 23:08:19,736 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1034s 2024-11-13 23:08:19,738 DEBUG: Getting signature of android.appsecurity.cts.tinyapp_10.apk 1034s 2024-11-13 23:08:19,739 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1034s 2024-11-13 23:08:19,741 DEBUG: Using APK Signature v3 1034s 2024-11-13 23:08:19,743 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1034s 2024-11-13 23:08:19,744 DEBUG: Using APK Signature v3 1035s 2024-11-13 23:08:20,061 DEBUG: repo/android.appsecurity.cts.tinyapp_10.apk: Verifies 1035s Verified using v1 scheme (JAR signing): false 1035s Verified using v2 scheme (APK Signature Scheme v2): false 1035s Verified using v3 scheme (APK Signature Scheme v3): true 1035s Verified using v4 scheme (APK Signature Scheme v4): false 1035s Verified for SourceStamp: false 1035s Number of signers: 1 1035s 1035s 2024-11-13 23:08:20,061 DEBUG: Processing apk.embedded_1.apk 1035s 2024-11-13 23:08:20,062 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1035s 2024-11-13 23:08:20,065 DEBUG: Getting signature of apk.embedded_1.apk 1035s 2024-11-13 23:08:20,066 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1035s 2024-11-13 23:08:20,068 DEBUG: Using APK Signature v3 1035s 2024-11-13 23:08:20,070 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1035s 2024-11-13 23:08:20,072 DEBUG: Using APK Signature v3 1035s 2024-11-13 23:08:20,458 DEBUG: repo/apk.embedded_1.apk: Verifies 1035s Verified using v1 scheme (JAR signing): true 1035s Verified using v2 scheme (APK Signature Scheme v2): true 1035s Verified using v3 scheme (APK Signature Scheme v3): true 1035s Verified using v4 scheme (APK Signature Scheme v4): false 1035s Verified for SourceStamp: false 1035s Number of signers: 1 1035s 1035s 2024-11-13 23:08:20,459 DEBUG: Processing com.example.test.helloworld_1.apk 1035s 2024-11-13 23:08:20,463 DEBUG: Getting signature of com.example.test.helloworld_1.apk 1035s 2024-11-13 23:08:20,466 DEBUG: Using JAR Signature 1035s 2024-11-13 23:08:20,470 DEBUG: Using JAR Signature 1035s 2024-11-13 23:08:20,832 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 1035s Verified using v1 scheme (JAR signing): true 1035s Verified using v2 scheme (APK Signature Scheme v2): false 1035s Verified using v3 scheme (APK Signature Scheme v3): false 1035s Verified using v4 scheme (APK Signature Scheme v4): false 1035s Verified for SourceStamp: false 1035s Number of signers: 1 1035s 1035s 2024-11-13 23:08:20,832 DEBUG: Processing com.politedroid_3.apk 1035s 2024-11-13 23:08:20,836 DEBUG: Getting signature of com.politedroid_3.apk 1035s 2024-11-13 23:08:20,839 DEBUG: Using JAR Signature 1035s 2024-11-13 23:08:20,842 DEBUG: Using JAR Signature 1036s 2024-11-13 23:08:21,216 DEBUG: repo/com.politedroid_3.apk: Verifies 1036s Verified using v1 scheme (JAR signing): true 1036s Verified using v2 scheme (APK Signature Scheme v2): false 1036s Verified using v3 scheme (APK Signature Scheme v3): false 1036s Verified using v4 scheme (APK Signature Scheme v4): false 1036s Verified for SourceStamp: false 1036s Number of signers: 1 1036s 1036s 2024-11-13 23:08:21,223 DEBUG: Processing com.politedroid_4.apk 1036s 2024-11-13 23:08:21,227 DEBUG: Getting signature of com.politedroid_4.apk 1036s 2024-11-13 23:08:21,230 DEBUG: Using JAR Signature 1036s 2024-11-13 23:08:21,233 DEBUG: Using JAR Signature 1036s 2024-11-13 23:08:21,601 DEBUG: repo/com.politedroid_4.apk: Verifies 1036s Verified using v1 scheme (JAR signing): true 1036s Verified using v2 scheme (APK Signature Scheme v2): false 1036s Verified using v3 scheme (APK Signature Scheme v3): false 1036s Verified using v4 scheme (APK Signature Scheme v4): false 1036s Verified for SourceStamp: false 1036s Number of signers: 1 1036s 1036s 2024-11-13 23:08:21,603 DEBUG: Processing com.politedroid_5.apk 1036s 2024-11-13 23:08:21,606 DEBUG: Getting signature of com.politedroid_5.apk 1036s 2024-11-13 23:08:21,609 DEBUG: Using JAR Signature 1036s 2024-11-13 23:08:21,612 DEBUG: Using JAR Signature 1037s 2024-11-13 23:08:21,966 DEBUG: repo/com.politedroid_5.apk: Verifies 1037s Verified using v1 scheme (JAR signing): true 1037s Verified using v2 scheme (APK Signature Scheme v2): false 1037s Verified using v3 scheme (APK Signature Scheme v3): false 1037s Verified using v4 scheme (APK Signature Scheme v4): false 1037s Verified for SourceStamp: false 1037s Number of signers: 1 1037s 1037s 2024-11-13 23:08:21,968 DEBUG: Processing com.politedroid_6.apk 1037s 2024-11-13 23:08:21,973 DEBUG: Getting signature of com.politedroid_6.apk 1037s 2024-11-13 23:08:21,977 DEBUG: Using JAR Signature 1037s 2024-11-13 23:08:21,981 DEBUG: Using JAR Signature 1037s 2024-11-13 23:08:22,338 DEBUG: repo/com.politedroid_6.apk: Verifies 1037s Verified using v1 scheme (JAR signing): true 1037s Verified using v2 scheme (APK Signature Scheme v2): false 1037s Verified using v3 scheme (APK Signature Scheme v3): false 1037s Verified using v4 scheme (APK Signature Scheme v4): false 1037s Verified for SourceStamp: false 1037s Number of signers: 1 1037s 1037s 2024-11-13 23:08:22,340 DEBUG: Processing duplicate.permisssions_9999999.apk 1037s 2024-11-13 23:08:22,346 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 1037s 2024-11-13 23:08:22,350 DEBUG: Using APK Signature v2 1037s 2024-11-13 23:08:22,355 DEBUG: Using APK Signature v2 1037s 2024-11-13 23:08:22,356 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 1037s 2024-11-13 23:08:22,720 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 1037s Verified using v1 scheme (JAR signing): true 1037s Verified using v2 scheme (APK Signature Scheme v2): true 1037s Verified using v3 scheme (APK Signature Scheme v3): false 1037s Verified using v4 scheme (APK Signature Scheme v4): false 1037s Verified for SourceStamp: false 1037s Number of signers: 1 1037s 1037s 2024-11-13 23:08:22,721 DEBUG: Density 120 not available, resizing down from 160 1037s 2024-11-13 23:08:22,723 DEBUG: Processing info.guardianproject.urzip_100.apk 1037s 2024-11-13 23:08:22,727 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 1037s 2024-11-13 23:08:22,731 DEBUG: Using JAR Signature 1037s 2024-11-13 23:08:22,734 DEBUG: Using JAR Signature 1038s 2024-11-13 23:08:23,085 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 1038s Verified using v1 scheme (JAR signing): true 1038s Verified using v2 scheme (APK Signature Scheme v2): false 1038s Verified using v3 scheme (APK Signature Scheme v3): false 1038s Verified using v4 scheme (APK Signature Scheme v4): false 1038s Verified for SourceStamp: false 1038s Number of signers: 1 1038s 1038s 2024-11-13 23:08:23,086 DEBUG: Density 120 not available, resizing down from 160 1038s 2024-11-13 23:08:23,088 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 1038s 2024-11-13 23:08:23,092 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 1038s 2024-11-13 23:08:23,095 DEBUG: Using JAR Signature 1038s 2024-11-13 23:08:23,099 DEBUG: Using JAR Signature 1038s 2024-11-13 23:08:23,451 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 1038s Verified using v1 scheme (JAR signing): true 1038s Verified using v2 scheme (APK Signature Scheme v2): false 1038s Verified using v3 scheme (APK Signature Scheme v3): false 1038s Verified using v4 scheme (APK Signature Scheme v4): false 1038s Verified for SourceStamp: false 1038s Number of signers: 1 1038s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1038s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1038s 1038s 2024-11-13 23:08:23,452 DEBUG: Processing no.min.target.sdk_987.apk 1038s 2024-11-13 23:08:23,456 DEBUG: Getting signature of no.min.target.sdk_987.apk 1038s 2024-11-13 23:08:23,459 DEBUG: Using APK Signature v2 1038s 2024-11-13 23:08:23,462 DEBUG: Using APK Signature v2 1038s 2024-11-13 23:08:23,463 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 1038s 2024-11-13 23:08:23,855 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 1038s Verified using v1 scheme (JAR signing): true 1038s Verified using v2 scheme (APK Signature Scheme v2): true 1038s Verified using v3 scheme (APK Signature Scheme v3): false 1038s Verified using v4 scheme (APK Signature Scheme v4): false 1038s Verified for SourceStamp: false 1038s Number of signers: 1 1038s 1038s 2024-11-13 23:08:23,856 DEBUG: Density 120 not available, resizing down from 160 1038s 2024-11-13 23:08:23,858 DEBUG: Processing obb.main.oldversion_1444412523.apk 1038s 2024-11-13 23:08:23,862 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 1038s 2024-11-13 23:08:23,866 DEBUG: Using APK Signature v2 1038s 2024-11-13 23:08:23,871 DEBUG: Using APK Signature v2 1039s 2024-11-13 23:08:24,256 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 1039s Verified using v1 scheme (JAR signing): true 1039s Verified using v2 scheme (APK Signature Scheme v2): true 1039s Verified using v3 scheme (APK Signature Scheme v3): false 1039s Verified using v4 scheme (APK Signature Scheme v4): false 1039s Verified for SourceStamp: false 1039s Number of signers: 1 1039s 1039s 2024-11-13 23:08:24,257 DEBUG: Density 120 not available, resizing down from 160 1039s 2024-11-13 23:08:24,259 DEBUG: Processing obb.main.twoversions_1101613.apk 1039s 2024-11-13 23:08:24,263 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 1039s 2024-11-13 23:08:24,267 DEBUG: Using JAR Signature 1039s 2024-11-13 23:08:24,271 DEBUG: Using JAR Signature 1039s 2024-11-13 23:08:24,618 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 1039s Verified using v1 scheme (JAR signing): true 1039s Verified using v2 scheme (APK Signature Scheme v2): false 1039s Verified using v3 scheme (APK Signature Scheme v3): false 1039s Verified using v4 scheme (APK Signature Scheme v4): false 1039s Verified for SourceStamp: false 1039s Number of signers: 1 1039s 1039s 2024-11-13 23:08:24,619 DEBUG: Density 120 not available, resizing down from 160 1039s 2024-11-13 23:08:24,621 DEBUG: Processing obb.main.twoversions_1101615.apk 1039s 2024-11-13 23:08:24,625 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 1039s 2024-11-13 23:08:24,629 DEBUG: Using JAR Signature 1039s 2024-11-13 23:08:24,632 DEBUG: Using JAR Signature 1040s 2024-11-13 23:08:24,984 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 1040s Verified using v1 scheme (JAR signing): true 1040s Verified using v2 scheme (APK Signature Scheme v2): false 1040s Verified using v3 scheme (APK Signature Scheme v3): false 1040s Verified using v4 scheme (APK Signature Scheme v4): false 1040s Verified for SourceStamp: false 1040s Number of signers: 1 1040s 1040s 2024-11-13 23:08:24,985 DEBUG: Density 120 not available, resizing down from 160 1040s 2024-11-13 23:08:24,987 DEBUG: Processing obb.main.twoversions_1101617.apk 1040s 2024-11-13 23:08:24,991 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 1040s 2024-11-13 23:08:24,995 DEBUG: Using JAR Signature 1040s 2024-11-13 23:08:24,999 DEBUG: Using JAR Signature 1040s 2024-11-13 23:08:25,353 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 1040s Verified using v1 scheme (JAR signing): true 1040s Verified using v2 scheme (APK Signature Scheme v2): false 1040s Verified using v3 scheme (APK Signature Scheme v3): false 1040s Verified using v4 scheme (APK Signature Scheme v4): false 1040s Verified for SourceStamp: false 1040s Number of signers: 1 1040s 1040s 2024-11-13 23:08:25,354 DEBUG: Density 120 not available, resizing down from 160 1040s 2024-11-13 23:08:25,359 DEBUG: Processing obb.mainpatch.current_1619.apk 1040s 2024-11-13 23:08:25,365 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 1040s 2024-11-13 23:08:25,371 DEBUG: Using JAR Signature 1040s 2024-11-13 23:08:25,377 DEBUG: Using JAR Signature 1040s 2024-11-13 23:08:25,945 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 1040s Verified using v1 scheme (JAR signing): true 1040s Verified using v2 scheme (APK Signature Scheme v2): false 1040s Verified using v3 scheme (APK Signature Scheme v3): false 1040s Verified using v4 scheme (APK Signature Scheme v4): false 1040s Verified for SourceStamp: false 1040s Number of signers: 1 1040s 1040s 2024-11-13 23:08:25,947 DEBUG: Density 120 not available, resizing down from 160 1040s 2024-11-13 23:08:25,951 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 1040s 2024-11-13 23:08:25,957 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 1041s 2024-11-13 23:08:25,962 DEBUG: Using JAR Signature 1041s 2024-11-13 23:08:25,967 DEBUG: Using JAR Signature 1041s 2024-11-13 23:08:26,330 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 1041s Verified using v1 scheme (JAR signing): true 1041s Verified using v2 scheme (APK Signature Scheme v2): false 1041s Verified using v3 scheme (APK Signature Scheme v3): false 1041s Verified using v4 scheme (APK Signature Scheme v4): false 1041s Verified for SourceStamp: false 1041s Number of signers: 1 1041s 1041s 2024-11-13 23:08:26,331 DEBUG: Density 120 not available, resizing down from 160 1041s 2024-11-13 23:08:26,333 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 1041s 2024-11-13 23:08:26,336 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 1041s 2024-11-13 23:08:26,339 DEBUG: Using JAR Signature 1041s 2024-11-13 23:08:26,342 DEBUG: Using JAR Signature 1041s 2024-11-13 23:08:26,697 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 1041s Verified using v1 scheme (JAR signing): true 1041s Verified using v2 scheme (APK Signature Scheme v2): false 1041s Verified using v3 scheme (APK Signature Scheme v3): false 1041s Verified using v4 scheme (APK Signature Scheme v4): false 1041s Verified for SourceStamp: false 1041s Number of signers: 1 1041s 1041s 2024-11-13 23:08:26,698 DEBUG: Density 120 not available, resizing down from 160 1041s 2024-11-13 23:08:26,699 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 1041s 2024-11-13 23:08:26,703 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 1041s 2024-11-13 23:08:26,706 DEBUG: Using JAR Signature 1041s 2024-11-13 23:08:26,709 DEBUG: Using JAR Signature 1042s 2024-11-13 23:08:27,287 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 1042s Verified using v1 scheme (JAR signing): true 1042s Verified using v2 scheme (APK Signature Scheme v2): false 1042s Verified using v3 scheme (APK Signature Scheme v3): false 1042s Verified using v4 scheme (APK Signature Scheme v4): false 1042s Verified for SourceStamp: false 1042s Number of signers: 1 1042s 1042s 2024-11-13 23:08:27,288 DEBUG: Density 120 not available, resizing down from 160 1042s 2024-11-13 23:08:27,290 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 1042s 2024-11-13 23:08:27,293 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 1042s 2024-11-13 23:08:27,296 DEBUG: Using JAR Signature 1042s 2024-11-13 23:08:27,300 DEBUG: Using JAR Signature 1042s 2024-11-13 23:08:27,642 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 1042s Verified using v1 scheme (JAR signing): true 1042s Verified using v2 scheme (APK Signature Scheme v2): false 1042s Verified using v3 scheme (APK Signature Scheme v3): false 1042s Verified using v4 scheme (APK Signature Scheme v4): false 1042s Verified for SourceStamp: false 1042s Number of signers: 1 1042s 1042s 2024-11-13 23:08:27,643 DEBUG: Density 120 not available, resizing down from 160 1042s 2024-11-13 23:08:27,645 DEBUG: Processing org.dyndns.fules.ck_20.apk 1042s 2024-11-13 23:08:27,651 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 1042s 2024-11-13 23:08:27,654 DEBUG: Using JAR Signature 1042s 2024-11-13 23:08:27,658 DEBUG: Using JAR Signature 1043s 2024-11-13 23:08:28,069 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 1043s Verified using v1 scheme (JAR signing): true 1043s Verified using v2 scheme (APK Signature Scheme v2): false 1043s Verified using v3 scheme (APK Signature Scheme v3): false 1043s Verified using v4 scheme (APK Signature Scheme v4): false 1043s Verified for SourceStamp: false 1043s Number of signers: 1 1043s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1043s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1043s 1043s 2024-11-13 23:08:28,075 DEBUG: Processing org.fdroid.ci_1.apk 1043s 2024-11-13 23:08:28,079 DEBUG: Getting signature of org.fdroid.ci_1.apk 1043s 2024-11-13 23:08:28,083 DEBUG: Using APK Signature v3 1043s 2024-11-13 23:08:28,087 DEBUG: Using APK Signature v3 1043s 2024-11-13 23:08:28,593 DEBUG: repo/org.fdroid.ci_1.apk: Verifies 1043s Verified using v1 scheme (JAR signing): false 1043s Verified using v2 scheme (APK Signature Scheme v2): false 1043s Verified using v3 scheme (APK Signature Scheme v3): true 1043s Verified using v4 scheme (APK Signature Scheme v4): false 1043s Verified for SourceStamp: false 1043s Number of signers: 1 1043s 1043s 2024-11-13 23:08:28,594 DEBUG: Processing org.sajeg.fallingblocks_3.apk 1043s 2024-11-13 23:08:28,598 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1043s 2024-11-13 23:08:28,614 DEBUG: Ignoring bad element in manifest: 1043s 2024-11-13 23:08:28,615 DEBUG: Ignoring bad element in manifest: 1043s 2024-11-13 23:08:28,615 DEBUG: Ignoring bad element in manifest: 1043s 2024-11-13 23:08:28,616 DEBUG: Getting signature of org.sajeg.fallingblocks_3.apk 1043s 2024-11-13 23:08:28,620 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1043s 2024-11-13 23:08:28,623 DEBUG: Using APK Signature v3 1043s 2024-11-13 23:08:28,627 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1043s 2024-11-13 23:08:28,630 DEBUG: Using APK Signature v3 1044s 2024-11-13 23:08:29,041 DEBUG: repo/org.sajeg.fallingblocks_3.apk: Verifies 1044s Verified using v1 scheme (JAR signing): true 1044s Verified using v2 scheme (APK Signature Scheme v2): true 1044s Verified using v3 scheme (APK Signature Scheme v3): true 1044s Verified using v4 scheme (APK Signature Scheme v4): false 1044s Verified for SourceStamp: false 1044s Number of signers: 1 1044s 1044s 2024-11-13 23:08:29,042 DEBUG: Processing souch.smsbypass_9.apk 1044s 2024-11-13 23:08:29,051 DEBUG: Getting signature of souch.smsbypass_9.apk 1044s 2024-11-13 23:08:29,057 DEBUG: Using JAR Signature 1044s 2024-11-13 23:08:29,063 DEBUG: Using JAR Signature 1044s 2024-11-13 23:08:29,684 DEBUG: repo/souch.smsbypass_9.apk: Verifies 1044s Verified using v1 scheme (JAR signing): true 1044s Verified using v2 scheme (APK Signature Scheme v2): false 1044s Verified using v3 scheme (APK Signature Scheme v3): false 1044s Verified using v4 scheme (APK Signature Scheme v4): false 1044s Verified for SourceStamp: false 1044s Number of signers: 1 1044s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1044s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1044s 1044s 2024-11-13 23:08:29,688 DEBUG: Density 120 not available, resizing down from 160 1044s 2024-11-13 23:08:29,694 DEBUG: Processing v1.v2.sig_1020.apk 1044s 2024-11-13 23:08:29,700 DEBUG: Getting signature of v1.v2.sig_1020.apk 1044s 2024-11-13 23:08:29,705 DEBUG: Using APK Signature v2 1044s 2024-11-13 23:08:29,711 DEBUG: Using APK Signature v2 1045s 2024-11-13 23:08:30,324 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 1045s Verified using v1 scheme (JAR signing): true 1045s Verified using v2 scheme (APK Signature Scheme v2): true 1045s Verified using v3 scheme (APK Signature Scheme v3): false 1045s Verified using v4 scheme (APK Signature Scheme v4): false 1045s Verified for SourceStamp: false 1045s Number of signers: 1 1045s 1045s 2024-11-13 23:08:30,326 DEBUG: Density 120 not available, resizing down from 160 1045s 2024-11-13 23:08:30,330 DEBUG: Processing v2.only.sig_2.apk 1045s 2024-11-13 23:08:30,337 DEBUG: Getting signature of v2.only.sig_2.apk 1045s 2024-11-13 23:08:30,342 DEBUG: Using APK Signature v2 1045s 2024-11-13 23:08:30,347 DEBUG: Using APK Signature v2 1045s 2024-11-13 23:08:30,857 DEBUG: repo/v2.only.sig_2.apk: Verifies 1045s Verified using v1 scheme (JAR signing): false 1045s Verified using v2 scheme (APK Signature Scheme v2): true 1045s Verified using v3 scheme (APK Signature Scheme v3): false 1045s Verified using v4 scheme (APK Signature Scheme v4): false 1045s Verified for SourceStamp: false 1045s Number of signers: 1 1045s 1045s 2024-11-13 23:08:30,859 DEBUG: Density 120 not available, resizing down from 160 1045s 2024-11-13 23:08:30,865 INFO: Generated skeleton metadata for SpeedoMeterApp.main 1045s 2024-11-13 23:08:30,870 INFO: Generated skeleton metadata for android.appsecurity.cts.tinyapp 1045s 2024-11-13 23:08:30,875 INFO: Generated skeleton metadata for apk.embedded 1045s 2024-11-13 23:08:30,881 INFO: Generated skeleton metadata for com.example.test.helloworld 1045s 2024-11-13 23:08:30,888 INFO: Generated skeleton metadata for com.politedroid 1045s 2024-11-13 23:08:30,896 INFO: Generated skeleton metadata for duplicate.permisssions 1045s 2024-11-13 23:08:30,905 INFO: Generated skeleton metadata for info.guardianproject.urzip 1045s 2024-11-13 23:08:30,917 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 1045s 2024-11-13 23:08:30,928 INFO: Generated skeleton metadata for no.min.target.sdk 1045s 2024-11-13 23:08:30,941 INFO: Generated skeleton metadata for obb.main.oldversion 1045s 2024-11-13 23:08:30,955 INFO: Generated skeleton metadata for obb.main.twoversions 1046s 2024-11-13 23:08:30,970 INFO: Generated skeleton metadata for obb.mainpatch.current 1046s 2024-11-13 23:08:30,986 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 1046s 2024-11-13 23:08:31,003 INFO: Generated skeleton metadata for org.dyndns.fules.ck 1046s 2024-11-13 23:08:31,021 INFO: Generated skeleton metadata for org.fdroid.ci 1046s 2024-11-13 23:08:31,041 INFO: Generated skeleton metadata for org.sajeg.fallingblocks 1046s 2024-11-13 23:08:31,061 INFO: Generated skeleton metadata for souch.smsbypass 1046s 2024-11-13 23:08:31,083 INFO: Generated skeleton metadata for v1.v2.sig 1046s 2024-11-13 23:08:31,106 INFO: Generated skeleton metadata for v2.only.sig 1046s 2024-11-13 23:08:31,135 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 1046s 1046s Warning: 1046s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 1046s 2024-11-13 23:08:31,947 INFO: Creating signed index with this key (SHA256): 1046s 2024-11-13 23:08:31,947 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 1046s 2024-11-13 23:08:31,947 DEBUG: Directory: repo 1046s 2024-11-13 23:08:31,947 DEBUG: > jar cf index.jar index.xml 1047s 2024-11-13 23:08:32,249 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 1048s jar signed. 1048s 1048s Warning: 1048s The signer's certificate is self-signed. 1048s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1048s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1048s 2024-11-13 23:08:33,152 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1048s 2024-11-13 23:08:33,163 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 1049s jar signed. 1049s 1049s Warning: 1049s The signer's certificate is self-signed. 1049s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1049s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1049s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1049s 2024-11-13 23:08:34,075 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 1049s 2024-11-13 23:08:34,678 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 1050s 1050s Warning: 1050s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 1050s 2024-11-13 23:08:35,396 DEBUG: Outputting JSON 1050s 2024-11-13 23:08:35,397 DEBUG: skip deploying full build logs: not enabled in config 1050s 2024-11-13 23:08:35,397 DEBUG: skip deploying full build logs: not enabled in config 1050s 2024-11-13 23:08:35,398 DEBUG: skip deploying full build logs: not enabled in config 1050s 2024-11-13 23:08:35,398 INFO: Finished 1050s + /usr/bin/fdroid readmeta 1051s + grep -F ' repo/SpeedoMeterApp.main_1.apk 1082s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 1083s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 1083s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk 1084s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk --> repo/org.fdroid.ci_1.apk 1084s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk 1085s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk --> repo/android.appsecurity.cts.tinyapp_10.apk 1085s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc2.apk 1086s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3a.apk 1086s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3b.apk 1087s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 1088s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 1088s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 1088s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 1088s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 1089s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 1089s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 1090s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 1090s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk 1090s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1090s [INFO ] androguard.apk: APK file was successfully validated! 1090s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1090s [INFO ] androguard.apk: APK file was successfully validated! 1090s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 1090s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk 1091s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk --> repo/org.sajeg.fallingblocks_3.apk 1091s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk 1092s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 1092s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 1093s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 1093s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk 1094s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 1094s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk 1094s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 1094s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk 1095s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 1095s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk 1095s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1095s [INFO ] androguard.apk: APK file was successfully validated! 1096s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1096s [INFO ] androguard.apk: APK file was successfully validated! 1096s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 1096s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 1096s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 1096s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk 1097s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 1097s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk 1098s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 1098s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk 1098s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 1098s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk 1099s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 1099s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk 1100s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 1100s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk 1100s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 1100s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 1101s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk 1101s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1101s [INFO ] androguard.apk: APK file was successfully validated! 1102s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1102s [INFO ] androguard.apk: APK file was successfully validated! 1102s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 1102s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1103s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 1103s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk 1103s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 1103s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk 1104s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 1105s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk 1105s + /usr/bin/fdroid update --create-metadata --verbose 1105s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 1106s 2024-11-13 23:09:31,300 DEBUG: Reading 'config.yml' 1106s 2024-11-13 23:09:31,314 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1106s 2024-11-13 23:09:31,315 DEBUG: skip deploying full build logs: not enabled in config 1106s 2024-11-13 23:09:31,315 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1106s 2024-11-13 23:09:31,316 DEBUG: Processing SpeedoMeterApp.main_1.apk 1106s 2024-11-13 23:09:31,413 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 1106s 2024-11-13 23:09:31,416 DEBUG: Using JAR Signature 1106s 2024-11-13 23:09:31,419 DEBUG: Using JAR Signature 1106s 2024-11-13 23:09:31,419 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 1107s 2024-11-13 23:09:31,982 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 1107s Verified using v1 scheme (JAR signing): true 1107s Verified using v2 scheme (APK Signature Scheme v2): false 1107s Verified using v3 scheme (APK Signature Scheme v3): false 1107s Verified using v4 scheme (APK Signature Scheme v4): false 1107s Verified for SourceStamp: false 1107s Number of signers: 1 1107s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1107s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1107s 1107s 2024-11-13 23:09:31,983 DEBUG: Processing android.appsecurity.cts.tinyapp_10.apk 1107s 2024-11-13 23:09:31,984 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1107s 2024-11-13 23:09:31,987 DEBUG: Getting signature of android.appsecurity.cts.tinyapp_10.apk 1107s 2024-11-13 23:09:31,988 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1107s 2024-11-13 23:09:31,990 DEBUG: Using APK Signature v3 1107s 2024-11-13 23:09:31,992 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1107s 2024-11-13 23:09:31,993 DEBUG: Using APK Signature v3 1107s 2024-11-13 23:09:32,493 DEBUG: repo/android.appsecurity.cts.tinyapp_10.apk: Verifies 1107s Verified using v1 scheme (JAR signing): false 1107s Verified using v2 scheme (APK Signature Scheme v2): false 1107s Verified using v3 scheme (APK Signature Scheme v3): true 1107s Verified using v4 scheme (APK Signature Scheme v4): false 1107s Verified for SourceStamp: false 1107s Number of signers: 1 1107s 1107s 2024-11-13 23:09:32,494 DEBUG: Processing apk.embedded_1.apk 1107s 2024-11-13 23:09:32,495 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1107s 2024-11-13 23:09:32,497 DEBUG: Getting signature of apk.embedded_1.apk 1107s 2024-11-13 23:09:32,498 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1107s 2024-11-13 23:09:32,500 DEBUG: Using APK Signature v3 1107s 2024-11-13 23:09:32,502 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1107s 2024-11-13 23:09:32,504 DEBUG: Using APK Signature v3 1107s 2024-11-13 23:09:32,900 DEBUG: repo/apk.embedded_1.apk: Verifies 1107s Verified using v1 scheme (JAR signing): true 1107s Verified using v2 scheme (APK Signature Scheme v2): true 1107s Verified using v3 scheme (APK Signature Scheme v3): true 1107s Verified using v4 scheme (APK Signature Scheme v4): false 1107s Verified for SourceStamp: false 1107s Number of signers: 1 1107s 1107s 2024-11-13 23:09:32,900 DEBUG: Processing com.example.test.helloworld_1.apk 1107s 2024-11-13 23:09:32,904 DEBUG: Getting signature of com.example.test.helloworld_1.apk 1107s 2024-11-13 23:09:32,908 DEBUG: Using JAR Signature 1107s 2024-11-13 23:09:32,912 DEBUG: Using JAR Signature 1108s 2024-11-13 23:09:33,270 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 1108s Verified using v1 scheme (JAR signing): true 1108s Verified using v2 scheme (APK Signature Scheme v2): false 1108s Verified using v3 scheme (APK Signature Scheme v3): false 1108s Verified using v4 scheme (APK Signature Scheme v4): false 1108s Verified for SourceStamp: false 1108s Number of signers: 1 1108s 1108s 2024-11-13 23:09:33,272 DEBUG: Processing com.politedroid_3.apk 1108s 2024-11-13 23:09:33,278 DEBUG: Getting signature of com.politedroid_3.apk 1108s 2024-11-13 23:09:33,284 DEBUG: Using JAR Signature 1108s 2024-11-13 23:09:33,289 DEBUG: Using JAR Signature 1108s 2024-11-13 23:09:33,870 DEBUG: repo/com.politedroid_3.apk: Verifies 1108s Verified using v1 scheme (JAR signing): true 1108s Verified using v2 scheme (APK Signature Scheme v2): false 1108s Verified using v3 scheme (APK Signature Scheme v3): false 1108s Verified using v4 scheme (APK Signature Scheme v4): false 1108s Verified for SourceStamp: false 1108s Number of signers: 1 1108s 1108s 2024-11-13 23:09:33,884 DEBUG: Processing com.politedroid_4.apk 1108s 2024-11-13 23:09:33,890 DEBUG: Getting signature of com.politedroid_4.apk 1108s 2024-11-13 23:09:33,895 DEBUG: Using JAR Signature 1108s 2024-11-13 23:09:33,900 DEBUG: Using JAR Signature 1109s 2024-11-13 23:09:34,474 DEBUG: repo/com.politedroid_4.apk: Verifies 1109s Verified using v1 scheme (JAR signing): true 1109s Verified using v2 scheme (APK Signature Scheme v2): false 1109s Verified using v3 scheme (APK Signature Scheme v3): false 1109s Verified using v4 scheme (APK Signature Scheme v4): false 1109s Verified for SourceStamp: false 1109s Number of signers: 1 1109s 1109s 2024-11-13 23:09:34,479 DEBUG: Processing com.politedroid_5.apk 1109s 2024-11-13 23:09:34,485 DEBUG: Getting signature of com.politedroid_5.apk 1109s 2024-11-13 23:09:34,489 DEBUG: Using JAR Signature 1109s 2024-11-13 23:09:34,494 DEBUG: Using JAR Signature 1109s 2024-11-13 23:09:34,875 DEBUG: repo/com.politedroid_5.apk: Verifies 1109s Verified using v1 scheme (JAR signing): true 1109s Verified using v2 scheme (APK Signature Scheme v2): false 1109s Verified using v3 scheme (APK Signature Scheme v3): false 1109s Verified using v4 scheme (APK Signature Scheme v4): false 1109s Verified for SourceStamp: false 1109s Number of signers: 1 1109s 1109s 2024-11-13 23:09:34,880 DEBUG: Processing com.politedroid_6.apk 1109s 2024-11-13 23:09:34,887 DEBUG: Getting signature of com.politedroid_6.apk 1109s 2024-11-13 23:09:34,894 DEBUG: Using JAR Signature 1109s 2024-11-13 23:09:34,901 DEBUG: Using JAR Signature 1110s 2024-11-13 23:09:35,274 DEBUG: repo/com.politedroid_6.apk: Verifies 1110s Verified using v1 scheme (JAR signing): true 1110s Verified using v2 scheme (APK Signature Scheme v2): false 1110s Verified using v3 scheme (APK Signature Scheme v3): false 1110s Verified using v4 scheme (APK Signature Scheme v4): false 1110s Verified for SourceStamp: false 1110s Number of signers: 1 1110s 1110s 2024-11-13 23:09:35,276 DEBUG: Processing duplicate.permisssions_9999999.apk 1110s 2024-11-13 23:09:35,282 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 1110s 2024-11-13 23:09:35,286 DEBUG: Using APK Signature v2 1110s 2024-11-13 23:09:35,291 DEBUG: Using APK Signature v2 1110s 2024-11-13 23:09:35,292 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 1110s 2024-11-13 23:09:35,890 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 1110s Verified using v1 scheme (JAR signing): true 1110s Verified using v2 scheme (APK Signature Scheme v2): true 1110s Verified using v3 scheme (APK Signature Scheme v3): false 1110s Verified using v4 scheme (APK Signature Scheme v4): false 1110s Verified for SourceStamp: false 1110s Number of signers: 1 1110s 1110s 2024-11-13 23:09:35,891 DEBUG: Density 120 not available, resizing down from 160 1110s 2024-11-13 23:09:35,893 DEBUG: Processing info.guardianproject.urzip_100.apk 1110s 2024-11-13 23:09:35,897 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 1110s 2024-11-13 23:09:35,901 DEBUG: Using JAR Signature 1110s 2024-11-13 23:09:35,905 DEBUG: Using JAR Signature 1111s 2024-11-13 23:09:36,434 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 1111s Verified using v1 scheme (JAR signing): true 1111s Verified using v2 scheme (APK Signature Scheme v2): false 1111s Verified using v3 scheme (APK Signature Scheme v3): false 1111s Verified using v4 scheme (APK Signature Scheme v4): false 1111s Verified for SourceStamp: false 1111s Number of signers: 1 1111s 1111s 2024-11-13 23:09:36,436 DEBUG: Density 120 not available, resizing down from 160 1111s 2024-11-13 23:09:36,440 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 1111s 2024-11-13 23:09:36,446 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 1111s 2024-11-13 23:09:36,452 DEBUG: Using JAR Signature 1111s 2024-11-13 23:09:36,458 DEBUG: Using JAR Signature 1112s 2024-11-13 23:09:37,021 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 1112s Verified using v1 scheme (JAR signing): true 1112s Verified using v2 scheme (APK Signature Scheme v2): false 1112s Verified using v3 scheme (APK Signature Scheme v3): false 1112s Verified using v4 scheme (APK Signature Scheme v4): false 1112s Verified for SourceStamp: false 1112s Number of signers: 1 1112s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1112s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1112s 1112s 2024-11-13 23:09:37,022 DEBUG: Processing no.min.target.sdk_987.apk 1112s 2024-11-13 23:09:37,028 DEBUG: Getting signature of no.min.target.sdk_987.apk 1112s 2024-11-13 23:09:37,033 DEBUG: Using APK Signature v2 1112s 2024-11-13 23:09:37,039 DEBUG: Using APK Signature v2 1112s 2024-11-13 23:09:37,040 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 1112s 2024-11-13 23:09:37,431 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 1112s Verified using v1 scheme (JAR signing): true 1112s Verified using v2 scheme (APK Signature Scheme v2): true 1112s Verified using v3 scheme (APK Signature Scheme v3): false 1112s Verified using v4 scheme (APK Signature Scheme v4): false 1112s Verified for SourceStamp: false 1112s Number of signers: 1 1112s 1112s 2024-11-13 23:09:37,433 DEBUG: Density 120 not available, resizing down from 160 1112s 2024-11-13 23:09:37,436 DEBUG: Processing obb.main.oldversion_1444412523.apk 1112s 2024-11-13 23:09:37,444 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 1112s 2024-11-13 23:09:37,450 DEBUG: Using APK Signature v2 1112s 2024-11-13 23:09:37,456 DEBUG: Using APK Signature v2 1113s 2024-11-13 23:09:38,061 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 1113s Verified using v1 scheme (JAR signing): true 1113s Verified using v2 scheme (APK Signature Scheme v2): true 1113s Verified using v3 scheme (APK Signature Scheme v3): false 1113s Verified using v4 scheme (APK Signature Scheme v4): false 1113s Verified for SourceStamp: false 1113s Number of signers: 1 1113s 1113s 2024-11-13 23:09:38,062 DEBUG: Density 120 not available, resizing down from 160 1113s 2024-11-13 23:09:38,067 DEBUG: Processing obb.main.twoversions_1101613.apk 1113s 2024-11-13 23:09:38,073 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 1113s 2024-11-13 23:09:38,078 DEBUG: Using JAR Signature 1113s 2024-11-13 23:09:38,084 DEBUG: Using JAR Signature 1113s 2024-11-13 23:09:38,644 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 1113s Verified using v1 scheme (JAR signing): true 1113s Verified using v2 scheme (APK Signature Scheme v2): false 1113s Verified using v3 scheme (APK Signature Scheme v3): false 1113s Verified using v4 scheme (APK Signature Scheme v4): false 1113s Verified for SourceStamp: false 1113s Number of signers: 1 1113s 1113s 2024-11-13 23:09:38,645 DEBUG: Density 120 not available, resizing down from 160 1113s 2024-11-13 23:09:38,649 DEBUG: Processing obb.main.twoversions_1101615.apk 1113s 2024-11-13 23:09:38,656 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 1113s 2024-11-13 23:09:38,663 DEBUG: Using JAR Signature 1113s 2024-11-13 23:09:38,669 DEBUG: Using JAR Signature 1114s 2024-11-13 23:09:39,045 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 1114s Verified using v1 scheme (JAR signing): true 1114s Verified using v2 scheme (APK Signature Scheme v2): false 1114s Verified using v3 scheme (APK Signature Scheme v3): false 1114s Verified using v4 scheme (APK Signature Scheme v4): false 1114s Verified for SourceStamp: false 1114s Number of signers: 1 1114s 1114s 2024-11-13 23:09:39,047 DEBUG: Density 120 not available, resizing down from 160 1114s 2024-11-13 23:09:39,051 DEBUG: Processing obb.main.twoversions_1101617.apk 1114s 2024-11-13 23:09:39,057 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 1114s 2024-11-13 23:09:39,063 DEBUG: Using JAR Signature 1114s 2024-11-13 23:09:39,069 DEBUG: Using JAR Signature 1114s 2024-11-13 23:09:39,441 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 1114s Verified using v1 scheme (JAR signing): true 1114s Verified using v2 scheme (APK Signature Scheme v2): false 1114s Verified using v3 scheme (APK Signature Scheme v3): false 1114s Verified using v4 scheme (APK Signature Scheme v4): false 1114s Verified for SourceStamp: false 1114s Number of signers: 1 1114s 1114s 2024-11-13 23:09:39,443 DEBUG: Density 120 not available, resizing down from 160 1114s 2024-11-13 23:09:39,447 DEBUG: Processing obb.mainpatch.current_1619.apk 1114s 2024-11-13 23:09:39,454 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 1114s 2024-11-13 23:09:39,460 DEBUG: Using JAR Signature 1114s 2024-11-13 23:09:39,466 DEBUG: Using JAR Signature 1115s 2024-11-13 23:09:40,060 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 1115s Verified using v1 scheme (JAR signing): true 1115s Verified using v2 scheme (APK Signature Scheme v2): false 1115s Verified using v3 scheme (APK Signature Scheme v3): false 1115s Verified using v4 scheme (APK Signature Scheme v4): false 1115s Verified for SourceStamp: false 1115s Number of signers: 1 1115s 1115s 2024-11-13 23:09:40,061 DEBUG: Density 120 not available, resizing down from 160 1115s 2024-11-13 23:09:40,063 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 1115s 2024-11-13 23:09:40,066 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 1115s 2024-11-13 23:09:40,070 DEBUG: Using JAR Signature 1115s 2024-11-13 23:09:40,073 DEBUG: Using JAR Signature 1115s 2024-11-13 23:09:40,421 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 1115s Verified using v1 scheme (JAR signing): true 1115s Verified using v2 scheme (APK Signature Scheme v2): false 1115s Verified using v3 scheme (APK Signature Scheme v3): false 1115s Verified using v4 scheme (APK Signature Scheme v4): false 1115s Verified for SourceStamp: false 1115s Number of signers: 1 1115s 1115s 2024-11-13 23:09:40,422 DEBUG: Density 120 not available, resizing down from 160 1115s 2024-11-13 23:09:40,424 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 1115s 2024-11-13 23:09:40,427 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 1115s 2024-11-13 23:09:40,430 DEBUG: Using JAR Signature 1115s 2024-11-13 23:09:40,433 DEBUG: Using JAR Signature 1116s 2024-11-13 23:09:41,000 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 1116s Verified using v1 scheme (JAR signing): true 1116s Verified using v2 scheme (APK Signature Scheme v2): false 1116s Verified using v3 scheme (APK Signature Scheme v3): false 1116s Verified using v4 scheme (APK Signature Scheme v4): false 1116s Verified for SourceStamp: false 1116s Number of signers: 1 1116s 1116s 2024-11-13 23:09:41,001 DEBUG: Density 120 not available, resizing down from 160 1116s 2024-11-13 23:09:41,002 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 1116s 2024-11-13 23:09:41,006 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 1116s 2024-11-13 23:09:41,009 DEBUG: Using JAR Signature 1116s 2024-11-13 23:09:41,012 DEBUG: Using JAR Signature 1116s 2024-11-13 23:09:41,367 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 1116s Verified using v1 scheme (JAR signing): true 1116s Verified using v2 scheme (APK Signature Scheme v2): false 1116s Verified using v3 scheme (APK Signature Scheme v3): false 1116s Verified using v4 scheme (APK Signature Scheme v4): false 1116s Verified for SourceStamp: false 1116s Number of signers: 1 1116s 1116s 2024-11-13 23:09:41,367 DEBUG: Density 120 not available, resizing down from 160 1116s 2024-11-13 23:09:41,369 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 1116s 2024-11-13 23:09:41,373 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 1116s 2024-11-13 23:09:41,376 DEBUG: Using JAR Signature 1116s 2024-11-13 23:09:41,379 DEBUG: Using JAR Signature 1116s 2024-11-13 23:09:41,705 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 1116s Verified using v1 scheme (JAR signing): true 1116s Verified using v2 scheme (APK Signature Scheme v2): false 1116s Verified using v3 scheme (APK Signature Scheme v3): false 1116s Verified using v4 scheme (APK Signature Scheme v4): false 1116s Verified for SourceStamp: false 1116s Number of signers: 1 1116s 1116s 2024-11-13 23:09:41,707 DEBUG: Density 120 not available, resizing down from 160 1116s 2024-11-13 23:09:41,710 DEBUG: Processing org.dyndns.fules.ck_20.apk 1116s 2024-11-13 23:09:41,721 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 1116s 2024-11-13 23:09:41,726 DEBUG: Using JAR Signature 1116s 2024-11-13 23:09:41,732 DEBUG: Using JAR Signature 1117s 2024-11-13 23:09:42,129 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 1117s Verified using v1 scheme (JAR signing): true 1117s Verified using v2 scheme (APK Signature Scheme v2): false 1117s Verified using v3 scheme (APK Signature Scheme v3): false 1117s Verified using v4 scheme (APK Signature Scheme v4): false 1117s Verified for SourceStamp: false 1117s Number of signers: 1 1117s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1117s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1117s 1117s 2024-11-13 23:09:42,134 DEBUG: Processing org.fdroid.ci_1.apk 1117s 2024-11-13 23:09:42,139 DEBUG: Getting signature of org.fdroid.ci_1.apk 1117s 2024-11-13 23:09:42,143 DEBUG: Using APK Signature v3 1117s 2024-11-13 23:09:42,147 DEBUG: Using APK Signature v3 1117s 2024-11-13 23:09:42,572 DEBUG: repo/org.fdroid.ci_1.apk: Verifies 1117s Verified using v1 scheme (JAR signing): false 1117s Verified using v2 scheme (APK Signature Scheme v2): false 1117s Verified using v3 scheme (APK Signature Scheme v3): true 1117s Verified using v4 scheme (APK Signature Scheme v4): false 1117s Verified for SourceStamp: false 1117s Number of signers: 1 1117s 1117s 2024-11-13 23:09:42,573 DEBUG: Processing org.sajeg.fallingblocks_3.apk 1117s 2024-11-13 23:09:42,575 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1117s 2024-11-13 23:09:42,588 DEBUG: Ignoring bad element in manifest: 1117s 2024-11-13 23:09:42,588 DEBUG: Ignoring bad element in manifest: 1117s 2024-11-13 23:09:42,589 DEBUG: Ignoring bad element in manifest: 1117s 2024-11-13 23:09:42,589 DEBUG: Getting signature of org.sajeg.fallingblocks_3.apk 1117s 2024-11-13 23:09:42,592 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1117s 2024-11-13 23:09:42,593 DEBUG: Using APK Signature v3 1117s 2024-11-13 23:09:42,597 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1117s 2024-11-13 23:09:42,599 DEBUG: Using APK Signature v3 1118s 2024-11-13 23:09:43,222 DEBUG: repo/org.sajeg.fallingblocks_3.apk: Verifies 1118s Verified using v1 scheme (JAR signing): true 1118s Verified using v2 scheme (APK Signature Scheme v2): true 1118s Verified using v3 scheme (APK Signature Scheme v3): true 1118s Verified using v4 scheme (APK Signature Scheme v4): false 1118s Verified for SourceStamp: false 1118s Number of signers: 1 1118s 1118s 2024-11-13 23:09:43,222 DEBUG: Processing souch.smsbypass_9.apk 1118s 2024-11-13 23:09:43,228 DEBUG: Getting signature of souch.smsbypass_9.apk 1118s 2024-11-13 23:09:43,232 DEBUG: Using JAR Signature 1118s 2024-11-13 23:09:43,236 DEBUG: Using JAR Signature 1118s 2024-11-13 23:09:43,624 DEBUG: repo/souch.smsbypass_9.apk: Verifies 1118s Verified using v1 scheme (JAR signing): true 1118s Verified using v2 scheme (APK Signature Scheme v2): false 1118s Verified using v3 scheme (APK Signature Scheme v3): false 1118s Verified using v4 scheme (APK Signature Scheme v4): false 1118s Verified for SourceStamp: false 1118s Number of signers: 1 1118s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1118s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1118s 1118s 2024-11-13 23:09:43,626 DEBUG: Density 120 not available, resizing down from 160 1118s 2024-11-13 23:09:43,629 DEBUG: Processing v1.v2.sig_1020.apk 1118s 2024-11-13 23:09:43,633 DEBUG: Getting signature of v1.v2.sig_1020.apk 1118s 2024-11-13 23:09:43,636 DEBUG: Using APK Signature v2 1118s 2024-11-13 23:09:43,640 DEBUG: Using APK Signature v2 1119s 2024-11-13 23:09:44,031 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 1119s Verified using v1 scheme (JAR signing): true 1119s Verified using v2 scheme (APK Signature Scheme v2): true 1119s Verified using v3 scheme (APK Signature Scheme v3): false 1119s Verified using v4 scheme (APK Signature Scheme v4): false 1119s Verified for SourceStamp: false 1119s Number of signers: 1 1119s 1119s 2024-11-13 23:09:44,032 DEBUG: Density 120 not available, resizing down from 160 1119s 2024-11-13 23:09:44,035 DEBUG: Processing v2.only.sig_2.apk 1119s 2024-11-13 23:09:44,039 DEBUG: Getting signature of v2.only.sig_2.apk 1119s 2024-11-13 23:09:44,042 DEBUG: Using APK Signature v2 1119s 2024-11-13 23:09:44,045 DEBUG: Using APK Signature v2 1119s 2024-11-13 23:09:44,389 DEBUG: repo/v2.only.sig_2.apk: Verifies 1119s Verified using v1 scheme (JAR signing): false 1119s Verified using v2 scheme (APK Signature Scheme v2): true 1119s Verified using v3 scheme (APK Signature Scheme v3): false 1119s Verified using v4 scheme (APK Signature Scheme v4): false 1119s Verified for SourceStamp: false 1119s Number of signers: 1 1119s 1119s 2024-11-13 23:09:44,390 DEBUG: Density 120 not available, resizing down from 160 1119s 2024-11-13 23:09:44,393 INFO: Generated skeleton metadata for SpeedoMeterApp.main 1119s 2024-11-13 23:09:44,396 INFO: Generated skeleton metadata for android.appsecurity.cts.tinyapp 1119s 2024-11-13 23:09:44,399 INFO: Generated skeleton metadata for apk.embedded 1119s 2024-11-13 23:09:44,402 INFO: Generated skeleton metadata for com.example.test.helloworld 1119s 2024-11-13 23:09:44,406 INFO: Generated skeleton metadata for com.politedroid 1119s 2024-11-13 23:09:44,410 INFO: Generated skeleton metadata for duplicate.permisssions 1119s 2024-11-13 23:09:44,415 INFO: Generated skeleton metadata for info.guardianproject.urzip 1119s 2024-11-13 23:09:44,421 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 1119s 2024-11-13 23:09:44,427 INFO: Generated skeleton metadata for no.min.target.sdk 1119s 2024-11-13 23:09:44,434 INFO: Generated skeleton metadata for obb.main.oldversion 1119s 2024-11-13 23:09:44,441 INFO: Generated skeleton metadata for obb.main.twoversions 1119s 2024-11-13 23:09:44,449 INFO: Generated skeleton metadata for obb.mainpatch.current 1119s 2024-11-13 23:09:44,458 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 1119s 2024-11-13 23:09:44,468 INFO: Generated skeleton metadata for org.dyndns.fules.ck 1119s 2024-11-13 23:09:44,477 INFO: Generated skeleton metadata for org.fdroid.ci 1119s 2024-11-13 23:09:44,487 INFO: Generated skeleton metadata for org.sajeg.fallingblocks 1119s 2024-11-13 23:09:44,498 INFO: Generated skeleton metadata for souch.smsbypass 1119s 2024-11-13 23:09:44,510 INFO: Generated skeleton metadata for v1.v2.sig 1119s 2024-11-13 23:09:44,522 INFO: Generated skeleton metadata for v2.only.sig 1119s 2024-11-13 23:09:44,538 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.b4NX/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1120s 2024-11-13 23:09:45,448 INFO: Creating signed index with this key (SHA256): 1120s 2024-11-13 23:09:45,449 INFO: C7 08 7B 40 B9 60 F9 23 A0 BE 15 1F 4D E7 3B 6C 07 F5 E4 63 08 12 2C 8C 57 1D 2C 04 5F 30 52 DE 1120s 2024-11-13 23:09:45,449 DEBUG: Directory: repo 1120s 2024-11-13 23:09:45,449 DEBUG: > jar cf index.jar index.xml 1120s 2024-11-13 23:09:45,751 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.b4NX/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1121s jar signed. 1121s 1121s Warning: 1121s The signer's certificate is self-signed. 1121s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1121s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1121s 2024-11-13 23:09:46,855 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1121s 2024-11-13 23:09:46,867 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.b4NX/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1122s jar signed. 1122s 1122s Warning: 1122s The signer's certificate is self-signed. 1122s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1122s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1122s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1123s 2024-11-13 23:09:47,979 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.b4NX/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias autopkgtest-lxd-fepetf.lxd --key-pass env:FDROID_KEY_PASS repo/entry.jar 1124s 2024-11-13 23:09:48,983 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.b4NX/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1124s 2024-11-13 23:09:49,900 DEBUG: Outputting JSON 1124s 2024-11-13 23:09:49,901 DEBUG: skip deploying full build logs: not enabled in config 1124s 2024-11-13 23:09:49,901 DEBUG: skip deploying full build logs: not enabled in config 1124s 2024-11-13 23:09:49,901 DEBUG: skip deploying full build logs: not enabled in config 1124s 2024-11-13 23:09:49,902 INFO: Finished 1125s + /usr/bin/fdroid readmeta 1125s + test -e repo/index.xml 1125s + test -e repo/index.jar 1125s + test -e repo/index-v1.jar 1125s + test -e tmp/apkcache.json 1125s + test -z tmp/apkcache.json 1125s + grep -F ' repo/SpeedoMeterApp.main_1.apk 1151s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 1151s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 1151s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk 1152s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk --> repo/org.fdroid.ci_1.apk 1152s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk 1152s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk --> repo/android.appsecurity.cts.tinyapp_10.apk 1152s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc2.apk 1153s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3a.apk 1153s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3b.apk 1154s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 1155s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 1155s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 1155s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 1155s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 1156s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 1156s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 1156s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 1156s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk 1157s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1157s [INFO ] androguard.apk: APK file was successfully validated! 1157s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1157s [INFO ] androguard.apk: APK file was successfully validated! 1157s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 1157s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk 1158s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk --> repo/org.sajeg.fallingblocks_3.apk 1158s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk 1158s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 1158s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 1159s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 1159s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk 1159s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 1159s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk 1160s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 1160s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk 1161s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 1161s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk 1161s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1161s [INFO ] androguard.apk: APK file was successfully validated! 1161s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1161s [INFO ] androguard.apk: APK file was successfully validated! 1161s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 1161s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 1162s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 1162s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk 1162s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 1162s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk 1163s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 1163s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk 1164s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 1164s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk 1164s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 1164s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk 1165s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 1165s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk 1165s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 1165s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 1166s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk 1166s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1166s [INFO ] androguard.apk: APK file was successfully validated! 1167s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1167s [INFO ] androguard.apk: APK file was successfully validated! 1167s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 1167s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1167s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 1167s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk 1168s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 1168s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk 1168s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 1169s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk 1170s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 1170s + /usr/bin/fdroid update --create-metadata --verbose 1170s 2024-11-13 23:10:35,516 DEBUG: Reading 'config.yml' 1170s 2024-11-13 23:10:35,517 WARNING: unsafe permissions on 'config.yml' (should be 0600)! 1170s 2024-11-13 23:10:35,519 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1170s 2024-11-13 23:10:35,519 DEBUG: skip deploying full build logs: not enabled in config 1170s 2024-11-13 23:10:35,520 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1170s 2024-11-13 23:10:35,521 DEBUG: Processing SpeedoMeterApp.main_1.apk 1170s 2024-11-13 23:10:35,618 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 1170s 2024-11-13 23:10:35,621 DEBUG: Using JAR Signature 1170s 2024-11-13 23:10:35,624 DEBUG: Using JAR Signature 1170s 2024-11-13 23:10:35,624 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 1171s 2024-11-13 23:10:35,976 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 1171s Verified using v1 scheme (JAR signing): true 1171s Verified using v2 scheme (APK Signature Scheme v2): false 1171s Verified using v3 scheme (APK Signature Scheme v3): false 1171s Verified using v4 scheme (APK Signature Scheme v4): false 1171s Verified for SourceStamp: false 1171s Number of signers: 1 1171s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1171s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1171s 1171s 2024-11-13 23:10:35,977 DEBUG: Processing android.appsecurity.cts.tinyapp_10.apk 1171s 2024-11-13 23:10:35,979 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1171s 2024-11-13 23:10:35,981 DEBUG: Getting signature of android.appsecurity.cts.tinyapp_10.apk 1171s 2024-11-13 23:10:35,983 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1171s 2024-11-13 23:10:35,984 DEBUG: Using APK Signature v3 1171s 2024-11-13 23:10:35,986 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1171s 2024-11-13 23:10:35,988 DEBUG: Using APK Signature v3 1171s 2024-11-13 23:10:36,277 DEBUG: repo/android.appsecurity.cts.tinyapp_10.apk: Verifies 1171s Verified using v1 scheme (JAR signing): false 1171s Verified using v2 scheme (APK Signature Scheme v2): false 1171s Verified using v3 scheme (APK Signature Scheme v3): true 1171s Verified using v4 scheme (APK Signature Scheme v4): false 1171s Verified for SourceStamp: false 1171s Number of signers: 1 1171s 1171s 2024-11-13 23:10:36,278 DEBUG: Processing apk.embedded_1.apk 1171s 2024-11-13 23:10:36,279 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1171s 2024-11-13 23:10:36,281 DEBUG: Getting signature of apk.embedded_1.apk 1171s 2024-11-13 23:10:36,283 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1171s 2024-11-13 23:10:36,284 DEBUG: Using APK Signature v3 1171s 2024-11-13 23:10:36,286 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1171s 2024-11-13 23:10:36,288 DEBUG: Using APK Signature v3 1171s 2024-11-13 23:10:36,674 DEBUG: repo/apk.embedded_1.apk: Verifies 1171s Verified using v1 scheme (JAR signing): true 1171s Verified using v2 scheme (APK Signature Scheme v2): true 1171s Verified using v3 scheme (APK Signature Scheme v3): true 1171s Verified using v4 scheme (APK Signature Scheme v4): false 1171s Verified for SourceStamp: false 1171s Number of signers: 1 1171s 1171s 2024-11-13 23:10:36,674 DEBUG: Processing com.example.test.helloworld_1.apk 1171s 2024-11-13 23:10:36,678 DEBUG: Getting signature of com.example.test.helloworld_1.apk 1171s 2024-11-13 23:10:36,682 DEBUG: Using JAR Signature 1171s 2024-11-13 23:10:36,685 DEBUG: Using JAR Signature 1172s 2024-11-13 23:10:37,027 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 1172s Verified using v1 scheme (JAR signing): true 1172s Verified using v2 scheme (APK Signature Scheme v2): false 1172s Verified using v3 scheme (APK Signature Scheme v3): false 1172s Verified using v4 scheme (APK Signature Scheme v4): false 1172s Verified for SourceStamp: false 1172s Number of signers: 1 1172s 1172s 2024-11-13 23:10:37,027 DEBUG: Processing com.politedroid_3.apk 1172s 2024-11-13 23:10:37,031 DEBUG: Getting signature of com.politedroid_3.apk 1172s 2024-11-13 23:10:37,034 DEBUG: Using JAR Signature 1172s 2024-11-13 23:10:37,037 DEBUG: Using JAR Signature 1172s 2024-11-13 23:10:37,385 DEBUG: repo/com.politedroid_3.apk: Verifies 1172s Verified using v1 scheme (JAR signing): true 1172s Verified using v2 scheme (APK Signature Scheme v2): false 1172s Verified using v3 scheme (APK Signature Scheme v3): false 1172s Verified using v4 scheme (APK Signature Scheme v4): false 1172s Verified for SourceStamp: false 1172s Number of signers: 1 1172s 1172s 2024-11-13 23:10:37,392 DEBUG: Processing com.politedroid_4.apk 1172s 2024-11-13 23:10:37,395 DEBUG: Getting signature of com.politedroid_4.apk 1172s 2024-11-13 23:10:37,398 DEBUG: Using JAR Signature 1172s 2024-11-13 23:10:37,402 DEBUG: Using JAR Signature 1172s 2024-11-13 23:10:37,753 DEBUG: repo/com.politedroid_4.apk: Verifies 1172s Verified using v1 scheme (JAR signing): true 1172s Verified using v2 scheme (APK Signature Scheme v2): false 1172s Verified using v3 scheme (APK Signature Scheme v3): false 1172s Verified using v4 scheme (APK Signature Scheme v4): false 1172s Verified for SourceStamp: false 1172s Number of signers: 1 1172s 1172s 2024-11-13 23:10:37,755 DEBUG: Processing com.politedroid_5.apk 1172s 2024-11-13 23:10:37,759 DEBUG: Getting signature of com.politedroid_5.apk 1172s 2024-11-13 23:10:37,761 DEBUG: Using JAR Signature 1172s 2024-11-13 23:10:37,764 DEBUG: Using JAR Signature 1173s 2024-11-13 23:10:38,124 DEBUG: repo/com.politedroid_5.apk: Verifies 1173s Verified using v1 scheme (JAR signing): true 1173s Verified using v2 scheme (APK Signature Scheme v2): false 1173s Verified using v3 scheme (APK Signature Scheme v3): false 1173s Verified using v4 scheme (APK Signature Scheme v4): false 1173s Verified for SourceStamp: false 1173s Number of signers: 1 1173s 1173s 2024-11-13 23:10:38,126 DEBUG: Processing com.politedroid_6.apk 1173s 2024-11-13 23:10:38,131 DEBUG: Getting signature of com.politedroid_6.apk 1173s 2024-11-13 23:10:38,136 DEBUG: Using JAR Signature 1173s 2024-11-13 23:10:38,140 DEBUG: Using JAR Signature 1173s 2024-11-13 23:10:38,485 DEBUG: repo/com.politedroid_6.apk: Verifies 1173s Verified using v1 scheme (JAR signing): true 1173s Verified using v2 scheme (APK Signature Scheme v2): false 1173s Verified using v3 scheme (APK Signature Scheme v3): false 1173s Verified using v4 scheme (APK Signature Scheme v4): false 1173s Verified for SourceStamp: false 1173s Number of signers: 1 1173s 1173s 2024-11-13 23:10:38,487 DEBUG: Processing duplicate.permisssions_9999999.apk 1173s 2024-11-13 23:10:38,493 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 1173s 2024-11-13 23:10:38,497 DEBUG: Using APK Signature v2 1173s 2024-11-13 23:10:38,502 DEBUG: Using APK Signature v2 1173s 2024-11-13 23:10:38,504 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 1173s 2024-11-13 23:10:38,862 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 1173s Verified using v1 scheme (JAR signing): true 1173s Verified using v2 scheme (APK Signature Scheme v2): true 1173s Verified using v3 scheme (APK Signature Scheme v3): false 1173s Verified using v4 scheme (APK Signature Scheme v4): false 1173s Verified for SourceStamp: false 1173s Number of signers: 1 1173s 1173s 2024-11-13 23:10:38,863 DEBUG: Density 120 not available, resizing down from 160 1173s 2024-11-13 23:10:38,865 DEBUG: Processing info.guardianproject.urzip_100.apk 1173s 2024-11-13 23:10:38,869 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 1173s 2024-11-13 23:10:38,873 DEBUG: Using JAR Signature 1173s 2024-11-13 23:10:38,876 DEBUG: Using JAR Signature 1174s 2024-11-13 23:10:39,219 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 1174s Verified using v1 scheme (JAR signing): true 1174s Verified using v2 scheme (APK Signature Scheme v2): false 1174s Verified using v3 scheme (APK Signature Scheme v3): false 1174s Verified using v4 scheme (APK Signature Scheme v4): false 1174s Verified for SourceStamp: false 1174s Number of signers: 1 1174s 1174s 2024-11-13 23:10:39,220 DEBUG: Density 120 not available, resizing down from 160 1174s 2024-11-13 23:10:39,222 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 1174s 2024-11-13 23:10:39,226 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 1174s 2024-11-13 23:10:39,229 DEBUG: Using JAR Signature 1174s 2024-11-13 23:10:39,233 DEBUG: Using JAR Signature 1174s 2024-11-13 23:10:39,569 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 1174s Verified using v1 scheme (JAR signing): true 1174s Verified using v2 scheme (APK Signature Scheme v2): false 1174s Verified using v3 scheme (APK Signature Scheme v3): false 1174s Verified using v4 scheme (APK Signature Scheme v4): false 1174s Verified for SourceStamp: false 1174s Number of signers: 1 1174s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1174s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1174s 1174s 2024-11-13 23:10:39,569 DEBUG: Processing no.min.target.sdk_987.apk 1174s 2024-11-13 23:10:39,573 DEBUG: Getting signature of no.min.target.sdk_987.apk 1174s 2024-11-13 23:10:39,576 DEBUG: Using APK Signature v2 1174s 2024-11-13 23:10:39,580 DEBUG: Using APK Signature v2 1174s 2024-11-13 23:10:39,581 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 1174s 2024-11-13 23:10:39,954 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 1174s Verified using v1 scheme (JAR signing): true 1174s Verified using v2 scheme (APK Signature Scheme v2): true 1174s Verified using v3 scheme (APK Signature Scheme v3): false 1174s Verified using v4 scheme (APK Signature Scheme v4): false 1174s Verified for SourceStamp: false 1174s Number of signers: 1 1174s 1174s 2024-11-13 23:10:39,954 DEBUG: Density 120 not available, resizing down from 160 1174s 2024-11-13 23:10:39,956 DEBUG: Processing obb.main.oldversion_1444412523.apk 1175s 2024-11-13 23:10:39,961 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 1175s 2024-11-13 23:10:39,966 DEBUG: Using APK Signature v2 1175s 2024-11-13 23:10:39,970 DEBUG: Using APK Signature v2 1175s 2024-11-13 23:10:40,341 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 1175s Verified using v1 scheme (JAR signing): true 1175s Verified using v2 scheme (APK Signature Scheme v2): true 1175s Verified using v3 scheme (APK Signature Scheme v3): false 1175s Verified using v4 scheme (APK Signature Scheme v4): false 1175s Verified for SourceStamp: false 1175s Number of signers: 1 1175s 1175s 2024-11-13 23:10:40,342 DEBUG: Density 120 not available, resizing down from 160 1175s 2024-11-13 23:10:40,344 DEBUG: Processing obb.main.twoversions_1101613.apk 1175s 2024-11-13 23:10:40,348 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 1175s 2024-11-13 23:10:40,352 DEBUG: Using JAR Signature 1175s 2024-11-13 23:10:40,356 DEBUG: Using JAR Signature 1175s 2024-11-13 23:10:40,696 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 1175s Verified using v1 scheme (JAR signing): true 1175s Verified using v2 scheme (APK Signature Scheme v2): false 1175s Verified using v3 scheme (APK Signature Scheme v3): false 1175s Verified using v4 scheme (APK Signature Scheme v4): false 1175s Verified for SourceStamp: false 1175s Number of signers: 1 1175s 1175s 2024-11-13 23:10:40,697 DEBUG: Density 120 not available, resizing down from 160 1175s 2024-11-13 23:10:40,699 DEBUG: Processing obb.main.twoversions_1101615.apk 1175s 2024-11-13 23:10:40,703 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 1175s 2024-11-13 23:10:40,707 DEBUG: Using JAR Signature 1175s 2024-11-13 23:10:40,711 DEBUG: Using JAR Signature 1176s 2024-11-13 23:10:41,052 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 1176s Verified using v1 scheme (JAR signing): true 1176s Verified using v2 scheme (APK Signature Scheme v2): false 1176s Verified using v3 scheme (APK Signature Scheme v3): false 1176s Verified using v4 scheme (APK Signature Scheme v4): false 1176s Verified for SourceStamp: false 1176s Number of signers: 1 1176s 1176s 2024-11-13 23:10:41,053 DEBUG: Density 120 not available, resizing down from 160 1176s 2024-11-13 23:10:41,055 DEBUG: Processing obb.main.twoversions_1101617.apk 1176s 2024-11-13 23:10:41,059 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 1176s 2024-11-13 23:10:41,063 DEBUG: Using JAR Signature 1176s 2024-11-13 23:10:41,067 DEBUG: Using JAR Signature 1176s 2024-11-13 23:10:41,417 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 1176s Verified using v1 scheme (JAR signing): true 1176s Verified using v2 scheme (APK Signature Scheme v2): false 1176s Verified using v3 scheme (APK Signature Scheme v3): false 1176s Verified using v4 scheme (APK Signature Scheme v4): false 1176s Verified for SourceStamp: false 1176s Number of signers: 1 1176s 1176s 2024-11-13 23:10:41,418 DEBUG: Density 120 not available, resizing down from 160 1176s 2024-11-13 23:10:41,420 DEBUG: Processing obb.mainpatch.current_1619.apk 1176s 2024-11-13 23:10:41,424 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 1176s 2024-11-13 23:10:41,428 DEBUG: Using JAR Signature 1176s 2024-11-13 23:10:41,432 DEBUG: Using JAR Signature 1176s 2024-11-13 23:10:41,805 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 1176s Verified using v1 scheme (JAR signing): true 1176s Verified using v2 scheme (APK Signature Scheme v2): false 1176s Verified using v3 scheme (APK Signature Scheme v3): false 1176s Verified using v4 scheme (APK Signature Scheme v4): false 1176s Verified for SourceStamp: false 1176s Number of signers: 1 1176s 1176s 2024-11-13 23:10:41,806 DEBUG: Density 120 not available, resizing down from 160 1176s 2024-11-13 23:10:41,808 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 1176s 2024-11-13 23:10:41,812 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 1176s 2024-11-13 23:10:41,815 DEBUG: Using JAR Signature 1176s 2024-11-13 23:10:41,818 DEBUG: Using JAR Signature 1177s 2024-11-13 23:10:42,150 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 1177s Verified using v1 scheme (JAR signing): true 1177s Verified using v2 scheme (APK Signature Scheme v2): false 1177s Verified using v3 scheme (APK Signature Scheme v3): false 1177s Verified using v4 scheme (APK Signature Scheme v4): false 1177s Verified for SourceStamp: false 1177s Number of signers: 1 1177s 1177s 2024-11-13 23:10:42,151 DEBUG: Density 120 not available, resizing down from 160 1177s 2024-11-13 23:10:42,153 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 1177s 2024-11-13 23:10:42,156 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 1177s 2024-11-13 23:10:42,159 DEBUG: Using JAR Signature 1177s 2024-11-13 23:10:42,162 DEBUG: Using JAR Signature 1177s 2024-11-13 23:10:42,496 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 1177s Verified using v1 scheme (JAR signing): true 1177s Verified using v2 scheme (APK Signature Scheme v2): false 1177s Verified using v3 scheme (APK Signature Scheme v3): false 1177s Verified using v4 scheme (APK Signature Scheme v4): false 1177s Verified for SourceStamp: false 1177s Number of signers: 1 1177s 1177s 2024-11-13 23:10:42,497 DEBUG: Density 120 not available, resizing down from 160 1177s 2024-11-13 23:10:42,499 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 1177s 2024-11-13 23:10:42,503 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 1177s 2024-11-13 23:10:42,506 DEBUG: Using JAR Signature 1177s 2024-11-13 23:10:42,509 DEBUG: Using JAR Signature 1177s 2024-11-13 23:10:42,858 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 1177s Verified using v1 scheme (JAR signing): true 1177s Verified using v2 scheme (APK Signature Scheme v2): false 1177s Verified using v3 scheme (APK Signature Scheme v3): false 1177s Verified using v4 scheme (APK Signature Scheme v4): false 1177s Verified for SourceStamp: false 1177s Number of signers: 1 1177s 1177s 2024-11-13 23:10:42,859 DEBUG: Density 120 not available, resizing down from 160 1177s 2024-11-13 23:10:42,861 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 1177s 2024-11-13 23:10:42,865 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 1177s 2024-11-13 23:10:42,868 DEBUG: Using JAR Signature 1177s 2024-11-13 23:10:42,871 DEBUG: Using JAR Signature 1178s 2024-11-13 23:10:43,189 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 1178s Verified using v1 scheme (JAR signing): true 1178s Verified using v2 scheme (APK Signature Scheme v2): false 1178s Verified using v3 scheme (APK Signature Scheme v3): false 1178s Verified using v4 scheme (APK Signature Scheme v4): false 1178s Verified for SourceStamp: false 1178s Number of signers: 1 1178s 1178s 2024-11-13 23:10:43,190 DEBUG: Density 120 not available, resizing down from 160 1178s 2024-11-13 23:10:43,192 DEBUG: Processing org.dyndns.fules.ck_20.apk 1178s 2024-11-13 23:10:43,198 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 1178s 2024-11-13 23:10:43,202 DEBUG: Using JAR Signature 1178s 2024-11-13 23:10:43,205 DEBUG: Using JAR Signature 1178s 2024-11-13 23:10:43,582 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 1178s Verified using v1 scheme (JAR signing): true 1178s Verified using v2 scheme (APK Signature Scheme v2): false 1178s Verified using v3 scheme (APK Signature Scheme v3): false 1178s Verified using v4 scheme (APK Signature Scheme v4): false 1178s Verified for SourceStamp: false 1178s Number of signers: 1 1178s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1178s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1178s 1178s 2024-11-13 23:10:43,584 DEBUG: Processing org.fdroid.ci_1.apk 1178s 2024-11-13 23:10:43,587 DEBUG: Getting signature of org.fdroid.ci_1.apk 1178s 2024-11-13 23:10:43,589 DEBUG: Using APK Signature v3 1178s 2024-11-13 23:10:43,591 DEBUG: Using APK Signature v3 1178s 2024-11-13 23:10:43,889 DEBUG: repo/org.fdroid.ci_1.apk: Verifies 1178s Verified using v1 scheme (JAR signing): false 1178s Verified using v2 scheme (APK Signature Scheme v2): false 1178s Verified using v3 scheme (APK Signature Scheme v3): true 1178s Verified using v4 scheme (APK Signature Scheme v4): false 1178s Verified for SourceStamp: false 1178s Number of signers: 1 1178s 1178s 2024-11-13 23:10:43,890 DEBUG: Processing org.sajeg.fallingblocks_3.apk 1178s 2024-11-13 23:10:43,892 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1178s 2024-11-13 23:10:43,905 DEBUG: Ignoring bad element in manifest: 1178s 2024-11-13 23:10:43,905 DEBUG: Ignoring bad element in manifest: 1178s 2024-11-13 23:10:43,905 DEBUG: Ignoring bad element in manifest: 1178s 2024-11-13 23:10:43,906 DEBUG: Getting signature of org.sajeg.fallingblocks_3.apk 1178s 2024-11-13 23:10:43,908 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1178s 2024-11-13 23:10:43,910 DEBUG: Using APK Signature v3 1178s 2024-11-13 23:10:43,913 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1178s 2024-11-13 23:10:43,915 DEBUG: Using APK Signature v3 1179s 2024-11-13 23:10:44,317 DEBUG: repo/org.sajeg.fallingblocks_3.apk: Verifies 1179s Verified using v1 scheme (JAR signing): true 1179s Verified using v2 scheme (APK Signature Scheme v2): true 1179s Verified using v3 scheme (APK Signature Scheme v3): true 1179s Verified using v4 scheme (APK Signature Scheme v4): false 1179s Verified for SourceStamp: false 1179s Number of signers: 1 1179s 1179s 2024-11-13 23:10:44,318 DEBUG: Processing souch.smsbypass_9.apk 1179s 2024-11-13 23:10:44,324 DEBUG: Getting signature of souch.smsbypass_9.apk 1179s 2024-11-13 23:10:44,328 DEBUG: Using JAR Signature 1179s 2024-11-13 23:10:44,333 DEBUG: Using JAR Signature 1179s 2024-11-13 23:10:44,711 DEBUG: repo/souch.smsbypass_9.apk: Verifies 1179s Verified using v1 scheme (JAR signing): true 1179s Verified using v2 scheme (APK Signature Scheme v2): false 1179s Verified using v3 scheme (APK Signature Scheme v3): false 1179s Verified using v4 scheme (APK Signature Scheme v4): false 1179s Verified for SourceStamp: false 1179s Number of signers: 1 1179s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1179s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1179s 1179s 2024-11-13 23:10:44,712 DEBUG: Density 120 not available, resizing down from 160 1179s 2024-11-13 23:10:44,715 DEBUG: Processing v1.v2.sig_1020.apk 1179s 2024-11-13 23:10:44,719 DEBUG: Getting signature of v1.v2.sig_1020.apk 1179s 2024-11-13 23:10:44,723 DEBUG: Using APK Signature v2 1179s 2024-11-13 23:10:44,726 DEBUG: Using APK Signature v2 1180s 2024-11-13 23:10:45,124 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 1180s Verified using v1 scheme (JAR signing): true 1180s Verified using v2 scheme (APK Signature Scheme v2): true 1180s Verified using v3 scheme (APK Signature Scheme v3): false 1180s Verified using v4 scheme (APK Signature Scheme v4): false 1180s Verified for SourceStamp: false 1180s Number of signers: 1 1180s 1180s 2024-11-13 23:10:45,125 DEBUG: Density 120 not available, resizing down from 160 1180s 2024-11-13 23:10:45,128 DEBUG: Processing v2.only.sig_2.apk 1180s 2024-11-13 23:10:45,132 DEBUG: Getting signature of v2.only.sig_2.apk 1180s 2024-11-13 23:10:45,136 DEBUG: Using APK Signature v2 1180s 2024-11-13 23:10:45,139 DEBUG: Using APK Signature v2 1180s 2024-11-13 23:10:45,441 DEBUG: repo/v2.only.sig_2.apk: Verifies 1180s Verified using v1 scheme (JAR signing): false 1180s Verified using v2 scheme (APK Signature Scheme v2): true 1180s Verified using v3 scheme (APK Signature Scheme v3): false 1180s Verified using v4 scheme (APK Signature Scheme v4): false 1180s Verified for SourceStamp: false 1180s Number of signers: 1 1180s 1180s 2024-11-13 23:10:45,442 DEBUG: Density 120 not available, resizing down from 160 1180s 2024-11-13 23:10:45,446 INFO: Generated skeleton metadata for SpeedoMeterApp.main 1180s 2024-11-13 23:10:45,449 INFO: Generated skeleton metadata for android.appsecurity.cts.tinyapp 1180s 2024-11-13 23:10:45,452 INFO: Generated skeleton metadata for apk.embedded 1180s 2024-11-13 23:10:45,455 INFO: Generated skeleton metadata for com.example.test.helloworld 1180s 2024-11-13 23:10:45,458 INFO: Generated skeleton metadata for com.politedroid 1180s 2024-11-13 23:10:45,462 INFO: Generated skeleton metadata for duplicate.permisssions 1180s 2024-11-13 23:10:45,467 INFO: Generated skeleton metadata for info.guardianproject.urzip 1180s 2024-11-13 23:10:45,473 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 1180s 2024-11-13 23:10:45,478 INFO: Generated skeleton metadata for no.min.target.sdk 1180s 2024-11-13 23:10:45,485 INFO: Generated skeleton metadata for obb.main.oldversion 1180s 2024-11-13 23:10:45,492 INFO: Generated skeleton metadata for obb.main.twoversions 1180s 2024-11-13 23:10:45,500 INFO: Generated skeleton metadata for obb.mainpatch.current 1180s 2024-11-13 23:10:45,508 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 1180s 2024-11-13 23:10:45,518 INFO: Generated skeleton metadata for org.dyndns.fules.ck 1180s 2024-11-13 23:10:45,527 INFO: Generated skeleton metadata for org.fdroid.ci 1180s 2024-11-13 23:10:45,537 INFO: Generated skeleton metadata for org.sajeg.fallingblocks 1180s 2024-11-13 23:10:45,548 INFO: Generated skeleton metadata for souch.smsbypass 1180s 2024-11-13 23:10:45,560 INFO: Generated skeleton metadata for v1.v2.sig 1180s 2024-11-13 23:10:45,572 INFO: Generated skeleton metadata for v2.only.sig 1180s 2024-11-13 23:10:45,588 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1181s 2024-11-13 23:10:46,299 INFO: Creating signed index with this key (SHA256): 1181s 2024-11-13 23:10:46,299 INFO: 6B A3 57 4C CB FA DF 88 EA 56 12 BF 9A 9E 70 40 4F 64 33 E2 00 9A 48 3E 46 35 F0 3A 44 77 6F 8E 1181s 2024-11-13 23:10:46,299 DEBUG: Directory: repo 1181s 2024-11-13 23:10:46,300 DEBUG: > jar cf index.jar index.xml 1181s 2024-11-13 23:10:46,501 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1182s jar signed. 1182s 1182s Warning: 1182s The signer's certificate is self-signed. 1182s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1182s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1182s 2024-11-13 23:10:47,506 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1182s 2024-11-13 23:10:47,518 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1183s jar signed. 1183s 1183s Warning: 1183s The signer's certificate is self-signed. 1183s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1183s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1183s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1183s 2024-11-13 23:10:48,531 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias autopkgtest-lxd-fepetf.lxd --key-pass env:FDROID_KEY_PASS repo/entry.jar 1184s 2024-11-13 23:10:49,337 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1185s 2024-11-13 23:10:50,154 DEBUG: Outputting JSON 1185s 2024-11-13 23:10:50,155 DEBUG: skip deploying full build logs: not enabled in config 1185s 2024-11-13 23:10:50,156 DEBUG: skip deploying full build logs: not enabled in config 1185s 2024-11-13 23:10:50,156 DEBUG: skip deploying full build logs: not enabled in config 1185s 2024-11-13 23:10:50,156 INFO: Finished 1185s + /usr/bin/fdroid readmeta 1185s 2024-11-13 23:10:50,725 WARNING: unsafe permissions on 'config.yml' (should be 0600)! 1185s + test -e repo/index.xml 1185s + test -e repo/index.jar 1185s + test -e repo/index-v1.jar 1185s + test -e tmp/apkcache.json 1185s + test -z tmp/apkcache.json 1185s + grep -F ' repo/SpeedoMeterApp.main_1.apk 1223s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk 1224s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 1224s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk 1224s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-min-sdk-30-poc.apk --> repo/org.fdroid.ci_1.apk 1224s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk 1225s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc1.apk --> repo/android.appsecurity.cts.tinyapp_10.apk 1225s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc2.apk 1226s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3a.apk 1226s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/issue-1128-poc3b.apk 1227s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 1227s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 1227s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 1228s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 1228s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 1228s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 1228s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 1229s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 1229s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk 1229s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1229s [INFO ] androguard.apk: APK file was successfully validated! 1230s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1230s [INFO ] androguard.apk: APK file was successfully validated! 1230s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 1230s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk 1230s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/org.sajeg.fallingblocks_3.apk --> repo/org.sajeg.fallingblocks_3.apk 1230s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk 1231s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 1231s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk 1231s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 1231s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk 1232s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 1232s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk 1232s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 1232s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk 1233s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 1233s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk 1233s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1233s [INFO ] androguard.apk: APK file was successfully validated! 1234s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1234s [INFO ] androguard.apk: APK file was successfully validated! 1234s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 1234s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 1234s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 1234s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk 1235s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 1235s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk 1235s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 1235s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk 1236s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 1236s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk 1236s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 1236s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk 1237s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 1237s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk 1238s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 1238s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 1238s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk 1238s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1238s [INFO ] androguard.apk: APK file was successfully validated! 1239s [INFO ] androguard.apk: Starting analysis on AndroidManifest.xml 1239s [INFO ] androguard.apk: APK file was successfully validated! 1239s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 1239s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1239s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 1239s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk 1240s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 1240s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip-release.apk 1240s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/urzip.apk 1241s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk 1242s /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 1242s + /usr/bin/fdroid update --create-metadata --verbose 1242s 2024-11-13 23:11:47,385 DEBUG: Reading 'config.yml' 1242s 2024-11-13 23:11:47,400 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1242s 2024-11-13 23:11:47,400 DEBUG: skip deploying full build logs: not enabled in config 1242s 2024-11-13 23:11:47,401 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1242s 2024-11-13 23:11:47,402 DEBUG: Processing SpeedoMeterApp.main_1.apk 1242s 2024-11-13 23:11:47,493 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 1242s 2024-11-13 23:11:47,496 DEBUG: Using JAR Signature 1242s 2024-11-13 23:11:47,499 DEBUG: Using JAR Signature 1242s 2024-11-13 23:11:47,499 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 1242s 2024-11-13 23:11:47,846 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 1242s Verified using v1 scheme (JAR signing): true 1242s Verified using v2 scheme (APK Signature Scheme v2): false 1242s Verified using v3 scheme (APK Signature Scheme v3): false 1242s Verified using v4 scheme (APK Signature Scheme v4): false 1242s Verified for SourceStamp: false 1242s Number of signers: 1 1242s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1242s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1242s 1242s 2024-11-13 23:11:47,847 DEBUG: Processing android.appsecurity.cts.tinyapp_10.apk 1242s 2024-11-13 23:11:47,848 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1242s 2024-11-13 23:11:47,850 DEBUG: Getting signature of android.appsecurity.cts.tinyapp_10.apk 1242s 2024-11-13 23:11:47,852 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1242s 2024-11-13 23:11:47,853 DEBUG: Using APK Signature v3 1242s 2024-11-13 23:11:47,855 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1242s 2024-11-13 23:11:47,856 DEBUG: Using APK Signature v3 1243s 2024-11-13 23:11:48,139 DEBUG: repo/android.appsecurity.cts.tinyapp_10.apk: Verifies 1243s Verified using v1 scheme (JAR signing): false 1243s Verified using v2 scheme (APK Signature Scheme v2): false 1243s Verified using v3 scheme (APK Signature Scheme v3): true 1243s Verified using v4 scheme (APK Signature Scheme v4): false 1243s Verified for SourceStamp: false 1243s Number of signers: 1 1243s 1243s 2024-11-13 23:11:48,139 DEBUG: Processing apk.embedded_1.apk 1243s 2024-11-13 23:11:48,141 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1243s 2024-11-13 23:11:48,143 DEBUG: Getting signature of apk.embedded_1.apk 1243s 2024-11-13 23:11:48,144 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1243s 2024-11-13 23:11:48,146 DEBUG: Using APK Signature v3 1243s 2024-11-13 23:11:48,147 WARNING: Requested API level 30 is larger than maximum we have, returning API level 28 instead. 1243s 2024-11-13 23:11:48,149 DEBUG: Using APK Signature v3 1243s 2024-11-13 23:11:48,506 DEBUG: repo/apk.embedded_1.apk: Verifies 1243s Verified using v1 scheme (JAR signing): true 1243s Verified using v2 scheme (APK Signature Scheme v2): true 1243s Verified using v3 scheme (APK Signature Scheme v3): true 1243s Verified using v4 scheme (APK Signature Scheme v4): false 1243s Verified for SourceStamp: false 1243s Number of signers: 1 1243s 1243s 2024-11-13 23:11:48,507 DEBUG: Processing com.example.test.helloworld_1.apk 1243s 2024-11-13 23:11:48,510 DEBUG: Getting signature of com.example.test.helloworld_1.apk 1243s 2024-11-13 23:11:48,514 DEBUG: Using JAR Signature 1243s 2024-11-13 23:11:48,517 DEBUG: Using JAR Signature 1243s 2024-11-13 23:11:48,850 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 1243s Verified using v1 scheme (JAR signing): true 1243s Verified using v2 scheme (APK Signature Scheme v2): false 1243s Verified using v3 scheme (APK Signature Scheme v3): false 1243s Verified using v4 scheme (APK Signature Scheme v4): false 1243s Verified for SourceStamp: false 1243s Number of signers: 1 1243s 1243s 2024-11-13 23:11:48,850 DEBUG: Processing com.politedroid_3.apk 1243s 2024-11-13 23:11:48,854 DEBUG: Getting signature of com.politedroid_3.apk 1243s 2024-11-13 23:11:48,857 DEBUG: Using JAR Signature 1243s 2024-11-13 23:11:48,860 DEBUG: Using JAR Signature 1244s 2024-11-13 23:11:49,194 DEBUG: repo/com.politedroid_3.apk: Verifies 1244s Verified using v1 scheme (JAR signing): true 1244s Verified using v2 scheme (APK Signature Scheme v2): false 1244s Verified using v3 scheme (APK Signature Scheme v3): false 1244s Verified using v4 scheme (APK Signature Scheme v4): false 1244s Verified for SourceStamp: false 1244s Number of signers: 1 1244s 1244s 2024-11-13 23:11:49,201 DEBUG: Processing com.politedroid_4.apk 1244s 2024-11-13 23:11:49,204 DEBUG: Getting signature of com.politedroid_4.apk 1244s 2024-11-13 23:11:49,207 DEBUG: Using JAR Signature 1244s 2024-11-13 23:11:49,210 DEBUG: Using JAR Signature 1244s 2024-11-13 23:11:49,556 DEBUG: repo/com.politedroid_4.apk: Verifies 1244s Verified using v1 scheme (JAR signing): true 1244s Verified using v2 scheme (APK Signature Scheme v2): false 1244s Verified using v3 scheme (APK Signature Scheme v3): false 1244s Verified using v4 scheme (APK Signature Scheme v4): false 1244s Verified for SourceStamp: false 1244s Number of signers: 1 1244s 1244s 2024-11-13 23:11:49,558 DEBUG: Processing com.politedroid_5.apk 1244s 2024-11-13 23:11:49,562 DEBUG: Getting signature of com.politedroid_5.apk 1244s 2024-11-13 23:11:49,564 DEBUG: Using JAR Signature 1244s 2024-11-13 23:11:49,567 DEBUG: Using JAR Signature 1244s 2024-11-13 23:11:49,903 DEBUG: repo/com.politedroid_5.apk: Verifies 1244s Verified using v1 scheme (JAR signing): true 1244s Verified using v2 scheme (APK Signature Scheme v2): false 1244s Verified using v3 scheme (APK Signature Scheme v3): false 1244s Verified using v4 scheme (APK Signature Scheme v4): false 1244s Verified for SourceStamp: false 1244s Number of signers: 1 1244s 1244s 2024-11-13 23:11:49,905 DEBUG: Processing com.politedroid_6.apk 1244s 2024-11-13 23:11:49,910 DEBUG: Getting signature of com.politedroid_6.apk 1244s 2024-11-13 23:11:49,914 DEBUG: Using JAR Signature 1244s 2024-11-13 23:11:49,917 DEBUG: Using JAR Signature 1245s 2024-11-13 23:11:50,250 DEBUG: repo/com.politedroid_6.apk: Verifies 1245s Verified using v1 scheme (JAR signing): true 1245s Verified using v2 scheme (APK Signature Scheme v2): false 1245s Verified using v3 scheme (APK Signature Scheme v3): false 1245s Verified using v4 scheme (APK Signature Scheme v4): false 1245s Verified for SourceStamp: false 1245s Number of signers: 1 1245s 1245s 2024-11-13 23:11:50,252 DEBUG: Processing duplicate.permisssions_9999999.apk 1245s 2024-11-13 23:11:50,258 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 1245s 2024-11-13 23:11:50,261 DEBUG: Using APK Signature v2 1245s 2024-11-13 23:11:50,266 DEBUG: Using APK Signature v2 1245s 2024-11-13 23:11:50,268 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 1245s 2024-11-13 23:11:50,615 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 1245s Verified using v1 scheme (JAR signing): true 1245s Verified using v2 scheme (APK Signature Scheme v2): true 1245s Verified using v3 scheme (APK Signature Scheme v3): false 1245s Verified using v4 scheme (APK Signature Scheme v4): false 1245s Verified for SourceStamp: false 1245s Number of signers: 1 1245s 1245s 2024-11-13 23:11:50,616 DEBUG: Density 120 not available, resizing down from 160 1245s 2024-11-13 23:11:50,617 DEBUG: Processing info.guardianproject.urzip_100.apk 1245s 2024-11-13 23:11:50,621 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 1245s 2024-11-13 23:11:50,625 DEBUG: Using JAR Signature 1245s 2024-11-13 23:11:50,628 DEBUG: Using JAR Signature 1246s 2024-11-13 23:11:50,961 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 1246s Verified using v1 scheme (JAR signing): true 1246s Verified using v2 scheme (APK Signature Scheme v2): false 1246s Verified using v3 scheme (APK Signature Scheme v3): false 1246s Verified using v4 scheme (APK Signature Scheme v4): false 1246s Verified for SourceStamp: false 1246s Number of signers: 1 1246s 1246s 2024-11-13 23:11:50,962 DEBUG: Density 120 not available, resizing down from 160 1246s 2024-11-13 23:11:50,964 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 1246s 2024-11-13 23:11:50,967 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 1246s 2024-11-13 23:11:50,971 DEBUG: Using JAR Signature 1246s 2024-11-13 23:11:50,974 DEBUG: Using JAR Signature 1246s 2024-11-13 23:11:51,308 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 1246s Verified using v1 scheme (JAR signing): true 1246s Verified using v2 scheme (APK Signature Scheme v2): false 1246s Verified using v3 scheme (APK Signature Scheme v3): false 1246s Verified using v4 scheme (APK Signature Scheme v4): false 1246s Verified for SourceStamp: false 1246s Number of signers: 1 1246s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1246s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1246s 1246s 2024-11-13 23:11:51,309 DEBUG: Processing no.min.target.sdk_987.apk 1246s 2024-11-13 23:11:51,312 DEBUG: Getting signature of no.min.target.sdk_987.apk 1246s 2024-11-13 23:11:51,315 DEBUG: Using APK Signature v2 1246s 2024-11-13 23:11:51,319 DEBUG: Using APK Signature v2 1246s 2024-11-13 23:11:51,320 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 1246s 2024-11-13 23:11:51,682 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 1246s Verified using v1 scheme (JAR signing): true 1246s Verified using v2 scheme (APK Signature Scheme v2): true 1246s Verified using v3 scheme (APK Signature Scheme v3): false 1246s Verified using v4 scheme (APK Signature Scheme v4): false 1246s Verified for SourceStamp: false 1246s Number of signers: 1 1246s 1246s 2024-11-13 23:11:51,684 DEBUG: Density 120 not available, resizing down from 160 1246s 2024-11-13 23:11:51,686 DEBUG: Processing obb.main.oldversion_1444412523.apk 1246s 2024-11-13 23:11:51,691 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 1246s 2024-11-13 23:11:51,695 DEBUG: Using APK Signature v2 1246s 2024-11-13 23:11:51,700 DEBUG: Using APK Signature v2 1247s 2024-11-13 23:11:52,047 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 1247s Verified using v1 scheme (JAR signing): true 1247s Verified using v2 scheme (APK Signature Scheme v2): true 1247s Verified using v3 scheme (APK Signature Scheme v3): false 1247s Verified using v4 scheme (APK Signature Scheme v4): false 1247s Verified for SourceStamp: false 1247s Number of signers: 1 1247s 1247s 2024-11-13 23:11:52,048 DEBUG: Density 120 not available, resizing down from 160 1247s 2024-11-13 23:11:52,050 DEBUG: Processing obb.main.twoversions_1101613.apk 1247s 2024-11-13 23:11:52,054 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 1247s 2024-11-13 23:11:52,057 DEBUG: Using JAR Signature 1247s 2024-11-13 23:11:52,061 DEBUG: Using JAR Signature 1247s 2024-11-13 23:11:52,388 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 1247s Verified using v1 scheme (JAR signing): true 1247s Verified using v2 scheme (APK Signature Scheme v2): false 1247s Verified using v3 scheme (APK Signature Scheme v3): false 1247s Verified using v4 scheme (APK Signature Scheme v4): false 1247s Verified for SourceStamp: false 1247s Number of signers: 1 1247s 1247s 2024-11-13 23:11:52,388 DEBUG: Density 120 not available, resizing down from 160 1247s 2024-11-13 23:11:52,390 DEBUG: Processing obb.main.twoversions_1101615.apk 1247s 2024-11-13 23:11:52,394 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 1247s 2024-11-13 23:11:52,398 DEBUG: Using JAR Signature 1247s 2024-11-13 23:11:52,401 DEBUG: Using JAR Signature 1247s 2024-11-13 23:11:52,736 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 1247s Verified using v1 scheme (JAR signing): true 1247s Verified using v2 scheme (APK Signature Scheme v2): false 1247s Verified using v3 scheme (APK Signature Scheme v3): false 1247s Verified using v4 scheme (APK Signature Scheme v4): false 1247s Verified for SourceStamp: false 1247s Number of signers: 1 1247s 1247s 2024-11-13 23:11:52,737 DEBUG: Density 120 not available, resizing down from 160 1247s 2024-11-13 23:11:52,739 DEBUG: Processing obb.main.twoversions_1101617.apk 1247s 2024-11-13 23:11:52,743 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 1247s 2024-11-13 23:11:52,746 DEBUG: Using JAR Signature 1247s 2024-11-13 23:11:52,750 DEBUG: Using JAR Signature 1248s 2024-11-13 23:11:53,068 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 1248s Verified using v1 scheme (JAR signing): true 1248s Verified using v2 scheme (APK Signature Scheme v2): false 1248s Verified using v3 scheme (APK Signature Scheme v3): false 1248s Verified using v4 scheme (APK Signature Scheme v4): false 1248s Verified for SourceStamp: false 1248s Number of signers: 1 1248s 1248s 2024-11-13 23:11:53,069 DEBUG: Density 120 not available, resizing down from 160 1248s 2024-11-13 23:11:53,071 DEBUG: Processing obb.mainpatch.current_1619.apk 1248s 2024-11-13 23:11:53,075 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 1248s 2024-11-13 23:11:53,078 DEBUG: Using JAR Signature 1248s 2024-11-13 23:11:53,082 DEBUG: Using JAR Signature 1248s 2024-11-13 23:11:53,675 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 1248s Verified using v1 scheme (JAR signing): true 1248s Verified using v2 scheme (APK Signature Scheme v2): false 1248s Verified using v3 scheme (APK Signature Scheme v3): false 1248s Verified using v4 scheme (APK Signature Scheme v4): false 1248s Verified for SourceStamp: false 1248s Number of signers: 1 1248s 1248s 2024-11-13 23:11:53,677 DEBUG: Density 120 not available, resizing down from 160 1248s 2024-11-13 23:11:53,681 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 1248s 2024-11-13 23:11:53,687 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 1248s 2024-11-13 23:11:53,692 DEBUG: Using JAR Signature 1248s 2024-11-13 23:11:53,698 DEBUG: Using JAR Signature 1249s 2024-11-13 23:11:54,027 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 1249s Verified using v1 scheme (JAR signing): true 1249s Verified using v2 scheme (APK Signature Scheme v2): false 1249s Verified using v3 scheme (APK Signature Scheme v3): false 1249s Verified using v4 scheme (APK Signature Scheme v4): false 1249s Verified for SourceStamp: false 1249s Number of signers: 1 1249s 1249s 2024-11-13 23:11:54,029 DEBUG: Density 120 not available, resizing down from 160 1249s 2024-11-13 23:11:54,033 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 1249s 2024-11-13 23:11:54,039 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 1249s 2024-11-13 23:11:54,044 DEBUG: Using JAR Signature 1249s 2024-11-13 23:11:54,050 DEBUG: Using JAR Signature 1249s 2024-11-13 23:11:54,358 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 1249s Verified using v1 scheme (JAR signing): true 1249s Verified using v2 scheme (APK Signature Scheme v2): false 1249s Verified using v3 scheme (APK Signature Scheme v3): false 1249s Verified using v4 scheme (APK Signature Scheme v4): false 1249s Verified for SourceStamp: false 1249s Number of signers: 1 1249s 1249s 2024-11-13 23:11:54,360 DEBUG: Density 120 not available, resizing down from 160 1249s 2024-11-13 23:11:54,363 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 1249s 2024-11-13 23:11:54,369 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 1249s 2024-11-13 23:11:54,374 DEBUG: Using JAR Signature 1249s 2024-11-13 23:11:54,380 DEBUG: Using JAR Signature 1249s 2024-11-13 23:11:54,694 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 1249s Verified using v1 scheme (JAR signing): true 1249s Verified using v2 scheme (APK Signature Scheme v2): false 1249s Verified using v3 scheme (APK Signature Scheme v3): false 1249s Verified using v4 scheme (APK Signature Scheme v4): false 1249s Verified for SourceStamp: false 1249s Number of signers: 1 1249s 1249s 2024-11-13 23:11:54,696 DEBUG: Density 120 not available, resizing down from 160 1249s 2024-11-13 23:11:54,699 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 1249s 2024-11-13 23:11:54,705 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 1249s 2024-11-13 23:11:54,711 DEBUG: Using JAR Signature 1249s 2024-11-13 23:11:54,717 DEBUG: Using JAR Signature 1250s 2024-11-13 23:11:55,031 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 1250s Verified using v1 scheme (JAR signing): true 1250s Verified using v2 scheme (APK Signature Scheme v2): false 1250s Verified using v3 scheme (APK Signature Scheme v3): false 1250s Verified using v4 scheme (APK Signature Scheme v4): false 1250s Verified for SourceStamp: false 1250s Number of signers: 1 1250s 1250s 2024-11-13 23:11:55,033 DEBUG: Density 120 not available, resizing down from 160 1250s 2024-11-13 23:11:55,036 DEBUG: Processing org.dyndns.fules.ck_20.apk 1250s 2024-11-13 23:11:55,047 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 1250s 2024-11-13 23:11:55,052 DEBUG: Using JAR Signature 1250s 2024-11-13 23:11:55,058 DEBUG: Using JAR Signature 1250s 2024-11-13 23:11:55,451 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 1250s Verified using v1 scheme (JAR signing): true 1250s Verified using v2 scheme (APK Signature Scheme v2): false 1250s Verified using v3 scheme (APK Signature Scheme v3): false 1250s Verified using v4 scheme (APK Signature Scheme v4): false 1250s Verified for SourceStamp: false 1250s Number of signers: 1 1250s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1250s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1250s 1250s 2024-11-13 23:11:55,454 DEBUG: Processing org.fdroid.ci_1.apk 1250s 2024-11-13 23:11:55,456 DEBUG: Getting signature of org.fdroid.ci_1.apk 1250s 2024-11-13 23:11:55,458 DEBUG: Using APK Signature v3 1250s 2024-11-13 23:11:55,460 DEBUG: Using APK Signature v3 1250s 2024-11-13 23:11:55,782 DEBUG: repo/org.fdroid.ci_1.apk: Verifies 1250s Verified using v1 scheme (JAR signing): false 1250s Verified using v2 scheme (APK Signature Scheme v2): false 1250s Verified using v3 scheme (APK Signature Scheme v3): true 1250s Verified using v4 scheme (APK Signature Scheme v4): false 1250s Verified for SourceStamp: false 1250s Number of signers: 1 1250s 1250s 2024-11-13 23:11:55,783 DEBUG: Processing org.sajeg.fallingblocks_3.apk 1250s 2024-11-13 23:11:55,785 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1250s 2024-11-13 23:11:55,798 DEBUG: Ignoring bad element in manifest: 1250s 2024-11-13 23:11:55,798 DEBUG: Ignoring bad element in manifest: 1250s 2024-11-13 23:11:55,799 DEBUG: Ignoring bad element in manifest: 1250s 2024-11-13 23:11:55,799 DEBUG: Getting signature of org.sajeg.fallingblocks_3.apk 1250s 2024-11-13 23:11:55,801 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1250s 2024-11-13 23:11:55,803 DEBUG: Using APK Signature v3 1250s 2024-11-13 23:11:55,806 WARNING: Requested API level 32 is larger than maximum we have, returning API level 28 instead. 1250s 2024-11-13 23:11:55,807 DEBUG: Using APK Signature v3 1251s 2024-11-13 23:11:56,466 DEBUG: repo/org.sajeg.fallingblocks_3.apk: Verifies 1251s Verified using v1 scheme (JAR signing): true 1251s Verified using v2 scheme (APK Signature Scheme v2): true 1251s Verified using v3 scheme (APK Signature Scheme v3): true 1251s Verified using v4 scheme (APK Signature Scheme v4): false 1251s Verified for SourceStamp: false 1251s Number of signers: 1 1251s 1251s 2024-11-13 23:11:56,467 DEBUG: Processing souch.smsbypass_9.apk 1251s 2024-11-13 23:11:56,472 DEBUG: Getting signature of souch.smsbypass_9.apk 1251s 2024-11-13 23:11:56,476 DEBUG: Using JAR Signature 1251s 2024-11-13 23:11:56,480 DEBUG: Using JAR Signature 1251s 2024-11-13 23:11:56,865 DEBUG: repo/souch.smsbypass_9.apk: Verifies 1251s Verified using v1 scheme (JAR signing): true 1251s Verified using v2 scheme (APK Signature Scheme v2): false 1251s Verified using v3 scheme (APK Signature Scheme v3): false 1251s Verified using v4 scheme (APK Signature Scheme v4): false 1251s Verified for SourceStamp: false 1251s Number of signers: 1 1251s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1251s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1251s 1251s 2024-11-13 23:11:56,867 DEBUG: Density 120 not available, resizing down from 160 1251s 2024-11-13 23:11:56,870 DEBUG: Processing v1.v2.sig_1020.apk 1251s 2024-11-13 23:11:56,873 DEBUG: Getting signature of v1.v2.sig_1020.apk 1251s 2024-11-13 23:11:56,876 DEBUG: Using APK Signature v2 1251s 2024-11-13 23:11:56,880 DEBUG: Using APK Signature v2 1252s 2024-11-13 23:11:57,235 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 1252s Verified using v1 scheme (JAR signing): true 1252s Verified using v2 scheme (APK Signature Scheme v2): true 1252s Verified using v3 scheme (APK Signature Scheme v3): false 1252s Verified using v4 scheme (APK Signature Scheme v4): false 1252s Verified for SourceStamp: false 1252s Number of signers: 1 1252s 1252s 2024-11-13 23:11:57,236 DEBUG: Density 120 not available, resizing down from 160 1252s 2024-11-13 23:11:57,237 DEBUG: Processing v2.only.sig_2.apk 1252s 2024-11-13 23:11:57,241 DEBUG: Getting signature of v2.only.sig_2.apk 1252s 2024-11-13 23:11:57,244 DEBUG: Using APK Signature v2 1252s 2024-11-13 23:11:57,247 DEBUG: Using APK Signature v2 1252s 2024-11-13 23:11:57,549 DEBUG: repo/v2.only.sig_2.apk: Verifies 1252s Verified using v1 scheme (JAR signing): false 1252s Verified using v2 scheme (APK Signature Scheme v2): true 1252s Verified using v3 scheme (APK Signature Scheme v3): false 1252s Verified using v4 scheme (APK Signature Scheme v4): false 1252s Verified for SourceStamp: false 1252s Number of signers: 1 1252s 1252s 2024-11-13 23:11:57,550 DEBUG: Density 120 not available, resizing down from 160 1252s 2024-11-13 23:11:57,553 INFO: Generated skeleton metadata for SpeedoMeterApp.main 1252s 2024-11-13 23:11:57,556 INFO: Generated skeleton metadata for android.appsecurity.cts.tinyapp 1252s 2024-11-13 23:11:57,558 INFO: Generated skeleton metadata for apk.embedded 1252s 2024-11-13 23:11:57,561 INFO: Generated skeleton metadata for com.example.test.helloworld 1252s 2024-11-13 23:11:57,564 INFO: Generated skeleton metadata for com.politedroid 1252s 2024-11-13 23:11:57,568 INFO: Generated skeleton metadata for duplicate.permisssions 1252s 2024-11-13 23:11:57,572 INFO: Generated skeleton metadata for info.guardianproject.urzip 1252s 2024-11-13 23:11:57,578 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 1252s 2024-11-13 23:11:57,583 INFO: Generated skeleton metadata for no.min.target.sdk 1252s 2024-11-13 23:11:57,589 INFO: Generated skeleton metadata for obb.main.oldversion 1252s 2024-11-13 23:11:57,595 INFO: Generated skeleton metadata for obb.main.twoversions 1252s 2024-11-13 23:11:57,602 INFO: Generated skeleton metadata for obb.mainpatch.current 1252s 2024-11-13 23:11:57,610 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 1252s 2024-11-13 23:11:57,618 INFO: Generated skeleton metadata for org.dyndns.fules.ck 1252s 2024-11-13 23:11:57,627 INFO: Generated skeleton metadata for org.fdroid.ci 1252s 2024-11-13 23:11:57,636 INFO: Generated skeleton metadata for org.sajeg.fallingblocks 1252s 2024-11-13 23:11:57,646 INFO: Generated skeleton metadata for souch.smsbypass 1252s 2024-11-13 23:11:57,656 INFO: Generated skeleton metadata for v1.v2.sig 1252s 2024-11-13 23:11:57,669 INFO: Generated skeleton metadata for v2.only.sig 1252s 2024-11-13 23:11:57,684 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1253s 2024-11-13 23:11:58,496 INFO: Creating signed index with this key (SHA256): 1253s 2024-11-13 23:11:58,496 INFO: 67 3E 9D 63 74 6E 6E D4 14 D8 F6 13 41 58 9B F4 5F AA 59 19 A8 21 5A 2D B6 BB 84 37 56 F7 DA 16 1253s 2024-11-13 23:11:58,496 DEBUG: Directory: repo 1253s 2024-11-13 23:11:58,496 DEBUG: > jar cf index.jar index.xml 1253s 2024-11-13 23:11:58,798 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1254s jar signed. 1254s 1254s Warning: 1254s The signer's certificate is self-signed. 1254s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1254s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1254s 2024-11-13 23:11:59,901 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1254s 2024-11-13 23:11:59,913 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1255s jar signed. 1255s 1255s Warning: 1255s The signer's certificate is self-signed. 1255s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1255s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1255s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1255s 2024-11-13 23:12:00,925 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias autopkgtest-lxd-fepetf.lxd --key-pass env:FDROID_KEY_PASS repo/entry.jar 1257s 2024-11-13 23:12:02,028 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1257s 2024-11-13 23:12:02,745 DEBUG: Outputting JSON 1257s 2024-11-13 23:12:02,746 DEBUG: skip deploying full build logs: not enabled in config 1257s 2024-11-13 23:12:02,746 DEBUG: skip deploying full build logs: not enabled in config 1257s 2024-11-13 23:12:02,747 DEBUG: skip deploying full build logs: not enabled in config 1257s 2024-11-13 23:12:02,747 INFO: Finished 1257s + /usr/bin/fdroid readmeta 1258s + test -e repo/index.xml 1258s + test -e repo/index.jar 1258s + test -e repo/index-v1.jar 1258s + grep -F ' /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1259s 2024-11-13 23:12:04,709 INFO: Creating signed index with this key (SHA256): 1259s 2024-11-13 23:12:04,709 INFO: 67 3E 9D 63 74 6E 6E D4 14 D8 F6 13 41 58 9B F4 5F AA 59 19 A8 21 5A 2D B6 BB 84 37 56 F7 DA 16 1259s 2024-11-13 23:12:04,709 DEBUG: Directory: repo 1259s 2024-11-13 23:12:04,709 DEBUG: > jar cf index.jar index.xml 1259s 2024-11-13 23:12:04,911 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1260s jar signed. 1260s 1260s Warning: 1260s The signer's certificate is self-signed. 1260s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1260s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1260s 2024-11-13 23:12:05,915 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1260s 2024-11-13 23:12:05,931 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar autopkgtest-lxd-fepetf.lxd -keypass:env FDROID_KEY_PASS 1262s jar signed. 1262s 1262s Warning: 1262s The signer's certificate is self-signed. 1262s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1262s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1262s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1262s 2024-11-13 23:12:07,244 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias autopkgtest-lxd-fepetf.lxd --key-pass env:FDROID_KEY_PASS repo/entry.jar 1263s 2024-11-13 23:12:08,048 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias autopkgtest-lxd-fepetf.lxd -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.UZW5/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1264s 2024-11-13 23:12:09,065 DEBUG: Outputting JSON 1264s 2024-11-13 23:12:09,066 DEBUG: skip deploying full build logs: not enabled in config 1264s 2024-11-13 23:12:09,067 DEBUG: skip deploying full build logs: not enabled in config 1264s 2024-11-13 23:12:09,067 DEBUG: skip deploying full build logs: not enabled in config 1264s 2024-11-13 23:12:09,067 INFO: Finished 1264s + /usr/bin/fdroid readmeta 1264s + test -e repo/index.xml 1264s + test -e repo/index.jar 1264s + test -e repo/index-v1.jar 1264s + test -e tmp/apkcache.json 1264s + test -z tmp/apkcache.json 1264s + grep -F ' 1270s sys.exit(load_entry_point('fdroidserver==2.3a2', 'console_scripts', 'fdroid')()) 1270s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 1270s File "/usr/lib/python3/dist-packages/fdroidserver/__main__.py", line 203, in main 1270s mod.main() 1270s File "/usr/lib/python3/dist-packages/fdroidserver/update.py", line 2752, in main 1270s fdroidserver.index.make(repoapps, apks, repodirs[0], False) 1270s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 71, in make 1270s common.assert_config_keystore(common.config) 1270s File "/usr/lib/python3/dist-packages/fdroidserver/common.py", line 731, in assert_config_keystore 1270s raise FDroidException("This command requires a signing key, " 1270s fdroidserver.exception.FDroidException: This command requires a signing key, you can create one using: fdroid update --create-key 1270s + '[' 1 -eq 0 ']' 1270s + echo '`fdroid update` prompted to add keystore' 1270s + set -e 1270s + touch /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.IvCZ/keystore.p12 1270s + echo 'keystore: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.IvCZ/keystore.p12' 1270s + echo 'repo_keyalias: foo' 1270s + echo 'keystorepass: foo' 1270s + echo 'keypass: foo' 1270s + set +e 1270s + /usr/bin/fdroid update --create-metadata --verbose 1270s `fdroid update` prompted to add keystore 1271s 2024-11-13 23:12:15,990 DEBUG: Reading 'config.yml' 1271s 2024-11-13 23:12:15,992 WARNING: unsafe permissions on 'config.yml' (should be 0600)! 1271s 2024-11-13 23:12:15,995 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1271s 2024-11-13 23:12:15,996 DEBUG: skip deploying full build logs: not enabled in config 1271s 2024-11-13 23:12:15,996 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1271s 2024-11-13 23:12:16,001 DEBUG: Reading urzip.apk from cache 1271s 2024-11-13 23:12:16,004 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias foo -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.IvCZ/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 1280s Traceback (most recent call last): 1280s File "/usr/bin/fdroid", line 33, in 1280s sys.exit(load_entry_point('fdroidserver==2.3a2', 'console_scripts', 'fdroid')()) 1280s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 1280s File "/usr/lib/python3/dist-packages/fdroidserver/__main__.py", line 203, in main 1280s mod.main() 1280s File "/usr/lib/python3/dist-packages/fdroidserver/update.py", line 2752, in main 1280s fdroidserver.index.make(repoapps, apks, repodirs[0], False) 1280s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 121, in make 1280s make_v0(sortedapps, apks, repodir, repodict, requestsdict, 1280s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 1080, in make_v0 1280s pubkey, repo_pubkey_fingerprint = extract_pubkey() 1280s ^^^^^^^^^^^^^^^^ 1280s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 1390, in extract_pubkey 1280s raise FDroidException(msg) 1280s fdroidserver.exception.FDroidException: Failed to get repo pubkey! 1281s `fdroid update` prompted to add keystore 1281s ============================================================================== 1281s copy tests/repo, update with binary transparency log 1281s + '[' 1 -eq 0 ']' 1281s + echo '`fdroid update` prompted to add keystore' 1281s + set -e 1281s + echo_header 'copy tests/repo, update with binary transparency log' 1281s ++ create_test_dir 1281s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1281s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1281s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO 1281s ++ create_test_dir 1281s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1281s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1281s + GIT_REMOTE=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.gnRI 1281s + GNUPGHOME=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/gnupghome 1281s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO 1281s + fdroid_init_with_prebuilt_keystore 1281s + '[' -z '' ']' 1281s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 1281s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 1281s 1281s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO" with this config: 1281s 1281s Android SDK: /usr/lib/android-sdk 1281s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 1281s Alias for key in store: sova 1281s 1281s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/repo" 1281s then run "fdroid update -c; fdroid update". You might also want to edit 1281s "config.yml" to set the URL, repo name, and more. You should also set up 1281s a signing key (a temporary one might have been automatically generated). 1281s 1281s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 1281s and https://f-droid.org/docs/Signing_Process 1281s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 1281s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 1281s + cp -a /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/stats /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/ 1281s + echo 'binary_transparency_remote: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.gnRI' 1281s + /usr/bin/fdroid update --verbose 1282s 2024-11-13 23:12:27,130 DEBUG: Reading 'config.yml' 1282s 2024-11-13 23:12:27,145 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1282s 2024-11-13 23:12:27,146 DEBUG: skip deploying full build logs: not enabled in config 1282s 2024-11-13 23:12:27,146 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1282s 2024-11-13 23:12:27,152 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 1282s 2024-11-13 23:12:27,152 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 1282s 2024-11-13 23:12:27,152 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 1282s 2024-11-13 23:12:27,237 DEBUG: Processing com.example.test.helloworld_1.apk 1282s 2024-11-13 23:12:27,309 DEBUG: Getting signature of com.example.test.helloworld_1.apk 1282s 2024-11-13 23:12:27,312 DEBUG: Using JAR Signature 1282s 2024-11-13 23:12:27,316 DEBUG: Using JAR Signature 1282s 2024-11-13 23:12:27,673 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 1282s Verified using v1 scheme (JAR signing): true 1282s Verified using v2 scheme (APK Signature Scheme v2): false 1282s Verified using v3 scheme (APK Signature Scheme v3): false 1282s Verified using v4 scheme (APK Signature Scheme v4): false 1282s Verified for SourceStamp: false 1282s Number of signers: 1 1282s 1282s 2024-11-13 23:12:27,674 DEBUG: Processing com.politedroid_3.apk 1282s 2024-11-13 23:12:27,678 DEBUG: Getting signature of com.politedroid_3.apk 1282s 2024-11-13 23:12:27,681 DEBUG: Using JAR Signature 1282s 2024-11-13 23:12:27,684 DEBUG: Using JAR Signature 1283s 2024-11-13 23:12:28,242 DEBUG: repo/com.politedroid_3.apk: Verifies 1283s Verified using v1 scheme (JAR signing): true 1283s Verified using v2 scheme (APK Signature Scheme v2): false 1283s Verified using v3 scheme (APK Signature Scheme v3): false 1283s Verified using v4 scheme (APK Signature Scheme v4): false 1283s Verified for SourceStamp: false 1283s Number of signers: 1 1283s 1283s 2024-11-13 23:12:28,256 DEBUG: Processing com.politedroid_4.apk 1283s 2024-11-13 23:12:28,263 DEBUG: Getting signature of com.politedroid_4.apk 1283s 2024-11-13 23:12:28,268 DEBUG: Using JAR Signature 1283s 2024-11-13 23:12:28,273 DEBUG: Using JAR Signature 1283s 2024-11-13 23:12:28,605 DEBUG: repo/com.politedroid_4.apk: Verifies 1283s Verified using v1 scheme (JAR signing): true 1283s Verified using v2 scheme (APK Signature Scheme v2): false 1283s Verified using v3 scheme (APK Signature Scheme v3): false 1283s Verified using v4 scheme (APK Signature Scheme v4): false 1283s Verified for SourceStamp: false 1283s Number of signers: 1 1283s 1283s 2024-11-13 23:12:28,610 DEBUG: Processing com.politedroid_5.apk 1283s 2024-11-13 23:12:28,616 DEBUG: Getting signature of com.politedroid_5.apk 1283s 2024-11-13 23:12:28,621 DEBUG: Using JAR Signature 1283s 2024-11-13 23:12:28,626 DEBUG: Using JAR Signature 1284s 2024-11-13 23:12:29,062 DEBUG: repo/com.politedroid_5.apk: Verifies 1284s Verified using v1 scheme (JAR signing): true 1284s Verified using v2 scheme (APK Signature Scheme v2): false 1284s Verified using v3 scheme (APK Signature Scheme v3): false 1284s Verified using v4 scheme (APK Signature Scheme v4): false 1284s Verified for SourceStamp: false 1284s Number of signers: 1 1284s 1284s 2024-11-13 23:12:29,064 DEBUG: Processing com.politedroid_6.apk 1284s 2024-11-13 23:12:29,069 DEBUG: Getting signature of com.politedroid_6.apk 1284s 2024-11-13 23:12:29,073 DEBUG: Using JAR Signature 1284s 2024-11-13 23:12:29,077 DEBUG: Using JAR Signature 1284s 2024-11-13 23:12:29,651 DEBUG: repo/com.politedroid_6.apk: Verifies 1284s Verified using v1 scheme (JAR signing): true 1284s Verified using v2 scheme (APK Signature Scheme v2): false 1284s Verified using v3 scheme (APK Signature Scheme v3): false 1284s Verified using v4 scheme (APK Signature Scheme v4): false 1284s Verified for SourceStamp: false 1284s Number of signers: 1 1284s 1284s 2024-11-13 23:12:29,655 DEBUG: Processing duplicate.permisssions_9999999.apk 1284s 2024-11-13 23:12:29,665 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 1284s 2024-11-13 23:12:29,671 DEBUG: Using APK Signature v2 1284s 2024-11-13 23:12:29,678 DEBUG: Using APK Signature v2 1284s 2024-11-13 23:12:29,681 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 1285s 2024-11-13 23:12:30,030 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 1285s Verified using v1 scheme (JAR signing): true 1285s Verified using v2 scheme (APK Signature Scheme v2): true 1285s Verified using v3 scheme (APK Signature Scheme v3): false 1285s Verified using v4 scheme (APK Signature Scheme v4): false 1285s Verified for SourceStamp: false 1285s Number of signers: 1 1285s 1285s 2024-11-13 23:12:30,032 DEBUG: Density 120 not available, resizing down from 160 1285s 2024-11-13 23:12:30,036 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 1285s 2024-11-13 23:12:30,044 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 1285s 2024-11-13 23:12:30,049 DEBUG: Using JAR Signature 1285s 2024-11-13 23:12:30,055 DEBUG: Using JAR Signature 1285s 2024-11-13 23:12:30,399 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 1285s Verified using v1 scheme (JAR signing): true 1285s Verified using v2 scheme (APK Signature Scheme v2): false 1285s Verified using v3 scheme (APK Signature Scheme v3): false 1285s Verified using v4 scheme (APK Signature Scheme v4): false 1285s Verified for SourceStamp: false 1285s Number of signers: 1 1285s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1285s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1285s 1285s 2024-11-13 23:12:30,400 DEBUG: Processing no.min.target.sdk_987.apk 1285s 2024-11-13 23:12:30,404 DEBUG: Getting signature of no.min.target.sdk_987.apk 1285s 2024-11-13 23:12:30,407 DEBUG: Using APK Signature v2 1285s 2024-11-13 23:12:30,411 DEBUG: Using APK Signature v2 1285s 2024-11-13 23:12:30,412 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 1285s 2024-11-13 23:12:30,800 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 1285s Verified using v1 scheme (JAR signing): true 1285s Verified using v2 scheme (APK Signature Scheme v2): true 1285s Verified using v3 scheme (APK Signature Scheme v3): false 1285s Verified using v4 scheme (APK Signature Scheme v4): false 1285s Verified for SourceStamp: false 1285s Number of signers: 1 1285s 1285s 2024-11-13 23:12:30,801 DEBUG: Density 120 not available, resizing down from 160 1285s 2024-11-13 23:12:30,803 DEBUG: Processing obb.main.oldversion_1444412523.apk 1285s 2024-11-13 23:12:30,808 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 1285s 2024-11-13 23:12:30,812 DEBUG: Using APK Signature v2 1285s 2024-11-13 23:12:30,817 DEBUG: Using APK Signature v2 1286s 2024-11-13 23:12:31,198 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 1286s Verified using v1 scheme (JAR signing): true 1286s Verified using v2 scheme (APK Signature Scheme v2): true 1286s Verified using v3 scheme (APK Signature Scheme v3): false 1286s Verified using v4 scheme (APK Signature Scheme v4): false 1286s Verified for SourceStamp: false 1286s Number of signers: 1 1286s 1286s 2024-11-13 23:12:31,199 DEBUG: Density 120 not available, resizing down from 160 1286s 2024-11-13 23:12:31,201 DEBUG: Processing obb.main.twoversions_1101613.apk 1286s 2024-11-13 23:12:31,206 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 1286s 2024-11-13 23:12:31,210 DEBUG: Using JAR Signature 1286s 2024-11-13 23:12:31,214 DEBUG: Using JAR Signature 1286s 2024-11-13 23:12:31,566 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 1286s Verified using v1 scheme (JAR signing): true 1286s Verified using v2 scheme (APK Signature Scheme v2): false 1286s Verified using v3 scheme (APK Signature Scheme v3): false 1286s Verified using v4 scheme (APK Signature Scheme v4): false 1286s Verified for SourceStamp: false 1286s Number of signers: 1 1286s 1286s 2024-11-13 23:12:31,567 DEBUG: Density 120 not available, resizing down from 160 1286s 2024-11-13 23:12:31,570 DEBUG: Processing obb.main.twoversions_1101615.apk 1286s 2024-11-13 23:12:31,574 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 1286s 2024-11-13 23:12:31,578 DEBUG: Using JAR Signature 1286s 2024-11-13 23:12:31,582 DEBUG: Using JAR Signature 1286s 2024-11-13 23:12:31,934 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 1286s Verified using v1 scheme (JAR signing): true 1286s Verified using v2 scheme (APK Signature Scheme v2): false 1286s Verified using v3 scheme (APK Signature Scheme v3): false 1286s Verified using v4 scheme (APK Signature Scheme v4): false 1286s Verified for SourceStamp: false 1286s Number of signers: 1 1286s 1286s 2024-11-13 23:12:31,935 DEBUG: Density 120 not available, resizing down from 160 1286s 2024-11-13 23:12:31,937 DEBUG: Processing obb.main.twoversions_1101617.apk 1286s 2024-11-13 23:12:31,942 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 1286s 2024-11-13 23:12:31,945 DEBUG: Using JAR Signature 1286s 2024-11-13 23:12:31,949 DEBUG: Using JAR Signature 1287s 2024-11-13 23:12:32,300 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 1287s Verified using v1 scheme (JAR signing): true 1287s Verified using v2 scheme (APK Signature Scheme v2): false 1287s Verified using v3 scheme (APK Signature Scheme v3): false 1287s Verified using v4 scheme (APK Signature Scheme v4): false 1287s Verified for SourceStamp: false 1287s Number of signers: 1 1287s 1287s 2024-11-13 23:12:32,301 DEBUG: Density 120 not available, resizing down from 160 1287s 2024-11-13 23:12:32,303 DEBUG: Processing obb.mainpatch.current_1619.apk 1287s 2024-11-13 23:12:32,308 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 1287s 2024-11-13 23:12:32,311 DEBUG: Using JAR Signature 1287s 2024-11-13 23:12:32,315 DEBUG: Using JAR Signature 1287s 2024-11-13 23:12:32,667 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 1287s Verified using v1 scheme (JAR signing): true 1287s Verified using v2 scheme (APK Signature Scheme v2): false 1287s Verified using v3 scheme (APK Signature Scheme v3): false 1287s Verified using v4 scheme (APK Signature Scheme v4): false 1287s Verified for SourceStamp: false 1287s Number of signers: 1 1287s 1287s 2024-11-13 23:12:32,668 DEBUG: Density 120 not available, resizing down from 160 1287s 2024-11-13 23:12:32,670 DEBUG: Processing obb.mainpatch.current_1619_another-release-key.apk 1287s 2024-11-13 23:12:32,675 DEBUG: Getting signature of obb.mainpatch.current_1619_another-release-key.apk 1287s 2024-11-13 23:12:32,678 DEBUG: Using JAR Signature 1287s 2024-11-13 23:12:32,682 DEBUG: Using JAR Signature 1288s 2024-11-13 23:12:33,030 DEBUG: repo/obb.mainpatch.current_1619_another-release-key.apk: Verifies 1288s Verified using v1 scheme (JAR signing): true 1288s Verified using v2 scheme (APK Signature Scheme v2): false 1288s Verified using v3 scheme (APK Signature Scheme v3): false 1288s Verified using v4 scheme (APK Signature Scheme v4): false 1288s Verified for SourceStamp: false 1288s Number of signers: 1 1288s 1288s 2024-11-13 23:12:33,030 DEBUG: Density 120 not available, resizing down from 160 1288s 2024-11-13 23:12:33,033 DEBUG: Processing souch.smsbypass_9.apk 1288s 2024-11-13 23:12:33,042 DEBUG: Getting signature of souch.smsbypass_9.apk 1288s 2024-11-13 23:12:33,046 DEBUG: Using JAR Signature 1288s 2024-11-13 23:12:33,049 DEBUG: Using JAR Signature 1288s 2024-11-13 23:12:33,423 DEBUG: repo/souch.smsbypass_9.apk: Verifies 1288s Verified using v1 scheme (JAR signing): true 1288s Verified using v2 scheme (APK Signature Scheme v2): false 1288s Verified using v3 scheme (APK Signature Scheme v3): false 1288s Verified using v4 scheme (APK Signature Scheme v4): false 1288s Verified for SourceStamp: false 1288s Number of signers: 1 1288s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1288s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 1288s 1288s 2024-11-13 23:12:33,424 DEBUG: Density 120 not available, resizing down from 160 1288s 2024-11-13 23:12:33,427 DEBUG: Processing urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1288s 2024-11-13 23:12:33,432 DEBUG: Getting signature of urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1288s 2024-11-13 23:12:33,436 DEBUG: Using JAR Signature 1288s 2024-11-13 23:12:33,440 DEBUG: Using JAR Signature 1288s 2024-11-13 23:12:33,776 DEBUG: repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk: Verifies 1288s Verified using v1 scheme (JAR signing): true 1288s Verified using v2 scheme (APK Signature Scheme v2): false 1288s Verified using v3 scheme (APK Signature Scheme v3): false 1288s Verified using v4 scheme (APK Signature Scheme v4): false 1288s Verified for SourceStamp: false 1288s Number of signers: 1 1288s 1288s 2024-11-13 23:12:33,777 DEBUG: Density 120 not available, resizing down from 160 1288s 2024-11-13 23:12:33,779 DEBUG: Processing v1.v2.sig_1020.apk 1288s 2024-11-13 23:12:33,784 DEBUG: Getting signature of v1.v2.sig_1020.apk 1288s 2024-11-13 23:12:33,787 DEBUG: Using APK Signature v2 1288s 2024-11-13 23:12:33,791 DEBUG: Using APK Signature v2 1289s 2024-11-13 23:12:34,181 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 1289s Verified using v1 scheme (JAR signing): true 1289s Verified using v2 scheme (APK Signature Scheme v2): true 1289s Verified using v3 scheme (APK Signature Scheme v3): false 1289s Verified using v4 scheme (APK Signature Scheme v4): false 1289s Verified for SourceStamp: false 1289s Number of signers: 1 1289s 1289s 2024-11-13 23:12:34,182 DEBUG: Density 120 not available, resizing down from 160 1289s 2024-11-13 23:12:34,184 DEBUG: Processing fake.ota.update_1234.zip 1289s 2024-11-13 23:12:34,184 DEBUG: skipping source tarball: repo/obb.main.twoversions_1101617_src.tar.gz 1289s 2024-11-13 23:12:34,185 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 1289s Use `fdroid update -c` to create it. 1289s 2024-11-13 23:12:34,185 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 1289s Use `fdroid update -c` to create it. 1289s 2024-11-13 23:12:34,188 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,188 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,188 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,188 DEBUG: app.with.special.build.params does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,188 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,188 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,188 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,189 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/featureGraphic.png repo/info.guardianproject.urzip/en-US 1289s 2024-11-13 23:12:34,280 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/icon.png repo/info.guardianproject.urzip/en-US 1289s 2024-11-13 23:12:34,281 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,281 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,281 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 1289s 2024-11-13 23:12:34,282 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 1289s 2024-11-13 23:12:34,282 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 1289s 2024-11-13 23:12:34,287 DEBUG: adding to phoneScreenshots: repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 1289s 2024-11-13 23:12:34,288 DEBUG: adding to sevenInchScreenshots: repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 1289s 2024-11-13 23:12:34,289 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,290 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 1289s 2024-11-13 23:12:34,291 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 1289s 1289s Warning: 1289s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 1290s 2024-11-13 23:12:34,999 INFO: Creating signed index with this key (SHA256): 1290s 2024-11-13 23:12:34,999 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 1290s 2024-11-13 23:12:34,999 DEBUG: Directory: repo 1290s 2024-11-13 23:12:34,999 DEBUG: > jar cf index.jar index.xml 1290s 2024-11-13 23:12:35,301 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 1291s jar signed. 1291s 1291s Warning: 1291s The signer's certificate is self-signed. 1291s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1291s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1291s 2024-11-13 23:12:36,204 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1291s 2024-11-13 23:12:36,212 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 1291s 2024-11-13 23:12:36,212 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 1291s 2024-11-13 23:12:36,215 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 1292s jar signed. 1292s 1292s Warning: 1292s The signer's certificate is self-signed. 1292s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1292s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1292s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1292s 2024-11-13 23:12:37,321 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 1292s 2024-11-13 23:12:37,323 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 1292s 2024-11-13 23:12:37,328 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 1292s 2024-11-13 23:12:37,930 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 1293s 1293s Warning: 1293s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks -deststoretype pkcs12". 1293s 2024-11-13 23:12:38,549 INFO: Committing indexes to binary_transparency 1293s 2024-11-13 23:12:38,549 DEBUG: Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/binary_transparency, universal_newlines=False, shell=None, istream=None) 1293s 2024-11-13 23:12:38,557 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/binary_transparency, universal_newlines=False, shell=None, istream=) 1293s 2024-11-13 23:12:38,560 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/binary_transparency, universal_newlines=False, shell=None, istream=) 1293s 2024-11-13 23:12:38,592 DEBUG: Outputting JSON 1293s 2024-11-13 23:12:38,592 DEBUG: skip deploying full build logs: not enabled in config 1293s 2024-11-13 23:12:38,593 DEBUG: skip deploying full build logs: not enabled in config 1293s 2024-11-13 23:12:38,594 DEBUG: skip deploying full build logs: not enabled in config 1293s 2024-11-13 23:12:38,594 INFO: Finished 1293s + /usr/bin/fdroid deploy --verbose 1294s 2024-11-13 23:12:39,155 DEBUG: Reading 'config.yml' 1294s 2024-11-13 23:12:39,170 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1294s 2024-11-13 23:12:39,170 INFO: Pushing binary transparency log to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.gnRI 1294s 2024-11-13 23:12:39,170 DEBUG: Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.gnRI, universal_newlines=False, shell=None, istream=None) 1294s 2024-11-13 23:12:39,176 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/binary_transparency'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.gnRI, universal_newlines=False, shell=None, istream=None) 1294s 2024-11-13 23:12:39,179 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.gnRI, universal_newlines=True, shell=None, istream=None) 1294s 2024-11-13 23:12:39,214 DEBUG: Fetch head lines do not match lines provided via progress information 1294s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 1294s Will ignore extra progress lines or fetch head lines. 1294s 2024-11-13 23:12:39,214 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' * [new branch] master -> local/master']" 1294s 2024-11-13 23:12:39,214 DEBUG: b'head info: ["25a7040a505d0be25ef50ca9e5df52b7762eb3c0\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.4MxO/binary_transparency\\n"]' 1294s 2024-11-13 23:12:39,214 DEBUG: skip deploying full build logs: not enabled in config 1294s 2024-11-13 23:12:39,215 DEBUG: skip deploying full build logs: not enabled in config 1294s 2024-11-13 23:12:39,215 DEBUG: skip deploying full build logs: not enabled in config 1294s + test -e repo/index.xml 1294s + test -e repo/index.jar 1294s + test -e repo/index-v1.jar 1294s + grep -F ' /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 1296s 1296s Warning: 1296s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -deststoretype pkcs12". 1296s 2024-11-13 23:12:41,379 INFO: Creating signed index with this key (SHA256): 1296s 2024-11-13 23:12:41,379 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 1296s 2024-11-13 23:12:41,379 DEBUG: Directory: repo 1296s 2024-11-13 23:12:41,379 DEBUG: > jar cf index.jar index.xml 1296s 2024-11-13 23:12:41,581 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 1297s jar signed. 1297s 1297s Warning: 1297s The signer's certificate is self-signed. 1297s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1297s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1297s 2024-11-13 23:12:42,784 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1297s 2024-11-13 23:12:42,792 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 1298s jar signed. 1298s 1298s Warning: 1298s The signer's certificate is self-signed. 1298s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 1298s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 1298s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 1298s 2024-11-13 23:12:43,699 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 1299s 2024-11-13 23:12:44,303 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 1299s 1299s Warning: 1299s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -destkeystore /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.1XtW/keystore.jks -deststoretype pkcs12". 1300s 2024-11-13 23:12:45,021 DEBUG: Outputting JSON 1300s 2024-11-13 23:12:45,021 DEBUG: skip deploying full build logs: not enabled in config 1300s 2024-11-13 23:12:45,021 DEBUG: skip deploying full build logs: not enabled in config 1300s 2024-11-13 23:12:45,022 DEBUG: skip deploying full build logs: not enabled in config 1300s 2024-11-13 23:12:45,022 INFO: Finished 1300s + /usr/bin/fdroid readmeta 1300s + test -e repo/index.xml 1300s + test -e repo/index.jar 1300s + test -e repo/index-v1.jar 1300s + test -e tmp/apkcache.json 1300s + test -z tmp/apkcache.json 1300s + grep -F '' repo/index.xml 1377s http://foo.bar/fdroid/repo 1377s http://asdflkdsfjafdsdfhkjh.onion/fdroid/repo 1377s + grep -F '/fdroid/archive' archive/index.xml 1377s http://foo.bar/fdroid/archive 1377s http://asdflkdsfjafdsdfhkjh.onion/fdroid/archive 1377s ++ grep '' repo/index.xml 1377s ++ wc -l 1377s + test 2 -eq 2 1377s ++ grep '' archive/index.xml 1377s ++ wc -l 1377s + test 2 -eq 2 1377s + cd binary_transparency 1377s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD 1377s + '[' 1 == 1 ']' 1377s + cd .. 1377s + /usr/bin/fdroid deploy --verbose 1378s 2024-11-13 23:14:03,270 DEBUG: Reading 'config.yml' 1378s 2024-11-13 23:14:03,287 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1378s 2024-11-13 23:14:03,287 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/ 1378s sending incremental file list 1378s repo/ 1378s repo/com.example.test.helloworld_1.apk 1378s repo/com.politedroid_3.apk 1378s repo/com.politedroid_4.apk 1378s repo/com.politedroid_5.apk 1378s repo/com.politedroid_6.apk 1378s repo/duplicate.permisssions_9999999.apk 1378s repo/entry.jar 1378s repo/entry.json 1378s repo/fake.ota.update_1234.zip 1378s repo/index-v1.jar 1378s repo/index-v1.json 1378s repo/index-v2.json 1378s repo/index.css 1378s repo/index.html 1378s repo/index.jar 1378s repo/index.png 1378s repo/index.xml 1378s repo/info.zwanenburg.caffeinetile_4.apk 1378s repo/main.1101613.obb.main.twoversions.obb 1378s repo/main.1101615.obb.main.twoversions.obb 1378s repo/main.1434483388.obb.main.oldversion.obb 1378s repo/main.1619.obb.mainpatch.current.obb 1378s repo/no.min.target.sdk_987.apk 1378s repo/obb.main.oldversion_1444412523.apk 1378s repo/obb.main.twoversions_1101613.apk 1378s repo/obb.main.twoversions_1101615.apk 1378s repo/obb.main.twoversions_1101617.apk 1378s repo/obb.main.twoversions_1101617_src.tar.gz 1378s repo/obb.mainpatch.current_1619.apk 1378s repo/obb.mainpatch.current_1619_another-release-key.apk 1378s repo/patch.1619.obb.mainpatch.current.obb 1378s repo/souch.smsbypass_9.apk 1378s repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1378s repo/v1.v2.sig_1020.apk 1378s repo/icons-120/ 1378s repo/icons-120/com.politedroid.3.png 1378s repo/icons-120/com.politedroid.4.png 1378s repo/icons-120/com.politedroid.5.png 1378s repo/icons-120/com.politedroid.6.png 1378s repo/icons-120/duplicate.permisssions.9999999.png 1378s repo/icons-120/info.guardianproject.urzip.100.png 1378s repo/icons-120/no.min.target.sdk.987.png 1378s repo/icons-120/obb.main.oldversion.1444412523.png 1378s repo/icons-120/obb.main.twoversions.1101613.png 1378s repo/icons-120/obb.main.twoversions.1101615.png 1378s repo/icons-120/obb.main.twoversions.1101617.png 1378s repo/icons-120/obb.mainpatch.current.1619.png 1378s repo/icons-120/souch.smsbypass.9.png 1378s repo/icons-120/v1.v2.sig.1020.png 1378s repo/icons-160/ 1378s repo/icons-160/com.politedroid.3.png 1378s repo/icons-160/com.politedroid.4.png 1378s repo/icons-160/com.politedroid.5.png 1378s repo/icons-160/com.politedroid.6.png 1378s repo/icons-160/duplicate.permisssions.9999999.png 1378s repo/icons-160/info.guardianproject.urzip.100.png 1378s repo/icons-160/no.min.target.sdk.987.png 1378s repo/icons-160/obb.main.oldversion.1444412523.png 1378s repo/icons-160/obb.main.twoversions.1101613.png 1378s repo/icons-160/obb.main.twoversions.1101615.png 1378s repo/icons-160/obb.main.twoversions.1101617.png 1378s repo/icons-160/obb.mainpatch.current.1619.png 1378s repo/icons-160/souch.smsbypass.9.png 1378s repo/icons-160/v1.v2.sig.1020.png 1378s repo/icons-240/ 1378s repo/icons-240/com.politedroid.3.png 1378s repo/icons-240/com.politedroid.4.png 1378s repo/icons-240/com.politedroid.5.png 1378s repo/icons-240/com.politedroid.6.png 1378s repo/icons-240/duplicate.permisssions.9999999.png 1378s repo/icons-240/info.guardianproject.urzip.100.png 1378s repo/icons-240/no.min.target.sdk.987.png 1378s repo/icons-240/obb.main.oldversion.1444412523.png 1378s repo/icons-240/obb.main.twoversions.1101613.png 1378s repo/icons-240/obb.main.twoversions.1101615.png 1378s repo/icons-240/obb.main.twoversions.1101617.png 1378s repo/icons-240/obb.mainpatch.current.1619.png 1378s repo/icons-240/souch.smsbypass.9.png 1378s repo/icons-240/v1.v2.sig.1020.png 1378s repo/icons-320/ 1378s repo/icons-320/com.politedroid.3.png 1378s repo/icons-320/com.politedroid.4.png 1378s repo/icons-320/com.politedroid.5.png 1378s repo/icons-320/com.politedroid.6.png 1378s repo/icons-320/duplicate.permisssions.9999999.png 1378s repo/icons-320/info.guardianproject.urzip.100.png 1378s repo/icons-320/no.min.target.sdk.987.png 1378s repo/icons-320/obb.main.oldversion.1444412523.png 1378s repo/icons-320/obb.main.twoversions.1101613.png 1378s repo/icons-320/obb.main.twoversions.1101615.png 1378s repo/icons-320/obb.main.twoversions.1101617.png 1378s repo/icons-320/obb.mainpatch.current.1619.png 1378s repo/icons-320/souch.smsbypass.9.png 1378s repo/icons-320/v1.v2.sig.1020.png 1378s repo/icons-480/ 1378s repo/icons-480/com.politedroid.3.png 1378s repo/icons-480/com.politedroid.4.png 1378s repo/icons-480/com.politedroid.5.png 1378s repo/icons-480/com.politedroid.6.png 1378s repo/icons-480/duplicate.permisssions.9999999.png 1378s repo/icons-480/info.guardianproject.urzip.100.png 1378s repo/icons-480/no.min.target.sdk.987.png 1378s repo/icons-480/obb.main.oldversion.1444412523.png 1378s repo/icons-480/obb.main.twoversions.1101613.png 1378s repo/icons-480/obb.main.twoversions.1101615.png 1378s repo/icons-480/obb.main.twoversions.1101617.png 1378s repo/icons-480/obb.mainpatch.current.1619.png 1378s repo/icons-480/souch.smsbypass.9.png 1378s repo/icons-480/v1.v2.sig.1020.png 1378s repo/icons-640/ 1378s repo/icons-640/com.politedroid.3.png 1378s repo/icons-640/com.politedroid.4.png 1378s repo/icons-640/com.politedroid.5.png 1378s repo/icons-640/com.politedroid.6.png 1378s repo/icons-640/duplicate.permisssions.9999999.png 1378s repo/icons-640/info.guardianproject.urzip.100.png 1378s repo/icons-640/no.min.target.sdk.987.png 1378s repo/icons-640/obb.main.oldversion.1444412523.png 1378s repo/icons-640/obb.main.twoversions.1101613.png 1378s repo/icons-640/obb.main.twoversions.1101615.png 1378s repo/icons-640/obb.main.twoversions.1101617.png 1378s repo/icons-640/obb.mainpatch.current.1619.png 1378s repo/icons-640/souch.smsbypass.9.png 1378s repo/icons-640/v1.v2.sig.1020.png 1378s repo/icons/ 1378s repo/icons/com.politedroid.3.png 1378s repo/icons/com.politedroid.4.png 1378s repo/icons/com.politedroid.5.png 1378s repo/icons/com.politedroid.6.png 1378s repo/icons/duplicate.permisssions.9999999.png 1378s repo/icons/ic_antifeature_ads.xml 1378s repo/icons/ic_antifeature_disabledalgorithm.xml 1378s repo/icons/ic_antifeature_knownvuln.xml 1378s repo/icons/ic_antifeature_nonfreeadd.xml 1378s repo/icons/ic_antifeature_nonfreeassets.xml 1378s repo/icons/ic_antifeature_nonfreedep.xml 1378s repo/icons/ic_antifeature_nonfreenet.xml 1378s repo/icons/ic_antifeature_nosourcesince.xml 1378s repo/icons/ic_antifeature_nsfw.xml 1378s repo/icons/ic_antifeature_tracking.xml 1378s repo/icons/ic_antifeature_upstreamnonfree.xml 1378s repo/icons/icon.png 1378s repo/icons/info.guardianproject.urzip.100.png 1378s repo/icons/no.min.target.sdk.987.png 1378s repo/icons/obb.main.oldversion.1444412523.png 1378s repo/icons/obb.main.twoversions.1101613.png 1378s repo/icons/obb.main.twoversions.1101615.png 1378s repo/icons/obb.main.twoversions.1101617.png 1378s repo/icons/obb.mainpatch.current.1619.png 1378s repo/icons/souch.smsbypass.9.png 1378s repo/icons/v1.v2.sig.1020.png 1378s repo/info.guardianproject.checkey/ 1378s repo/info.guardianproject.checkey/en-US/ 1378s repo/info.guardianproject.checkey/en-US/phoneScreenshots/ 1378s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png 1378s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png 1378s repo/info.guardianproject.urzip/ 1378s repo/info.guardianproject.urzip/en-US/ 1378s repo/info.guardianproject.urzip/en-US/featureGraphic.png 1378s repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png 1378s repo/info.guardianproject.urzip/en-US/icon.png 1378s repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png 1378s repo/obb.mainpatch.current/ 1378s repo/obb.mainpatch.current/en-US/ 1378s repo/obb.mainpatch.current/en-US/featureGraphic.png 1378s repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png 1378s repo/obb.mainpatch.current/en-US/icon.png 1378s repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png 1378s repo/obb.mainpatch.current/en-US/phoneScreenshots/ 1378s repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 1378s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/ 1378s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 1378s repo/org.fake/ 1378s repo/org.fake/de-DE/ 1378s repo/org.fake/de-DE/tenInchScreenshots/ 1378s repo/org.fake/en-US/ 1378s repo/org.fake/en-US/phoneScreenshots/ 1378s repo/org.fake/en-US/tenInchScreenshots/ 1378s repo/org.videolan.vlc/ 1378s repo/org.videolan.vlc/en-US/ 1378s repo/org.videolan.vlc/en-US/icon.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/ 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png 1378s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/ 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png 1378s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png 1378s repo/status/ 1378s repo/status/running.json 1378s repo/status/update.json 1378s 1378s sent 3,731,893 bytes received 3,661 bytes 7,471,108.00 bytes/sec 1378s total size is 3,713,929 speedup is 0.99 1378s 2024-11-13 23:14:03,387 INFO: Pushing binary transparency log to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency 1378s 2024-11-13 23:14:03,387 DEBUG: Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 1378s 2024-11-13 23:14:03,393 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.T9B1/binary_transparency'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 1378s 2024-11-13 23:14:03,396 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None) 1378s 2024-11-13 23:14:03,433 DEBUG: Fetch head lines do not match lines provided via progress information 1378s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 1378s Will ignore extra progress lines or fetch head lines. 1378s 2024-11-13 23:14:03,433 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' * [new branch] master -> local/master']" 1378s 2024-11-13 23:14:03,433 DEBUG: b'head info: ["3ec447869cb1d2f3fda36a510815a698a007ca0a\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.T9B1/binary_transparency\\n"]' 1378s 2024-11-13 23:14:03,438 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy` 1378s 2024-11-13 23:14:03,438 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose archive /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/ 1378s sending incremental file list 1378s archive/ 1378s archive/entry.jar 1378s archive/entry.json 1378s archive/index-v1.jar 1378s archive/index-v1.json 1378s archive/index-v2.json 1378s archive/index.css 1378s archive/index.html 1378s archive/index.jar 1378s archive/index.png 1378s archive/index.xml 1378s archive/icons-120/ 1378s archive/icons-160/ 1378s archive/icons-240/ 1378s archive/icons-320/ 1378s archive/icons-480/ 1378s archive/icons-640/ 1378s archive/icons/ 1378s archive/icons/icon.png 1378s 2024-11-13 23:14:03,491 INFO: Pushing binary transparency log to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency 1378s 2024-11-13 23:14:03,492 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.T9B1/binary_transparency'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 1378s 2024-11-13 23:14:03,495 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None) 1378s 1378s sent 25,231 bytes received 261 bytes 50,984.00 bytes/sec 1378s total size is 24,125 speedup is 0.95 1378s 2024-11-13 23:14:03,515 DEBUG: Fetch head lines do not match lines provided via progress information 1378s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 1378s Will ignore extra progress lines or fetch head lines. 1378s 2024-11-13 23:14:03,515 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' = [up to date] master -> local/master']" 1378s 2024-11-13 23:14:03,515 DEBUG: b'head info: ["3ec447869cb1d2f3fda36a510815a698a007ca0a\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.T9B1/binary_transparency\\n"]' 1378s 2024-11-13 23:14:03,515 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy` 1378s 2024-11-13 23:14:03,515 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose unsigned /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/ 1378s sending incremental file list 1378s unsigned/ 1378s unsigned/urzip-release-unsigned.apk 1378s 1378s sent 8,635 bytes received 39 bytes 17,348.00 bytes/sec 1378s total size is 8,471 speedup is 0.98 1378s 2024-11-13 23:14:03,565 INFO: Pushing binary transparency log to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency 1378s 2024-11-13 23:14:03,566 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.T9B1/binary_transparency'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 1378s 2024-11-13 23:14:03,568 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None) 1378s 2024-11-13 23:14:03,587 DEBUG: Fetch head lines do not match lines provided via progress information 1378s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 1378s Will ignore extra progress lines or fetch head lines. 1378s 2024-11-13 23:14:03,588 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' = [up to date] master -> local/master']" 1378s 2024-11-13 23:14:03,588 DEBUG: b'head info: ["3ec447869cb1d2f3fda36a510815a698a007ca0a\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.T9B1/binary_transparency\\n"]' 1378s 2024-11-13 23:14:03,588 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy` 1378s 2024-11-13 23:14:03,588 DEBUG: skip deploying full build logs: not enabled in config 1378s 2024-11-13 23:14:03,588 DEBUG: skip deploying full build logs: not enabled in config 1378s 2024-11-13 23:14:03,589 DEBUG: skip deploying full build logs: not enabled in config 1378s + test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/unsigned/urzip-release-unsigned.apk 1378s + grep -F ' FETCH_HEAD', ' * [new branch] master -> local/master']" 1379s 2024-11-13 23:14:04,299 DEBUG: b'head info: ["3ec447869cb1d2f3fda36a510815a698a007ca0a\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency\\n"]' 1379s 2024-11-13 23:14:04,303 INFO: rsyncing repo to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.oWmR/fdroid/ 1379s building file list ... done 1379s created directory /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.oWmR/fdroid 1379s repo/ 1379s repo/com.example.test.helloworld_1.apk 1379s repo/com.politedroid_3.apk 1379s repo/com.politedroid_4.apk 1379s repo/com.politedroid_5.apk 1379s repo/com.politedroid_6.apk 1379s repo/duplicate.permisssions_9999999.apk 1379s repo/fake.ota.update_1234.zip 1379s repo/info.zwanenburg.caffeinetile_4.apk 1379s repo/main.1101613.obb.main.twoversions.obb 1379s repo/main.1101615.obb.main.twoversions.obb 1379s repo/main.1434483388.obb.main.oldversion.obb 1379s repo/main.1619.obb.mainpatch.current.obb 1379s repo/no.min.target.sdk_987.apk 1379s repo/obb.main.oldversion_1444412523.apk 1379s repo/obb.main.twoversions_1101613.apk 1379s repo/obb.main.twoversions_1101615.apk 1379s repo/obb.main.twoversions_1101617.apk 1379s repo/obb.main.twoversions_1101617_src.tar.gz 1379s repo/obb.mainpatch.current_1619.apk 1379s repo/obb.mainpatch.current_1619_another-release-key.apk 1379s repo/patch.1619.obb.mainpatch.current.obb 1379s repo/souch.smsbypass_9.apk 1379s repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1379s repo/v1.v2.sig_1020.apk 1379s repo/icons-120/ 1379s repo/icons-120/com.politedroid.3.png 1379s repo/icons-120/com.politedroid.4.png 1379s repo/icons-120/com.politedroid.5.png 1379s repo/icons-120/com.politedroid.6.png 1379s repo/icons-120/duplicate.permisssions.9999999.png 1379s repo/icons-120/info.guardianproject.urzip.100.png 1379s repo/icons-120/no.min.target.sdk.987.png 1379s repo/icons-120/obb.main.oldversion.1444412523.png 1379s repo/icons-120/obb.main.twoversions.1101613.png 1379s repo/icons-120/obb.main.twoversions.1101615.png 1379s repo/icons-120/obb.main.twoversions.1101617.png 1379s repo/icons-120/obb.mainpatch.current.1619.png 1379s repo/icons-120/souch.smsbypass.9.png 1379s repo/icons-120/v1.v2.sig.1020.png 1379s repo/icons-160/ 1379s repo/icons-160/com.politedroid.3.png 1379s repo/icons-160/com.politedroid.4.png 1379s repo/icons-160/com.politedroid.5.png 1379s repo/icons-160/com.politedroid.6.png 1379s repo/icons-160/duplicate.permisssions.9999999.png 1379s repo/icons-160/info.guardianproject.urzip.100.png 1379s repo/icons-160/no.min.target.sdk.987.png 1379s repo/icons-160/obb.main.oldversion.1444412523.png 1379s repo/icons-160/obb.main.twoversions.1101613.png 1379s repo/icons-160/obb.main.twoversions.1101615.png 1379s repo/icons-160/obb.main.twoversions.1101617.png 1379s repo/icons-160/obb.mainpatch.current.1619.png 1379s repo/icons-160/souch.smsbypass.9.png 1379s repo/icons-160/v1.v2.sig.1020.png 1379s repo/icons-240/ 1379s repo/icons-240/com.politedroid.3.png 1379s repo/icons-240/com.politedroid.4.png 1379s repo/icons-240/com.politedroid.5.png 1379s repo/icons-240/com.politedroid.6.png 1379s repo/icons-240/duplicate.permisssions.9999999.png 1379s repo/icons-240/info.guardianproject.urzip.100.png 1379s repo/icons-240/no.min.target.sdk.987.png 1379s repo/icons-240/obb.main.oldversion.1444412523.png 1379s repo/icons-240/obb.main.twoversions.1101613.png 1379s repo/icons-240/obb.main.twoversions.1101615.png 1379s repo/icons-240/obb.main.twoversions.1101617.png 1379s repo/icons-240/obb.mainpatch.current.1619.png 1379s repo/icons-240/souch.smsbypass.9.png 1379s repo/icons-240/v1.v2.sig.1020.png 1379s repo/icons-320/ 1379s repo/icons-320/com.politedroid.3.png 1379s repo/icons-320/com.politedroid.4.png 1379s repo/icons-320/com.politedroid.5.png 1379s repo/icons-320/com.politedroid.6.png 1379s repo/icons-320/duplicate.permisssions.9999999.png 1379s repo/icons-320/info.guardianproject.urzip.100.png 1379s repo/icons-320/no.min.target.sdk.987.png 1379s repo/icons-320/obb.main.oldversion.1444412523.png 1379s repo/icons-320/obb.main.twoversions.1101613.png 1379s repo/icons-320/obb.main.twoversions.1101615.png 1379s repo/icons-320/obb.main.twoversions.1101617.png 1379s repo/icons-320/obb.mainpatch.current.1619.png 1379s repo/icons-320/souch.smsbypass.9.png 1379s repo/icons-320/v1.v2.sig.1020.png 1379s repo/icons-480/ 1379s repo/icons-480/com.politedroid.3.png 1379s repo/icons-480/com.politedroid.4.png 1379s repo/icons-480/com.politedroid.5.png 1379s repo/icons-480/com.politedroid.6.png 1379s repo/icons-480/duplicate.permisssions.9999999.png 1379s repo/icons-480/info.guardianproject.urzip.100.png 1379s repo/icons-480/no.min.target.sdk.987.png 1379s repo/icons-480/obb.main.oldversion.1444412523.png 1379s repo/icons-480/obb.main.twoversions.1101613.png 1379s repo/icons-480/obb.main.twoversions.1101615.png 1379s repo/icons-480/obb.main.twoversions.1101617.png 1379s repo/icons-480/obb.mainpatch.current.1619.png 1379s repo/icons-480/souch.smsbypass.9.png 1379s repo/icons-480/v1.v2.sig.1020.png 1379s repo/icons-640/ 1379s repo/icons-640/com.politedroid.3.png 1379s repo/icons-640/com.politedroid.4.png 1379s repo/icons-640/com.politedroid.5.png 1379s repo/icons-640/com.politedroid.6.png 1379s repo/icons-640/duplicate.permisssions.9999999.png 1379s repo/icons-640/info.guardianproject.urzip.100.png 1379s repo/icons-640/no.min.target.sdk.987.png 1379s repo/icons-640/obb.main.oldversion.1444412523.png 1379s repo/icons-640/obb.main.twoversions.1101613.png 1379s repo/icons-640/obb.main.twoversions.1101615.png 1379s repo/icons-640/obb.main.twoversions.1101617.png 1379s repo/icons-640/obb.mainpatch.current.1619.png 1379s repo/icons-640/souch.smsbypass.9.png 1379s repo/icons-640/v1.v2.sig.1020.png 1379s repo/icons/ 1379s repo/icons/com.politedroid.3.png 1379s repo/icons/com.politedroid.4.png 1379s repo/icons/com.politedroid.5.png 1379s repo/icons/com.politedroid.6.png 1379s repo/icons/duplicate.permisssions.9999999.png 1379s repo/icons/ic_antifeature_ads.xml 1379s repo/icons/ic_antifeature_disabledalgorithm.xml 1379s repo/icons/ic_antifeature_knownvuln.xml 1379s repo/icons/ic_antifeature_nonfreeadd.xml 1379s repo/icons/ic_antifeature_nonfreeassets.xml 1379s repo/icons/ic_antifeature_nonfreedep.xml 1379s repo/icons/ic_antifeature_nonfreenet.xml 1379s repo/icons/ic_antifeature_nosourcesince.xml 1379s repo/icons/ic_antifeature_nsfw.xml 1379s repo/icons/ic_antifeature_tracking.xml 1379s repo/icons/ic_antifeature_upstreamnonfree.xml 1379s repo/icons/icon.png 1379s repo/icons/info.guardianproject.urzip.100.png 1379s repo/icons/no.min.target.sdk.987.png 1379s repo/icons/obb.main.oldversion.1444412523.png 1379s repo/icons/obb.main.twoversions.1101613.png 1379s repo/icons/obb.main.twoversions.1101615.png 1379s repo/icons/obb.main.twoversions.1101617.png 1379s repo/icons/obb.mainpatch.current.1619.png 1379s repo/icons/souch.smsbypass.9.png 1379s repo/icons/v1.v2.sig.1020.png 1379s repo/info.guardianproject.checkey/ 1379s repo/info.guardianproject.checkey/en-US/ 1379s repo/info.guardianproject.checkey/en-US/phoneScreenshots/ 1379s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png 1379s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png 1379s repo/info.guardianproject.urzip/ 1379s repo/info.guardianproject.urzip/en-US/ 1379s repo/info.guardianproject.urzip/en-US/featureGraphic.png 1379s repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png 1379s repo/info.guardianproject.urzip/en-US/icon.png 1379s repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png 1379s repo/obb.mainpatch.current/ 1379s repo/obb.mainpatch.current/en-US/ 1379s repo/obb.mainpatch.current/en-US/featureGraphic.png 1379s repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png 1379s repo/obb.mainpatch.current/en-US/icon.png 1379s repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png 1379s repo/obb.mainpatch.current/en-US/phoneScreenshots/ 1379s repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 1379s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/ 1379s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 1379s repo/org.fake/ 1379s repo/org.fake/de-DE/ 1379s repo/org.fake/de-DE/tenInchScreenshots/ 1379s repo/org.fake/en-US/ 1379s repo/org.fake/en-US/phoneScreenshots/ 1379s repo/org.fake/en-US/tenInchScreenshots/ 1379s repo/org.videolan.vlc/ 1379s repo/org.videolan.vlc/en-US/ 1379s repo/org.videolan.vlc/en-US/icon.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/ 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png 1379s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/ 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png 1379s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png 1379s repo/status/ 1379s repo/status/running.json 1379s repo/status/update.json 1379s 1379s sent 3,622,172 bytes received 3,483 bytes 7,251,310.00 bytes/sec 1379s total size is 3,605,221 speedup is 0.99 1379s building file list ... done 1379s repo/entry.jar 1379s repo/entry.json 1379s repo/index-v1.jar 1379s repo/index-v1.json 1379s repo/index-v2.json 1379s repo/index.css 1379s repo/index.html 1379s repo/index.jar 1379s repo/index.png 1379s repo/index.xml 1379s 1379s sent 118,261 bytes received 205 bytes 236,932.00 bytes/sec 1379s total size is 3,713,929 speedup is 31.35 1379s 2024-11-13 23:14:04,445 DEBUG: Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=None) 1379s 2024-11-13 23:14:04,449 DEBUG: Popen(['git', 'switch', '--orphan', 'full'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=None) 1379s 2024-11-13 23:14:04,451 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/repo/ /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror/fdroid/repo/ 1379s sending incremental file list 1379s ./ 1379s com.example.test.helloworld_1.apk 1379s com.politedroid_3.apk 1379s com.politedroid_4.apk 1379s com.politedroid_5.apk 1379s com.politedroid_6.apk 1379s duplicate.permisssions_9999999.apk 1379s entry.jar 1379s entry.json 1379s fake.ota.update_1234.zip 1379s index-v1.jar 1379s index-v1.json 1379s index-v2.json 1379s index.css 1379s index.html 1379s index.jar 1379s index.png 1379s index.xml 1379s info.zwanenburg.caffeinetile_4.apk 1379s main.1101613.obb.main.twoversions.obb 1379s main.1101615.obb.main.twoversions.obb 1379s main.1434483388.obb.main.oldversion.obb 1379s main.1619.obb.mainpatch.current.obb 1379s no.min.target.sdk_987.apk 1379s obb.main.oldversion_1444412523.apk 1379s obb.main.twoversions_1101613.apk 1379s obb.main.twoversions_1101615.apk 1379s obb.main.twoversions_1101617.apk 1379s obb.main.twoversions_1101617_src.tar.gz 1379s obb.mainpatch.current_1619.apk 1379s obb.mainpatch.current_1619_another-release-key.apk 1379s patch.1619.obb.mainpatch.current.obb 1379s souch.smsbypass_9.apk 1379s urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 1379s v1.v2.sig_1020.apk 1379s icons-120/ 1379s icons-120/com.politedroid.3.png 1379s icons-120/com.politedroid.4.png 1379s icons-120/com.politedroid.5.png 1379s icons-120/com.politedroid.6.png 1379s icons-120/duplicate.permisssions.9999999.png 1379s icons-120/info.guardianproject.urzip.100.png 1379s icons-120/no.min.target.sdk.987.png 1379s icons-120/obb.main.oldversion.1444412523.png 1379s icons-120/obb.main.twoversions.1101613.png 1379s icons-120/obb.main.twoversions.1101615.png 1379s icons-120/obb.main.twoversions.1101617.png 1379s icons-120/obb.mainpatch.current.1619.png 1379s icons-120/souch.smsbypass.9.png 1379s icons-120/v1.v2.sig.1020.png 1379s icons-160/ 1379s icons-160/com.politedroid.3.png 1379s icons-160/com.politedroid.4.png 1379s icons-160/com.politedroid.5.png 1379s icons-160/com.politedroid.6.png 1379s icons-160/duplicate.permisssions.9999999.png 1379s icons-160/info.guardianproject.urzip.100.png 1379s icons-160/no.min.target.sdk.987.png 1379s icons-160/obb.main.oldversion.1444412523.png 1379s icons-160/obb.main.twoversions.1101613.png 1379s icons-160/obb.main.twoversions.1101615.png 1379s icons-160/obb.main.twoversions.1101617.png 1379s icons-160/obb.mainpatch.current.1619.png 1379s icons-160/souch.smsbypass.9.png 1379s icons-160/v1.v2.sig.1020.png 1379s icons-240/ 1379s icons-240/com.politedroid.3.png 1379s icons-240/com.politedroid.4.png 1379s icons-240/com.politedroid.5.png 1379s icons-240/com.politedroid.6.png 1379s icons-240/duplicate.permisssions.9999999.png 1379s icons-240/info.guardianproject.urzip.100.png 1379s icons-240/no.min.target.sdk.987.png 1379s icons-240/obb.main.oldversion.1444412523.png 1379s icons-240/obb.main.twoversions.1101613.png 1379s icons-240/obb.main.twoversions.1101615.png 1379s icons-240/obb.main.twoversions.1101617.png 1379s icons-240/obb.mainpatch.current.1619.png 1379s icons-240/souch.smsbypass.9.png 1379s icons-240/v1.v2.sig.1020.png 1379s icons-320/ 1379s icons-320/com.politedroid.3.png 1379s icons-320/com.politedroid.4.png 1379s icons-320/com.politedroid.5.png 1379s icons-320/com.politedroid.6.png 1379s icons-320/duplicate.permisssions.9999999.png 1379s icons-320/info.guardianproject.urzip.100.png 1379s icons-320/no.min.target.sdk.987.png 1379s icons-320/obb.main.oldversion.1444412523.png 1379s icons-320/obb.main.twoversions.1101613.png 1379s icons-320/obb.main.twoversions.1101615.png 1379s icons-320/obb.main.twoversions.1101617.png 1379s icons-320/obb.mainpatch.current.1619.png 1379s icons-320/souch.smsbypass.9.png 1379s icons-320/v1.v2.sig.1020.png 1379s icons-480/ 1379s icons-480/com.politedroid.3.png 1379s icons-480/com.politedroid.4.png 1379s icons-480/com.politedroid.5.png 1379s icons-480/com.politedroid.6.png 1379s icons-480/duplicate.permisssions.9999999.png 1379s icons-480/info.guardianproject.urzip.100.png 1379s icons-480/no.min.target.sdk.987.png 1379s icons-480/obb.main.oldversion.1444412523.png 1379s icons-480/obb.main.twoversions.1101613.png 1379s icons-480/obb.main.twoversions.1101615.png 1379s icons-480/obb.main.twoversions.1101617.png 1379s icons-480/obb.mainpatch.current.1619.png 1379s icons-480/souch.smsbypass.9.png 1379s icons-480/v1.v2.sig.1020.png 1379s icons-640/ 1379s icons-640/com.politedroid.3.png 1379s icons-640/com.politedroid.4.png 1379s icons-640/com.politedroid.5.png 1379s icons-640/com.politedroid.6.png 1379s icons-640/duplicate.permisssions.9999999.png 1379s icons-640/info.guardianproject.urzip.100.png 1379s icons-640/no.min.target.sdk.987.png 1379s icons-640/obb.main.oldversion.1444412523.png 1379s icons-640/obb.main.twoversions.1101613.png 1379s icons-640/obb.main.twoversions.1101615.png 1379s icons-640/obb.main.twoversions.1101617.png 1379s icons-640/obb.mainpatch.current.1619.png 1379s icons-640/souch.smsbypass.9.png 1379s icons-640/v1.v2.sig.1020.png 1379s icons/ 1379s icons/com.politedroid.3.png 1379s icons/com.politedroid.4.png 1379s icons/com.politedroid.5.png 1379s icons/com.politedroid.6.png 1379s icons/duplicate.permisssions.9999999.png 1379s icons/ic_antifeature_ads.xml 1379s icons/ic_antifeature_disabledalgorithm.xml 1379s icons/ic_antifeature_knownvuln.xml 1379s icons/ic_antifeature_nonfreeadd.xml 1379s icons/ic_antifeature_nonfreeassets.xml 1379s icons/ic_antifeature_nonfreedep.xml 1379s icons/ic_antifeature_nonfreenet.xml 1379s icons/ic_antifeature_nosourcesince.xml 1379s icons/ic_antifeature_nsfw.xml 1379s icons/ic_antifeature_tracking.xml 1379s icons/ic_antifeature_upstreamnonfree.xml 1379s icons/icon.png 1379s icons/info.guardianproject.urzip.100.png 1379s icons/no.min.target.sdk.987.png 1379s icons/obb.main.oldversion.1444412523.png 1379s icons/obb.main.twoversions.1101613.png 1379s icons/obb.main.twoversions.1101615.png 1379s icons/obb.main.twoversions.1101617.png 1379s icons/obb.mainpatch.current.1619.png 1379s icons/souch.smsbypass.9.png 1379s icons/v1.v2.sig.1020.png 1379s info.guardianproject.checkey/ 1379s info.guardianproject.checkey/en-US/ 1379s info.guardianproject.checkey/en-US/phoneScreenshots/ 1379s info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png 1379s info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png 1379s info.guardianproject.urzip/ 1379s info.guardianproject.urzip/en-US/ 1379s info.guardianproject.urzip/en-US/featureGraphic.png 1379s info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png 1379s info.guardianproject.urzip/en-US/icon.png 1379s info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png 1379s obb.mainpatch.current/ 1379s obb.mainpatch.current/en-US/ 1379s obb.mainpatch.current/en-US/featureGraphic.png 1379s obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png 1379s obb.mainpatch.current/en-US/icon.png 1379s obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png 1379s obb.mainpatch.current/en-US/phoneScreenshots/ 1379s obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 1379s obb.mainpatch.current/en-US/sevenInchScreenshots/ 1379s obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 1379s org.fake/ 1379s org.fake/de-DE/ 1379s org.fake/de-DE/tenInchScreenshots/ 1379s org.fake/en-US/ 1379s org.fake/en-US/phoneScreenshots/ 1379s org.fake/en-US/tenInchScreenshots/ 1379s org.videolan.vlc/ 1379s org.videolan.vlc/en-US/ 1379s org.videolan.vlc/en-US/icon.png 1379s org.videolan.vlc/en-US/phoneScreenshots/ 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png 1379s org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/ 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png 1379s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png 1379s status/ 1379s status/running.json 1379s status/update.json 1379s 2024-11-13 23:14:04,521 DEBUG: Popen(['git', 'remote', 'add', '--', 'autopkgtest', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.fOEJ'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=None) 1379s 2024-11-13 23:14:04,524 INFO: Mirroring to: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.fOEJ 1379s 2024-11-13 23:14:04,524 DEBUG: Adding all files to git mirror 1379s 2024-11-13 23:14:04,524 DEBUG: Popen(['git', 'add', '--all'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=None) 1379s 1379s sent 3,731,802 bytes received 3,660 bytes 7,470,924.00 bytes/sec 1379s total size is 3,713,929 speedup is 0.99 1379s 2024-11-13 23:14:04,677 DEBUG: Committing files into git mirror 1379s 2024-11-13 23:14:04,686 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=) 1379s 2024-11-13 23:14:04,688 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=) 1379s 2024-11-13 23:14:04,697 DEBUG: Pushing to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.fOEJ 1379s 2024-11-13 23:14:04,697 DEBUG: Popen(['git', 'version'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=False, shell=None, istream=None) 1379s 2024-11-13 23:14:04,699 DEBUG: Popen(['git', 'push', '--porcelain', '--force', '--set-upstream', '--progress', '--', 'autopkgtest', 'full:master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/git-mirror, universal_newlines=True, shell=None, istream=None) 1380s 2024-11-13 23:14:04,983 DEBUG: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.fOEJ: [new branch] 1380s 1380s 2024-11-13 23:14:04,983 INFO: Syncing from local_copy_dir to this repo. 1380s 2024-11-13 23:14:04,983 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/unsigned/ unsigned/ 1380s sending incremental file list 1380s created directory unsigned 1380s ./ 1380s urzip-release-unsigned.apk 1380s 1380s sent 8,617 bytes received 69 bytes 17,372.00 bytes/sec 1380s total size is 8,471 speedup is 0.98 1380s 2024-11-13 23:14:05,030 INFO: Pushing binary transparency log to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/binary_transparency 1380s 2024-11-13 23:14:05,031 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/binary_transparency, universal_newlines=False, shell=None, istream=None) 1380s 2024-11-13 23:14:05,033 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/binary_transparency, universal_newlines=True, shell=None, istream=None) 1380s 2024-11-13 23:14:05,049 DEBUG: Fetch head lines do not match lines provided via progress information 1380s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 1380s Will ignore extra progress lines or fetch head lines. 1380s 2024-11-13 23:14:05,049 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' = [up to date] master -> local/master']" 1380s 2024-11-13 23:14:05,049 DEBUG: b'head info: ["3ec447869cb1d2f3fda36a510815a698a007ca0a\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.xMYw/fdroid/binary_transparency\\n"]' 1380s 2024-11-13 23:14:05,053 INFO: rsyncing unsigned to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.oWmR/fdroid/ 1380s building file list ... done 1380s unsigned/ 1380s unsigned/urzip-release-unsigned.apk 1380s 1380s sent 8,654 bytes received 37 bytes 17,382.00 bytes/sec 1380s total size is 8,471 speedup is 0.97 1380s building file list ... done 1380s 1380s sent 137 bytes received 11 bytes 296.00 bytes/sec 1380s total size is 8,471 speedup is 57.24 1380s 2024-11-13 23:14:05,148 INFO: Pushing binary transparency log to /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.acTS 1380s 2024-11-13 23:14:05,149 DEBUG: Popen(['git', 'init', '--initial-branch=master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.acTS, universal_newlines=False, shell=None, istream=None) 1380s 2024-11-13 23:14:05,153 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/binary_transparency'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.acTS, universal_newlines=False, shell=None, istream=None) 1380s 2024-11-13 23:14:05,156 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.acTS, universal_newlines=True, shell=None, istream=None) 1380s 2024-11-13 23:14:05,190 DEBUG: Fetch head lines do not match lines provided via progress information 1380s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 1380s Will ignore extra progress lines or fetch head lines. 1380s 2024-11-13 23:14:05,190 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' * [new branch] master -> local/master']" 1380s 2024-11-13 23:14:05,190 DEBUG: b'head info: ["3ec447869cb1d2f3fda36a510815a698a007ca0a\\t\\tbranch \'master\' of /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/binary_transparency\\n"]' 1380s 2024-11-13 23:14:05,191 DEBUG: skip deploying full build logs: not enabled in config 1380s 2024-11-13 23:14:05,191 DEBUG: skip deploying full build logs: not enabled in config 1380s 2024-11-13 23:14:05,191 DEBUG: skip deploying full build logs: not enabled in config 1380s + test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.pkrS/unsigned/urzip-release-unsigned.apk 1380s + test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.oWmR/fdroid/unsigned/urzip-release-unsigned.apk 1380s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.acTS 1380s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD 1380s + '[' 1 == 1 ']' 1380s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.fOEJ 1380s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD 1380s ============================================================================== 1380s test extracting and publishing with developer signature 1380s + '[' 1 == 1 ']' 1380s + echo_header 'test extracting and publishing with developer signature' 1380s + use_apksigner 1380s + python3 -c ' 1380s import sys 1380s sys.path.insert(0, '\''/tmp/autopkgtest.BGvKMW/build.5vX/src'\'') 1380s from fdroidserver import common 1380s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 1380s common.find_apksigner(c) 1380s exit(c.get('\''apksigner'\'') is None) 1380s ' 1380s ++ create_test_dir 1380s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1380s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1380s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.qUhe 1380s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.qUhe 1380s + fdroid_init_with_prebuilt_keystore 1380s + '[' -z '' ']' 1380s + keystore=/tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 1380s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks --repo-keyalias=sova 1381s 1381s Built repo based in "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.qUhe" with this config: 1381s 1381s Android SDK: /usr/lib/android-sdk 1381s Keystore for signing key: /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/keystore.jks 1381s Alias for key in store: sova 1381s 1381s To complete the setup, add your APKs to "/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.qUhe/repo" 1381s then run "fdroid update -c; fdroid update". You might also want to edit 1381s "config.yml" to set the URL, repo name, and more. You should also set up 1381s a signing key (a temporary one might have been automatically generated). 1381s 1381s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 1381s and https://f-droid.org/docs/Signing_Process 1381s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 1381s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 1381s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"' 1381s + test -d metadata 1381s + mkdir metadata 1381s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/metadata/com.politedroid.yml metadata/ 1381s + test -d repo 1381s + test -d unsigned 1381s + mkdir unsigned 1381s + cp /tmp/autopkgtest.BGvKMW/build.5vX/src/tests/repo/com.politedroid_6.apk unsigned/ 1381s + /usr/bin/fdroid signatures unsigned/com.politedroid_6.apk 1382s + test -d metadata/com.politedroid/signatures/6 1382s + test -f metadata/com.politedroid/signatures/6/MANIFEST.MF 1382s + test -f metadata/com.politedroid/signatures/6/RELEASE.RSA 1382s + test -f metadata/com.politedroid/signatures/6/RELEASE.SF 1382s + test -f repo/com.politedroid_6.apk 1382s + /usr/bin/fdroid publish 1382s 2024-11-13 23:14:07,893 INFO: Creating log directory 1382s 2024-11-13 23:14:07,898 INFO: 1 app, 1 key aliases 1382s 2024-11-13 23:14:07,898 INFO: Processing unsigned/com.politedroid_6.apk 1383s 2024-11-13 23:14:08,240 INFO: Key alias: 4e7da5b7 1384s 2024-11-13 23:14:09,445 INFO: Published com.politedroid_6.apk 1385s 2024-11-13 23:14:10,957 INFO: published list signing-key fingerprints 1386s /usr/bin/apksigner 1386s + test -f repo/com.politedroid_6.apk 1386s + which apksigner 1386s + apksigner verify repo/com.politedroid_6.apk 1386s + which jarsigner 1386s + jarsigner -verify repo/com.politedroid_6.apk 1386s /usr/bin/jarsigner 1386s 1386s The jar will be treated as unsigned, because it is signed with a weak algorithm that is now disabled. 1386s 1386s Re-run jarsigner with the -verbose option for more details. 1386s ============================================================================== 1386s test mirroring a repo 1386s + echo_header 'test mirroring a repo' 1386s + which wget 1386s ++ create_test_dir 1386s /usr/bin/wget 1386s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1386s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1386s + TESTROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ofTY 1386s ++ create_test_dir 1386s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1386s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1386s + REPOROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nwpo 1386s + cp -r /tmp/autopkgtest.BGvKMW/build.5vX/src/tests /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ofTY 1386s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ofTY/tests 1386s + test -d archive 1386s + mkdir archive 1386s + cp repo/index-v1.json /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nwpo/ 1386s + /usr/bin/fdroid update 1387s 2024-11-13 23:14:12,340 WARNING: config.py is deprecated, use config.yml 1387s 2024-11-13 23:14:12,343 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 1387s 2024-11-13 23:14:12,349 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/Ads.txt was ignored! 1387s 2024-11-13 23:14:12,349 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/en-US/antifeatures/NoSourceSince.txt was ignored! 1387s 2024-11-13 23:14:12,349 ERROR: Duplicate Anti-Feature declaration at metadata/app.with.special.build.params/zh-CN/antifeatures/49_Tracking.txt was ignored! 1389s 2024-11-13 23:14:14,317 WARNING: repo/duplicate.permisssions_9999999.apk: debuggable or testOnly set in AndroidManifest.xml 1390s 2024-11-13 23:14:15,049 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 1393s 2024-11-13 23:14:18,944 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 1393s Use `fdroid update -c` to create it. 1393s 2024-11-13 23:14:18,944 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 1393s Use `fdroid update -c` to create it. 1394s 2024-11-13 23:14:19,451 INFO: Creating signed index with this key (SHA256): 1394s 2024-11-13 23:14:19,451 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 1395s 2024-11-13 23:14:20,656 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1396s 2024-11-13 23:14:21,502 WARNING: Category "Time" defined but not used for any apps! 1396s 2024-11-13 23:14:21,502 WARNING: Category "Development" defined but not used for any apps! 1396s 2024-11-13 23:14:21,502 WARNING: Category "GuardianProject" defined but not used for any apps! 1396s 2024-11-13 23:14:21,502 WARNING: Category "Multimedia" defined but not used for any apps! 1396s 2024-11-13 23:14:21,502 WARNING: Category "Phone & SMS" defined but not used for any apps! 1396s 2024-11-13 23:14:21,502 WARNING: Category "Security" defined but not used for any apps! 1396s 2024-11-13 23:14:21,502 WARNING: Category "System" defined but not used for any apps! 1397s 2024-11-13 23:14:22,720 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 1397s 2024-11-13 23:14:22,721 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,728 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,729 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 1397s 2024-11-13 23:14:22,730 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 1398s 2024-11-13 23:14:23,237 INFO: Creating signed index with this key (SHA256): 1398s 2024-11-13 23:14:23,237 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 1399s 2024-11-13 23:14:24,341 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 1399s 2024-11-13 23:14:24,348 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 1399s 2024-11-13 23:14:24,348 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 1400s 2024-11-13 23:14:25,285 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 1400s 2024-11-13 23:14:25,286 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 1401s 2024-11-13 23:14:26,412 INFO: Finished 1401s + /usr/bin/fdroid signindex 1402s 2024-11-13 23:14:26,984 WARNING: config.py is deprecated, use config.yml 1402s 2024-11-13 23:14:27,791 INFO: Signed repo/index-v1.json 1403s 2024-11-13 23:14:28,397 INFO: Signed repo/entry.json 1404s 2024-11-13 23:14:29,200 INFO: Signed archive/index-v1.json 1404s 2024-11-13 23:14:29,803 INFO: Signed archive/entry.json 1404s + mv /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nwpo/index-v1.json repo/index-v1.json 1404s + port=32115 1404s ++ printf 32115 1404s ++ wc -m 1404s + test 5 -le 3 1404s + http_server_pid=32163 1404s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Nwpo 1404s + http_proxy= 1404s + HTTP_PROXY= 1404s + timeout 5m python3 -m http.server 32115 --bind 127.0.0.1 1404s + /usr/bin/fdroid mirror http://127.0.0.1:32115/ 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/com.politedroid_6.apk [16578/16578] -> "com.politedroid_6.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/com.politedroid_5.apk [18817/18817] -> "com.politedroid_5.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/com.politedroid_4.apk [18489/18489] -> "com.politedroid_4.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/com.politedroid_3.apk [17552/17552] -> "com.politedroid_3.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/duplicate.permisssions_9999999.apk [27446/27446] -> "duplicate.permisssions_9999999.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/fake.ota.update_1234.zip [233/233] -> "fake.ota.update_1234.zip" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/urzip-;%20%D0%A0%D0%B0%D1%85%D0%BC%D0%B0%CC%81,%20[r%C9%90x%CB%88man%CA%B2%C9%AAn%C9%99f]%20%D8%B3%D9%8A%D8%B1%D8%AC%D9%8A_%D8%B1%D8%AE%D9%85%D8%A7%D9%86%D9%8A%D9%86%D9%88%D9%81%20%E8%B0%A2%C2%B7.apk [11471/11471] -> "urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/info.zwanenburg.caffeinetile_4.apk [11740/11740] -> "info.zwanenburg.caffeinetile_4.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/no.min.target.sdk_987.apk [14102/14102] -> "no.min.target.sdk_987.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.main.oldversion_1444412523.apk [14323/14323] -> "obb.main.oldversion_1444412523.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.main.twoversions_1101617.apk [11481/11481] -> "obb.main.twoversions_1101617.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.main.twoversions_1101615.apk [11480/11480] -> "obb.main.twoversions_1101615.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.main.twoversions_1101613.apk [11477/11477] -> "obb.main.twoversions_1101613.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.mainpatch.current_1619.apk [11479/11479] -> "obb.mainpatch.current_1619.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.mainpatch.current_1619_another-release-key.apk [10541/10541] -> "obb.mainpatch.current_1619_another-release-key.apk" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/souch.smsbypass_9.apk [81295/81295] -> "souch.smsbypass_9.apk" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.02s 1405s Downloaded: 16 files, 282K in 0s (1.18 GB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png [24336/24336] -> "featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png [260113/260113] -> "icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.003s 1405s Downloaded: 2 files, 278K in 0s (1.16 GB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png [44990/44990] -> "screenshot-main.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.002s 1405s Downloaded: 1 files, 44K in 0s (1.70 GB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png [56049/56049] -> "screenshot-tablet-main.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.002s 1405s Downloaded: 1 files, 55K in 0s (1.53 GB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png [36027/36027] -> "featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png [1413/1413] -> "icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.003s 1405s Downloaded: 2 files, 37K in 0s (1.27 GB/s) 1405s ERROR: no "icon" in info.zwanenburg.caffeinetile 1405s ERROR: no "icon" in fake.ota.update 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/souch.smsbypass.9.png [1558/1558] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/com.politedroid.6.png [559/559] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.009s 1405s Downloaded: 8 files, 9.9K in 0s (240 MB/s) 1405s http://127.0.0.1:32115/repo/icons-65534/souch.smsbypass.9.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/duplicate.permisssions.9999999.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/no.min.target.sdk.987.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/obb.main.oldversion.1444412523.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/obb.main.twoversions.1101617.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/obb.mainpatch.current.1619.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/com.politedroid.6.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s http://127.0.0.1:32115/repo/icons-65534/info.guardianproject.urzip.100.png: 1405s 2024-11-13 23:14:30 ERROR 404: File not found. 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/souch.smsbypass.9.png [5874/5874] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-640/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.01s 1405s Downloaded: 8 files, 15K in 0s (269 MB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/souch.smsbypass.9.png [5874/5874] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-480/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.01s 1405s Downloaded: 8 files, 15K in 0s (309 MB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/souch.smsbypass.9.png [3615/3615] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-320/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.01s 1405s Downloaded: 8 files, 13K in 0s (279 MB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/souch.smsbypass.9.png [2264/2264] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/com.politedroid.6.png [910/910] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-240/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.009s 1405s Downloaded: 8 files, 11K in 0s (253 MB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/souch.smsbypass.9.png [1558/1558] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/com.politedroid.6.png [559/559] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-160/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.01s 1405s Downloaded: 8 files, 9.9K in 0s (223 MB/s) 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/souch.smsbypass.9.png [1335/1335] -> "souch.smsbypass.9.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/com.politedroid.6.png [357/357] -> "com.politedroid.6.png" [1] 1405s 2024-11-13 23:14:30 URL:http://127.0.0.1:32115/repo/icons-120/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 1405s FINISHED --2024-11-13 23:14:30-- 1405s Total wall clock time: 0.01s 1405s Downloaded: 8 files, 9.5K in 0s (194 MB/s) 1405s + test -e 127.0.0.1:32115/repo/souch.smsbypass_9.apk 1405s + test -e 127.0.0.1:32115/repo/icons-640/souch.smsbypass.9.png 1405s + test -e 127.0.0.1:32115/repo/index-v1.jar 1405s + http_proxy= 1405s + HTTP_PROXY= 1405s + /usr/bin/fdroid mirror 'http://127.0.0.1:32115/?fingerprint=asdfasdf' 1406s ERROR: The repository's fingerprint does not match. 1406s + test -e 127.0.0.1:32115/repo/index-v1.jar 1406s + http_proxy= 1406s + HTTP_PROXY= 1406s + /usr/bin/fdroid mirror 'http://127.0.0.1:32115/?fingerprint=F49AF3F11EFDDF20DFFD70F5E3117B9976674167ADCA280E6B1932A0601B26F6' 1407s 2024-11-13 23:14:32 URL:http://127.0.0.1:32115/repo/index-v1.jar [8373/8373] -> "index-v1.jar" [1] 1407s FINISHED --2024-11-13 23:14:32-- 1407s Total wall clock time: 0.002s 1407s Downloaded: 1 files, 8.2K in 0s (933 MB/s) 1407s ERROR: no "icon" in info.zwanenburg.caffeinetile 1407s ERROR: no "icon" in fake.ota.update 1407s http://127.0.0.1:32115/repo/icons-65534/souch.smsbypass.9.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/duplicate.permisssions.9999999.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/no.min.target.sdk.987.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/obb.main.oldversion.1444412523.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/obb.main.twoversions.1101617.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/obb.mainpatch.current.1619.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/com.politedroid.6.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s http://127.0.0.1:32115/repo/icons-65534/info.guardianproject.urzip.100.png: 1407s 2024-11-13 23:14:32 ERROR 404: File not found. 1407s + test -e 127.0.0.1:32115/repo/index-v1.jar 1407s + kill -9 32163 1407s + rm -f 127.0.0.1:32115/repo/com.politedroid_3.apk 127.0.0.1:32115/repo/com.politedroid_4.apk 127.0.0.1:32115/repo/com.politedroid_5.apk 127.0.0.1:32115/repo/com.politedroid_6.apk 127.0.0.1:32115/repo/duplicate.permisssions_9999999.apk 127.0.0.1:32115/repo/info.zwanenburg.caffeinetile_4.apk 127.0.0.1:32115/repo/no.min.target.sdk_987.apk 127.0.0.1:32115/repo/obb.main.oldversion_1444412523.apk 127.0.0.1:32115/repo/obb.main.twoversions_1101613.apk 127.0.0.1:32115/repo/obb.main.twoversions_1101615.apk 127.0.0.1:32115/repo/obb.main.twoversions_1101617.apk 127.0.0.1:32115/repo/obb.mainpatch.current_1619.apk 127.0.0.1:32115/repo/obb.mainpatch.current_1619_another-release-key.apk 127.0.0.1:32115/repo/souch.smsbypass_9.apk '127.0.0.1:32115/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk' 127.0.0.1:32115/repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 127.0.0.1:32115/repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 1407s ./tests/run-tests: line 1330: 32163 Killed timeout 5m python3 -m http.server $port --bind 127.0.0.1 > $REPOROOT/http.server.log 2>&1 (wd: /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.ofTY/tests) 1407s + sleep 1 1408s + echo_header 'Test recovering from from broken git submodules' 1408s + export GIT_ALLOW_PROTOCOL=file 1408s + GIT_ALLOW_PROTOCOL=file 1408s ++ create_test_dir 1408s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1408s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1408s + ROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ 1408s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ 1408s + mkdir foo bar 1408s + cd foo 1408s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1408s ============================================================================== 1408s Test recovering from from broken git submodules 1408s hint: Using 'master' as the name for the initial branch. This default branch name 1408s hint: is subject to change. To configure the initial branch name to use in all 1408s hint: of your new repositories, which will suppress this warning, call: 1408s hint: 1408s hint: git config --global init.defaultBranch 1408s hint: 1408s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 1408s hint: 'development'. The just-created branch can be renamed via this command: 1408s hint: 1408s hint: git branch -m 1408s Initialized empty Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ/foo/.git/ 1408s [master (root-commit) 854ae78] a 1408s 1 file changed, 1 insertion(+) 1408s create mode 100644 a 1408s Initialized empty Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ/bar/.git/ 1408s + echo a 1408s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add a 1408s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m a 1408s + cd ../bar 1408s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1408s hint: Using 'master' as the name for the initial branch. This default branch name 1408s hint: is subject to change. To configure the initial branch name to use in all 1408s hint: of your new repositories, which will suppress this warning, call: 1408s hint: 1408s hint: git config --global init.defaultBranch 1408s hint: 1408s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 1408s hint: 'development'. The just-created branch can be renamed via this command: 1408s hint: 1408s hint: git branch -m 1408s ++ pwd 1408s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ/bar/../foo baz 1408s Cloning into '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ/bar/baz'... 1408s + rm .gitmodules 1408s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am a 1409s [master (root-commit) cdb1ba4] a 1409s 1 file changed, 1 insertion(+) 1409s create mode 160000 baz 1409s + rm -rf baz 1409s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git checkout baz 1409s Updated 1 path from the index 1409s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 2 1409s + cd .. 1409s + mkdir repo 1409s + mkdir metadata 1409s + echo 'RepoType: git' 1409s ++ pwd 1409s + echo 'Repo: file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.y9uJ/bar' 1409s + echo 'AutoUpdateMode: Version' 1409s + echo 'UpdateCheckMode: Tags' 1409s + echo 'UpdateCheckData: '\''|||'\''' 1409s + echo 'CurrentVersion: 1' 1409s + echo 'CurrentVersionCode: 1' 1409s + /usr/bin/fdroid checkupdates --allow-dirty 1409s 2024-11-13 23:14:34,410 INFO: Processing fake 1413s 2024-11-13 23:14:38,759 INFO: ...updating to version 2 (2) 1413s + grep 'CurrentVersionCode: 2' metadata/fake.yml 1413s + echo_header 'checkupdates ignore broken submodule' 1413s ++ create_test_dir 1413s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1413s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1413s + ROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze 1413s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze 1413s + mkdir foo bar 1413s + cd foo 1413s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1413s hint: Using 'master' as the name for the initial branch. This default branch name 1413s hint: is subject to change. To configure the initial branch name to use in all 1413s hint: of your new repositories, which will suppress this warning, call: 1413s hint: 1413s hint: git config --global init.defaultBranch 1413s hint: 1413s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 1413s hint: 'development'. The just-created branch can be renamed via this command: 1413s hint: 1413s hint: git branch -m 1413s CurrentVersionCode: 2 1413s ============================================================================== 1413s checkupdates ignore broken submodule 1413s + echo a 1413s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add a 1413s Initialized empty Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze/foo/.git/ 1413s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m a 1413s [master (root-commit) 2adea3c] a 1413s 1 file changed, 1 insertion(+) 1413s create mode 100644 a 1413s Initialized empty Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze/bar/.git/ 1413s + cd ../bar 1413s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1413s hint: Using 'master' as the name for the initial branch. This default branch name 1413s hint: is subject to change. To configure the initial branch name to use in all 1413s hint: of your new repositories, which will suppress this warning, call: 1413s hint: 1413s hint: git config --global init.defaultBranch 1413s hint: 1413s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 1413s hint: 'development'. The just-created branch can be renamed via this command: 1413s hint: 1413s hint: git branch -m 1413s ++ pwd 1413s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze/bar/../foo baz 1413s Cloning into '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze/bar/baz'... 1413s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am a 1414s [master (root-commit) de104ef] a 1414s 2 files changed, 4 insertions(+) 1414s create mode 100644 .gitmodules 1414s create mode 160000 baz 1414s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 2 1414s + cd ../foo 1414s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit --amend -m aa 1414s [master d37b2b9] aa 1414s Date: Wed Nov 13 23:14:38 2024 +0000 1414s 1 file changed, 1 insertion(+) 1414s create mode 100644 a 1414s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git reflog expire --expire=now --all 1414s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git gc --aggressive --prune=now 1414s + cd .. 1414s + mkdir repo 1414s + mkdir metadata 1414s + echo 'RepoType: git' 1414s ++ pwd 1414s + echo 'Repo: file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.Bwze/bar' 1414s + echo Builds: 1414s + echo ' - versionName: 1' 1414s + echo ' versionCode: 1' 1414s + echo ' submodules: true' 1414s + echo 'AutoUpdateMode: Version' 1414s + echo 'UpdateCheckMode: Tags' 1414s + echo 'UpdateCheckData: '\''|||'\''' 1414s + echo 'CurrentVersion: 1' 1414s + echo 'CurrentVersionCode: 1' 1414s + /usr/bin/fdroid checkupdates --allow-dirty 1414s 2024-11-13 23:14:39,803 INFO: Processing fake 1416s 2024-11-13 23:14:41,025 INFO: submodule broken for fake 1418s 2024-11-13 23:14:43,473 INFO: submodule broken for fake 1420s 2024-11-13 23:14:45,296 INFO: ...updating to version 2 (2) 1420s + grep 'CurrentVersionCode: 2' metadata/fake.yml 1420s + echo_header 'checkupdates check version in submodule' 1420s ++ create_test_dir 1420s ++ test -e /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles 1420s ++ mktemp -d /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.XXXX 1420s CurrentVersionCode: 2 1420s ============================================================================== 1420s checkupdates check version in submodule 1420s + ROOT=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu 1420s + cd /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu 1420s + mkdir app sub 1420s + cd sub 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1420s Initialized empty Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/sub/.git/ 1420s hint: Using 'master' as the name for the initial branch. This default branch name 1420s hint: is subject to change. To configure the initial branch name to use in all 1420s hint: of your new repositories, which will suppress this warning, call: 1420s hint: 1420s hint: git config --global init.defaultBranch 1420s hint: 1420s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 1420s hint: 'development'. The just-created branch can be renamed via this command: 1420s hint: 1420s hint: git branch -m 1420s + echo 1 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add ver 1420s [master (root-commit) a3205cf] 1 1420s 1 file changed, 1 insertion(+) 1420s create mode 100644 ver 1420s Initialized empty Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app/.git/ 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m 1 1420s + cd ../app 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1420s hint: Using 'master' as the name for the initial branch. This default branch name 1420s hint: is subject to change. To configure the initial branch name to use in all 1420s hint: of your new repositories, which will suppress this warning, call: 1420s hint: 1420s hint: git config --global init.defaultBranch 1420s hint: 1420s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 1420s hint: 'development'. The just-created branch can be renamed via this command: 1420s hint: 1420s hint: git branch -m 1420s ++ pwd 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app/../sub 1420s Cloning into '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app/sub'... 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 1 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 1 1420s + cd ../sub 1420s + echo 2 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 2 1420s [master (root-commit) 6608a05] 1 1420s 2 files changed, 4 insertions(+) 1420s create mode 100644 .gitmodules 1420s create mode 160000 sub 1420s + cd ../app 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule update --remote 1420s [master b0669d5] 2 1420s 1 file changed, 1 insertion(+), 1 deletion(-) 1420s Reinitialized existing Git repository in /tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app/.git/ 1420s From file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app/../sub 1420s a3205cf..b0669d5 master -> origin/master 1420s Submodule path 'sub': checked out 'b0669d56b2c66ccb769c916db98cf76f6bda920f' 1420s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 2 1420s [master 52afc41] 2 1420s 1 file changed, 1 insertion(+), 1 deletion(-) 1420s + cd .. 1420s + mkdir repo 1420s + mkdir metadata 1420s + cat 1420s ++ pwd 1420s + /usr/bin/fdroid checkupdates --allow-dirty --auto -v 1421s 2024-11-13 23:14:46,011 DEBUG: ipfs_cid not found, skipping CIDv1 generation 1421s 2024-11-13 23:14:46,014 INFO: Processing fake 1421s 2024-11-13 23:14:46,014 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app build/fake 1421s Cloning into 'build/fake'... 1421s 2024-11-13 23:14:46,216 DEBUG: Directory: build/fake 1421s 2024-11-13 23:14:46,216 DEBUG: > git rev-parse --show-toplevel 1421s 2024-11-13 23:14:46,418 DEBUG: Directory: build/fake 1421s 2024-11-13 23:14:46,418 DEBUG: > git checkout -f origin/HEAD 1421s 2024-11-13 23:14:46,620 DEBUG: Directory: build/fake 1421s 2024-11-13 23:14:46,620 DEBUG: > git clean -dffx 1421s 2024-11-13 23:14:46,721 DEBUG: Directory: build/fake 1421s 2024-11-13 23:14:46,722 DEBUG: > git rev-parse --show-toplevel 1421s 2024-11-13 23:14:46,924 DEBUG: Directory: build/fake 1421s 2024-11-13 23:14:46,924 DEBUG: > git submodule sync 1422s 2024-11-13 23:14:47,026 DEBUG: Directory: build/fake 1422s 2024-11-13 23:14:47,026 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org submodule update --init --force --recursive 1422s Submodule 'sub' (file:///tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/app/../sub) registered for path 'sub' 1422s Cloning into '/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/build/fake/sub'... 1422s Submodule path 'sub': checked out 'b0669d56b2c66ccb769c916db98cf76f6bda920f' 1422s 2024-11-13 23:14:47,227 DEBUG: Directory: build/fake 1422s 2024-11-13 23:14:47,228 DEBUG: > git rev-parse --show-toplevel 1422s 2024-11-13 23:14:47,432 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/build/fake, universal_newlines=False, shell=None, istream=) 1422s 2024-11-13 23:14:47,434 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/build/fake, universal_newlines=False, shell=None, istream=) 1422s 2024-11-13 23:14:47,436 DEBUG: All tags: 1 1422s 2024-11-13 23:14:47,436 DEBUG: Check tag: '1' 1422s 2024-11-13 23:14:47,436 DEBUG: Directory: build/fake 1422s 2024-11-13 23:14:47,436 DEBUG: > git rev-parse --show-toplevel 1422s 2024-11-13 23:14:47,638 DEBUG: Directory: build/fake 1422s 2024-11-13 23:14:47,639 DEBUG: > git submodule foreach --recursive git reset --hard 1422s 2024-11-13 23:14:47,840 DEBUG: Directory: build/fake 1422s 2024-11-13 23:14:47,840 DEBUG: > git reset --hard 1423s 2024-11-13 23:14:48,042 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,042 DEBUG: > git submodule foreach --recursive git clean -dffx 1423s 2024-11-13 23:14:48,244 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,244 DEBUG: > git clean -dffx 1423s 2024-11-13 23:14:48,346 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,346 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --prune-tags --force origin 1423s 2024-11-13 23:14:48,448 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,448 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin 1423s 2024-11-13 23:14:48,550 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,550 DEBUG: > git remote set-head origin --auto 1423s 2024-11-13 23:14:48,752 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,752 DEBUG: > git checkout -f 1 1423s 2024-11-13 23:14:48,953 DEBUG: Directory: build/fake 1423s 2024-11-13 23:14:48,954 DEBUG: > git clean -dffx 1424s 2024-11-13 23:14:49,055 DEBUG: Directory: build/fake 1424s 2024-11-13 23:14:49,055 DEBUG: > git rev-parse --show-toplevel 1424s 2024-11-13 23:14:49,257 DEBUG: Directory: build/fake 1424s 2024-11-13 23:14:49,258 DEBUG: > git submodule sync 1424s 2024-11-13 23:14:49,459 DEBUG: Directory: build/fake 1424s 2024-11-13 23:14:49,459 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org submodule update --init --force --recursive 1424s Submodule path 'sub': checked out 'a3205cf63807314354ad12c752078d3ddb77f8a3' 1424s 2024-11-13 23:14:49,661 DEBUG: UpdateCheckData found version 1 (1) 1424s 2024-11-13 23:14:49,661 DEBUG: Directory: build/fake 1424s 2024-11-13 23:14:49,661 DEBUG: > git rev-parse --show-toplevel 1424s 2024-11-13 23:14:49,864 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.BGvKMW/build.5vX/src/.testfiles/run-tests.mxEu/build/fake, universal_newlines=False, shell=None, istream=) 1424s 2024-11-13 23:14:49,866 DEBUG: ...updating - old vercode=0, new vercode=1 1424s 2024-11-13 23:14:49,866 DEBUG: Directory: build/fake 1424s 2024-11-13 23:14:49,866 DEBUG: > git rev-parse --show-toplevel 1425s 2024-11-13 23:14:50,068 DEBUG: Directory: build/fake 1425s 2024-11-13 23:14:50,068 DEBUG: > git submodule foreach --recursive git reset --hard 1425s 2024-11-13 23:14:50,270 DEBUG: Directory: build/fake 1425s 2024-11-13 23:14:50,270 DEBUG: > git reset --hard 1425s 2024-11-13 23:14:50,472 DEBUG: Directory: build/fake 1425s 2024-11-13 23:14:50,472 DEBUG: > git submodule foreach --recursive git clean -dffx 1425s 2024-11-13 23:14:50,674 DEBUG: Directory: build/fake 1425s 2024-11-13 23:14:50,674 DEBUG: > git clean -dffx 1425s 2024-11-13 23:14:50,775 DEBUG: Directory: build/fake 1425s 2024-11-13 23:14:50,775 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --prune-tags --force origin 1425s 2024-11-13 23:14:50,877 DEBUG: Directory: build/fake 1425s 2024-11-13 23:14:50,877 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin 1426s 2024-11-13 23:14:50,979 DEBUG: Directory: build/fake 1426s 2024-11-13 23:14:50,979 DEBUG: > git remote set-head origin --auto 1426s 2024-11-13 23:14:51,181 DEBUG: Directory: build/fake 1426s 2024-11-13 23:14:51,181 DEBUG: > git checkout -f 6608a05f72fe2503e8473d8441db8b9d5aca4639 1426s 2024-11-13 23:14:51,383 DEBUG: Directory: build/fake 1426s 2024-11-13 23:14:51,383 DEBUG: > git clean -dffx 1426s 2024-11-13 23:14:51,484 DEBUG: ...fetch auto name from build/fake 1426s 2024-11-13 23:14:51,485 DEBUG: ...couldn't get autoname 1426s 2024-11-13 23:14:51,486 INFO: ...updating to version 1 (1) 1426s 2024-11-13 23:14:51,486 INFO: ...auto-generating build for 1 1426s 2024-11-13 23:14:51,489 DEBUG: Outputting JSON 1426s 2024-11-13 23:14:51,490 DEBUG: skip deploying full build logs: not enabled in config 1426s 2024-11-13 23:14:51,490 DEBUG: skip deploying full build logs: not enabled in config 1426s 2024-11-13 23:14:51,490 DEBUG: skip deploying full build logs: not enabled in config 1426s + grep 'CurrentVersionCode: 1' metadata/fake.yml 1426s + unset GIT_ALLOW_PROTOCOL 1426s + echo SUCCESS 1426s + err_handler 1426s CurrentVersionCode: 1 1426s SUCCESS 1426s + set +x 1427s autopkgtest [23:14:52]: test command1: -----------------------] 1431s autopkgtest [23:14:56]: test command1: - - - - - - - - - - results - - - - - - - - - - 1431s command1 PASS 1435s autopkgtest [23:15:00]: test locales: preparing testbed 1489s autopkgtest [23:15:54]: testbed dpkg architecture: armhf 1491s autopkgtest [23:15:56]: testbed apt version: 2.9.8 1491s autopkgtest [23:15:56]: @@@@@@@@@@@@@@@@@@@@ test bed setup 1499s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 1500s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [17.2 kB] 1500s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [101 kB] 1500s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [971 kB] 1500s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 1500s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Packages [104 kB] 1500s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Packages [668 kB] 1500s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Packages [17.2 kB] 1500s Fetched 1958 kB in 1s (1601 kB/s) 1500s Reading package lists... 1516s tee: /proc/self/fd/2: Permission denied 1545s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 1545s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 1545s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 1545s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 1547s Reading package lists... 1547s Reading package lists... 1547s Building dependency tree... 1547s Reading state information... 1547s Calculating upgrade... 1548s The following packages were automatically installed and are no longer required: 1548s libperl5.38t64 perl-modules-5.38 python3-netifaces 1548s Use 'apt autoremove' to remove them. 1548s The following NEW packages will be installed: 1548s libperl5.40 perl-modules-5.40 python3-jaraco.text python3.13-gdbm 1548s systemd-cryptsetup 1548s The following packages will be upgraded: 1548s apport apport-core-dump-handler base-files base-passwd bash-completion 1548s dhcpcd-base distro-info-data dpkg dpkg-dev fwupd gcc-14-base info 1548s install-info iproute2 libarchive13t64 libatomic1 libattr1 1548s libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 libblockdev-mdraid3 1548s libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 libblockdev-utils3 1548s libblockdev3 libbpf1 libbsd0 libbytesize-common libbytesize1 libdb5.3t64 1549s libdpkg-perl libdrm-common libdrm2 libdw1t64 libedit2 libelf1t64 libevdev2 1549s libfastjson4 libflashrom1 libftdi1-2 libfwupd2 libgcc-s1 libgnutls30t64 1549s libgpgme11t64 libinih1 libjson-c5 libjson-glib-1.0-0 libjson-glib-1.0-common 1549s libkeyutils1 libldap-common libldap2 liblocale-gettext-perl libmaxminddb0 1549s libmnl0 libnetfilter-conntrack3 libnetplan1 libnewt0.52 libnghttp2-14 1549s libnspr4 libnss-systemd libnvme1t64 libpam-systemd libpipeline1 libplymouth5 1549s libpng16-16t64 libpopt0 libpython3-stdlib libpython3.12-minimal 1549s libpython3.12-stdlib libsgutils2-1.46-2 libssh2-1t64 libstdc++6 1549s libsystemd-shared libsystemd0 libtext-charwidth-perl libtext-iconv-perl 1549s libtraceevent1 libtraceevent1-plugin libudev1 libudisks2-0 liburcu8t64 1549s libutempter0 libuv1t64 libx11-6 libx11-data libxau6 libxmlb2 mawk 1549s motd-news-config nano netplan-generator netplan.io openssh-client 1549s openssh-server openssh-sftp-server pci.ids perl perl-base plymouth 1549s plymouth-theme-ubuntu-text python3 python3-apport python3-certifi 1549s python3-cffi-backend python3-configobj python3-gdbm python3-gi python3-idna 1549s python3-jaraco.functools python3-json-pointer python3-jsonpatch 1549s python3-lazr.restfulclient python3-lazr.uri python3-minimal 1549s python3-more-itertools python3-netplan python3-newt python3-oauthlib 1549s python3-pkg-resources python3-problem-report python3-setuptools 1549s python3-typeguard python3-urllib3 python3-wadllib python3-zipp python3.12 1549s python3.12-gdbm python3.12-minimal sg3-utils sg3-utils-udev ssh-import-id 1549s systemd systemd-resolved systemd-sysv systemd-timesyncd tzdata udev udisks2 1549s ufw usbutils vim-common vim-tiny whiptail xxd 1549s 145 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 1549s Need to get 46.3 MB of archives. 1549s After this operation, 43.2 MB of additional disk space will be used. 1549s Get:1 http://ftpmaster.internal/ubuntu plucky/main armhf motd-news-config all 13.5ubuntu3 [5190 B] 1549s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf base-files armhf 13.5ubuntu3 [75.1 kB] 1549s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg armhf 1.22.11ubuntu3 [1247 kB] 1549s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf perl-modules-5.40 all 5.40.0-7 [3214 kB] 1549s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libperl5.40 armhf 5.40.0-7 [4139 kB] 1550s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf perl armhf 5.40.0-7 [263 kB] 1550s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf perl-base armhf 5.40.0-7 [1674 kB] 1550s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf liblocale-gettext-perl armhf 1.07-7build1 [15.0 kB] 1550s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-iconv-perl armhf 1.7-8build4 [12.8 kB] 1550s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf libtext-charwidth-perl armhf 0.04-11build4 [9128 B] 1550s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf libdb5.3t64 armhf 5.3.28+dfsg2-9 [655 kB] 1550s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf base-passwd armhf 3.6.5 [53.2 kB] 1550s Get:13 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-minimal armhf 3.12.7-1 [27.4 kB] 1550s Get:14 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3 armhf 3.12.7-1 [24.0 kB] 1550s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf tzdata all 2024b-1ubuntu2 [274 kB] 1550s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12 armhf 3.12.7-3 [661 kB] 1550s Get:17 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-stdlib armhf 3.12.7-3 [1934 kB] 1550s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-minimal armhf 3.12.7-3 [2012 kB] 1550s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-minimal armhf 3.12.7-3 [822 kB] 1551s Get:20 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libpython3-stdlib armhf 3.12.7-1 [10.0 kB] 1551s Get:21 http://ftpmaster.internal/ubuntu plucky/main armhf libnss-systemd armhf 256.5-2ubuntu4 [155 kB] 1551s Get:22 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-timesyncd armhf 256.5-2ubuntu4 [40.7 kB] 1551s Get:23 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-resolved armhf 256.5-2ubuntu4 [309 kB] 1551s Get:24 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd-shared armhf 256.5-2ubuntu4 [2129 kB] 1551s Get:25 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd0 armhf 256.5-2ubuntu4 [428 kB] 1551s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-sysv armhf 256.5-2ubuntu4 [11.9 kB] 1551s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf libpam-systemd armhf 256.5-2ubuntu4 [226 kB] 1551s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf systemd armhf 256.5-2ubuntu4 [3442 kB] 1551s Get:29 http://ftpmaster.internal/ubuntu plucky/main armhf udev armhf 256.5-2ubuntu4 [1949 kB] 1551s Get:30 http://ftpmaster.internal/ubuntu plucky/main armhf libudev1 armhf 256.5-2ubuntu4 [188 kB] 1551s Get:31 http://ftpmaster.internal/ubuntu plucky/main armhf python3-problem-report all 2.30.0-0ubuntu5 [25.0 kB] 1551s Get:32 http://ftpmaster.internal/ubuntu plucky/main armhf python3-apport all 2.30.0-0ubuntu5 [93.2 kB] 1551s Get:33 http://ftpmaster.internal/ubuntu plucky/main armhf python3-gi armhf 3.50.0-3 [227 kB] 1551s Get:34 http://ftpmaster.internal/ubuntu plucky/main armhf apport-core-dump-handler all 2.30.0-0ubuntu5 [17.9 kB] 1551s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf apport all 2.30.0-0ubuntu5 [83.0 kB] 1551s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf libbsd0 armhf 0.12.2-2 [36.8 kB] 1551s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf libedit2 armhf 3.1-20240808-1 [79.0 kB] 1551s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-sftp-server armhf 1:9.7p1-7ubuntu5 [35.4 kB] 1551s Get:39 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-server armhf 1:9.7p1-7ubuntu5 [505 kB] 1551s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf openssh-client armhf 1:9.7p1-7ubuntu5 [889 kB] 1551s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf libatomic1 armhf 14.2.0-8ubuntu1 [7846 B] 1551s Get:42 http://ftpmaster.internal/ubuntu plucky/main armhf gcc-14-base armhf 14.2.0-8ubuntu1 [51.5 kB] 1551s Get:43 http://ftpmaster.internal/ubuntu plucky/main armhf libstdc++6 armhf 14.2.0-8ubuntu1 [711 kB] 1551s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf libgcc-s1 armhf 14.2.0-8ubuntu1 [40.8 kB] 1551s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf libattr1 armhf 1:2.5.2-2 [10.5 kB] 1551s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf libgnutls30t64 armhf 3.8.8-2ubuntu1 [955 kB] 1551s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf install-info armhf 7.1.1-1 [61.4 kB] 1551s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf mawk armhf 1.3.4.20240905-1 [116 kB] 1551s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf dhcpcd-base armhf 1:10.1.0-2 [188 kB] 1551s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf distro-info-data all 0.63 [6588 B] 1551s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf libdw1t64 armhf 0.192-4 [243 kB] 1551s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf libelf1t64 armhf 0.192-4 [50.2 kB] 1551s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libbpf1 armhf 1:1.5.0-1 [158 kB] 1551s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libmnl0 armhf 1.0.5-3 [10.7 kB] 1551s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf iproute2 armhf 6.10.0-2ubuntu1 [1082 kB] 1551s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf libfastjson4 armhf 1.2304.0-2 [20.2 kB] 1551s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-c5 armhf 0.18+ds-1 [33.2 kB] 1551s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf libkeyutils1 armhf 1.6.3-4ubuntu2 [8712 B] 1551s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf netplan-generator armhf 1.1.1-1 [60.4 kB] 1551s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf python3-cffi-backend armhf 1.17.1-2 [68.7 kB] 1551s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf python3-netplan armhf 1.1.1-1 [24.1 kB] 1551s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf netplan.io armhf 1.1.1-1 [66.4 kB] 1551s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libnetplan1 armhf 1.1.1-1 [122 kB] 1551s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf python3-newt armhf 0.52.24-2ubuntu4 [19.7 kB] 1551s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf libnewt0.52 armhf 0.52.24-2ubuntu4 [39.2 kB] 1551s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf libpopt0 armhf 1.19+dfsg-2 [25.4 kB] 1551s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf vim-tiny armhf 2:9.1.0777-1ubuntu1 [693 kB] 1551s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf vim-common all 2:9.1.0777-1ubuntu1 [394 kB] 1551s Get:69 http://ftpmaster.internal/ubuntu plucky/main armhf whiptail armhf 0.52.24-2ubuntu4 [17.2 kB] 1552s Get:70 http://ftpmaster.internal/ubuntu plucky/main armhf xxd armhf 2:9.1.0777-1ubuntu1 [66.8 kB] 1552s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf bash-completion all 1:2.14.0-2 [210 kB] 1552s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf info armhf 7.1.1-1 [126 kB] 1552s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-common all 2.4.123-1 [8436 B] 1552s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm2 armhf 2.4.123-1 [36.5 kB] 1552s Get:75 http://ftpmaster.internal/ubuntu plucky/main armhf libevdev2 armhf 1.13.3+dfsg-1 [29.7 kB] 1552s Get:76 http://ftpmaster.internal/ubuntu plucky/main armhf libmaxminddb0 armhf 1.11.0-1 [16.8 kB] 1552s Get:77 http://ftpmaster.internal/ubuntu plucky/main armhf libnetfilter-conntrack3 armhf 1.1.0-1 [38.4 kB] 1552s Get:78 http://ftpmaster.internal/ubuntu plucky/main armhf libnghttp2-14 armhf 1.64.0-1 [68.9 kB] 1552s Get:79 http://ftpmaster.internal/ubuntu plucky/main armhf libpipeline1 armhf 1.5.8-1 [26.9 kB] 1552s Get:80 http://ftpmaster.internal/ubuntu plucky/main armhf libpng16-16t64 armhf 1.6.44-2 [168 kB] 1552s Get:81 http://ftpmaster.internal/ubuntu plucky/main armhf libplymouth5 armhf 24.004.60-1ubuntu11 [140 kB] 1552s Get:82 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1-plugin armhf 1:1.8.3-1ubuntu1 [18.1 kB] 1552s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1 armhf 1:1.8.3-1ubuntu1 [52.1 kB] 1552s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf liburcu8t64 armhf 0.14.1-1 [56.6 kB] 1552s Get:85 http://ftpmaster.internal/ubuntu plucky/main armhf libuv1t64 armhf 1.48.0-7 [83.3 kB] 1552s Get:86 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-data all 2:1.8.10-2 [116 kB] 1552s Get:87 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-6 armhf 2:1.8.10-2 [587 kB] 1552s Get:88 http://ftpmaster.internal/ubuntu plucky/main armhf libxau6 armhf 1:1.0.11-1 [6558 B] 1552s Get:89 http://ftpmaster.internal/ubuntu plucky/main armhf nano armhf 8.2-1 [276 kB] 1552s Get:90 http://ftpmaster.internal/ubuntu plucky/main armhf pci.ids all 0.0~2024.10.24-1 [279 kB] 1552s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-1ubuntu11 [9920 B] 1552s Get:92 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth armhf 24.004.60-1ubuntu11 [142 kB] 1552s Get:93 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-gdbm armhf 3.12.7-3 [28.7 kB] 1552s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-gdbm armhf 3.13.0-2 [29.5 kB] 1552s Get:95 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-gdbm armhf 3.12.7-1 [8642 B] 1552s Get:96 http://ftpmaster.internal/ubuntu plucky/main armhf ufw all 0.36.2-8 [170 kB] 1552s Get:97 http://ftpmaster.internal/ubuntu plucky/main armhf usbutils armhf 1:018-1 [76.1 kB] 1552s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg-dev all 1.22.11ubuntu3 [1088 kB] 1552s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libdpkg-perl all 1.22.11ubuntu3 [279 kB] 1552s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libarchive13t64 armhf 3.7.4-1.1 [331 kB] 1552s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libftdi1-2 armhf 1.5-7 [25.7 kB] 1552s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libflashrom1 armhf 1.4.0-3ubuntu1 [141 kB] 1552s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-common all 1.10.0+ds-3 [5586 B] 1552s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-0 armhf 1.10.0+ds-3 [61.7 kB] 1552s Get:105 http://ftpmaster.internal/ubuntu plucky/main armhf libfwupd2 armhf 1.9.26-2 [125 kB] 1552s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf libxmlb2 armhf 0.3.21-1 [57.7 kB] 1552s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf fwupd armhf 1.9.26-2 [4404 kB] 1553s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-utils3 armhf 3.2.1-1 [17.4 kB] 1553s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-crypto3 armhf 3.2.1-1 [22.4 kB] 1553s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-fs3 armhf 3.2.1-1 [34.3 kB] 1553s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-loop3 armhf 3.2.1-1 [6552 B] 1553s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize1 armhf 2.11-1ubuntu1 [12.0 kB] 1553s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf libbytesize-common all 2.11-1ubuntu1 [3584 B] 1553s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-mdraid3 armhf 3.2.1-1 [13.4 kB] 1553s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf libnvme1t64 armhf 1.11-1 [73.8 kB] 1553s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-nvme3 armhf 3.2.1-1 [17.6 kB] 1553s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-part3 armhf 3.2.1-1 [16.5 kB] 1553s Get:118 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-swap3 armhf 3.2.1-1 [8952 B] 1553s Get:119 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev3 armhf 3.2.1-1 [44.2 kB] 1553s Get:120 http://ftpmaster.internal/ubuntu plucky/main armhf libgpgme11t64 armhf 1.23.2-5ubuntu4 [123 kB] 1553s Get:121 http://ftpmaster.internal/ubuntu plucky/main armhf libinih1 armhf 58-1ubuntu1 [6750 B] 1553s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf libldap-common all 2.6.8+dfsg-1~exp4ubuntu3 [32.3 kB] 1553s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf libldap2 armhf 2.6.8+dfsg-1~exp4ubuntu3 [173 kB] 1553s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf libnspr4 armhf 2:4.35-1.1ubuntu2 [94.1 kB] 1553s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf libsgutils2-1.46-2 armhf 1.46-3ubuntu5 [82.5 kB] 1553s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf libssh2-1t64 armhf 1.11.1-1 [116 kB] 1553s Get:127 http://ftpmaster.internal/ubuntu plucky/main armhf udisks2 armhf 2.10.1-11ubuntu1 [278 kB] 1553s Get:128 http://ftpmaster.internal/ubuntu plucky/main armhf libudisks2-0 armhf 2.10.1-11ubuntu1 [142 kB] 1553s Get:129 http://ftpmaster.internal/ubuntu plucky/main armhf libutempter0 armhf 1.2.1-4 [9062 B] 1553s Get:130 http://ftpmaster.internal/ubuntu plucky/main armhf python3-certifi all 2024.8.30+dfsg-1 [9742 B] 1553s Get:131 http://ftpmaster.internal/ubuntu plucky/main armhf python3-configobj all 5.0.9-1 [33.9 kB] 1553s Get:132 http://ftpmaster.internal/ubuntu plucky/main armhf python3-idna all 3.8-2 [47.0 kB] 1553s Get:133 http://ftpmaster.internal/ubuntu plucky/main armhf python3-more-itertools all 10.5.0-1 [56.2 kB] 1553s Get:134 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jaraco.functools all 4.1.0-1 [11.8 kB] 1553s Get:135 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jaraco.text all 4.0.0-1 [11.5 kB] 1553s Get:136 http://ftpmaster.internal/ubuntu plucky/main armhf python3-json-pointer all 2.4-2 [8396 B] 1553s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jsonpatch all 1.32-4 [12.2 kB] 1553s Get:138 http://ftpmaster.internal/ubuntu plucky/main armhf python3-typeguard all 4.4.1-1 [29.0 kB] 1553s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf python3-zipp all 3.21.0-1 [10.2 kB] 1553s Get:140 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-pkg-resources all 75.2.0-1 [134 kB] 1553s Get:141 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-setuptools all 75.2.0-1 [657 kB] 1553s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.uri all 1.0.6-4 [13.6 kB] 1553s Get:143 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wadllib all 2.0.0-1 [36.7 kB] 1553s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf python3-oauthlib all 3.2.2-2 [89.8 kB] 1553s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.restfulclient all 0.14.6-2 [50.9 kB] 1553s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf python3-urllib3 all 2.0.7-2ubuntu0.1 [93.1 kB] 1553s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils armhf 1.46-3ubuntu5 [816 kB] 1553s Get:148 http://ftpmaster.internal/ubuntu plucky/main armhf sg3-utils-udev all 1.46-3ubuntu5 [5916 B] 1553s Get:149 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-cryptsetup armhf 256.5-2ubuntu4 [122 kB] 1553s Get:150 http://ftpmaster.internal/ubuntu plucky/main armhf ssh-import-id all 5.11-0ubuntu3 [10.1 kB] 1554s Preconfiguring packages ... 1554s Fetched 46.3 MB in 5s (8869 kB/s) 1554s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 1554s Preparing to unpack .../motd-news-config_13.5ubuntu3_all.deb ... 1554s Unpacking motd-news-config (13.5ubuntu3) over (13.3ubuntu6) ... 1554s Preparing to unpack .../base-files_13.5ubuntu3_armhf.deb ... 1554s Unpacking base-files (13.5ubuntu3) over (13.3ubuntu6) ... 1554s Setting up base-files (13.5ubuntu3) ... 1554s Installing new version of config file /etc/issue ... 1554s Installing new version of config file /etc/issue.net ... 1554s Installing new version of config file /etc/lsb-release ... 1555s motd-news.service is a disabled or a static unit not running, not starting it. 1555s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 1555s Preparing to unpack .../dpkg_1.22.11ubuntu3_armhf.deb ... 1555s Unpacking dpkg (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 1555s Setting up dpkg (1.22.11ubuntu3) ... 1555s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59386 files and directories currently installed.) 1555s Preparing to unpack .../perl_5.40.0-7_armhf.deb ... 1555s Unpacking perl (5.40.0-7) over (5.38.2-5) ... 1556s Selecting previously unselected package perl-modules-5.40. 1556s Preparing to unpack .../perl-modules-5.40_5.40.0-7_all.deb ... 1556s Unpacking perl-modules-5.40 (5.40.0-7) ... 1556s Selecting previously unselected package libperl5.40:armhf. 1556s Preparing to unpack .../libperl5.40_5.40.0-7_armhf.deb ... 1556s Unpacking libperl5.40:armhf (5.40.0-7) ... 1556s Preparing to unpack .../perl-base_5.40.0-7_armhf.deb ... 1556s Unpacking perl-base (5.40.0-7) over (5.38.2-5) ... 1556s Setting up perl-base (5.40.0-7) ... 1556s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 1556s Preparing to unpack .../liblocale-gettext-perl_1.07-7build1_armhf.deb ... 1556s Unpacking liblocale-gettext-perl (1.07-7build1) over (1.07-7) ... 1556s Preparing to unpack .../libtext-iconv-perl_1.7-8build4_armhf.deb ... 1556s Unpacking libtext-iconv-perl:armhf (1.7-8build4) over (1.7-8build3) ... 1556s Preparing to unpack .../libtext-charwidth-perl_0.04-11build4_armhf.deb ... 1556s Unpacking libtext-charwidth-perl:armhf (0.04-11build4) over (0.04-11build3) ... 1556s Preparing to unpack .../libdb5.3t64_5.3.28+dfsg2-9_armhf.deb ... 1556s Unpacking libdb5.3t64:armhf (5.3.28+dfsg2-9) over (5.3.28+dfsg2-7) ... 1556s Setting up libdb5.3t64:armhf (5.3.28+dfsg2-9) ... 1557s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 1557s Preparing to unpack .../base-passwd_3.6.5_armhf.deb ... 1557s Unpacking base-passwd (3.6.5) over (3.6.4) ... 1557s Setting up base-passwd (3.6.5) ... 1557s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 1557s Preparing to unpack .../python3-minimal_3.12.7-1_armhf.deb ... 1557s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 1557s Setting up python3-minimal (3.12.7-1) ... 1557s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61465 files and directories currently installed.) 1557s Preparing to unpack .../00-python3_3.12.7-1_armhf.deb ... 1557s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 1557s Preparing to unpack .../01-tzdata_2024b-1ubuntu2_all.deb ... 1557s Unpacking tzdata (2024b-1ubuntu2) over (2024a-4ubuntu1) ... 1557s Preparing to unpack .../02-python3.12_3.12.7-3_armhf.deb ... 1557s Unpacking python3.12 (3.12.7-3) over (3.12.7-1) ... 1557s Preparing to unpack .../03-libpython3.12-stdlib_3.12.7-3_armhf.deb ... 1557s Unpacking libpython3.12-stdlib:armhf (3.12.7-3) over (3.12.7-1) ... 1558s Preparing to unpack .../04-python3.12-minimal_3.12.7-3_armhf.deb ... 1558s Unpacking python3.12-minimal (3.12.7-3) over (3.12.7-1) ... 1558s Preparing to unpack .../05-libpython3.12-minimal_3.12.7-3_armhf.deb ... 1558s Unpacking libpython3.12-minimal:armhf (3.12.7-3) over (3.12.7-1) ... 1558s Preparing to unpack .../06-libpython3-stdlib_3.12.7-1_armhf.deb ... 1558s Unpacking libpython3-stdlib:armhf (3.12.7-1) over (3.12.6-0ubuntu1) ... 1558s Preparing to unpack .../07-libnss-systemd_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking libnss-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../08-systemd-timesyncd_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking systemd-timesyncd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../09-systemd-resolved_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking systemd-resolved (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../10-libsystemd-shared_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking libsystemd-shared:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../11-libsystemd0_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking libsystemd0:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Setting up libsystemd0:armhf (256.5-2ubuntu4) ... 1558s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 1558s Preparing to unpack .../systemd-sysv_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking systemd-sysv (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../libpam-systemd_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking libpam-systemd:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../systemd_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking systemd (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1558s Preparing to unpack .../udev_256.5-2ubuntu4_armhf.deb ... 1558s Unpacking udev (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1559s Preparing to unpack .../libudev1_256.5-2ubuntu4_armhf.deb ... 1559s Unpacking libudev1:armhf (256.5-2ubuntu4) over (256.5-2ubuntu3) ... 1559s Setting up libudev1:armhf (256.5-2ubuntu4) ... 1559s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61464 files and directories currently installed.) 1559s Preparing to unpack .../0-python3-problem-report_2.30.0-0ubuntu5_all.deb ... 1559s Unpacking python3-problem-report (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 1559s Preparing to unpack .../1-python3-apport_2.30.0-0ubuntu5_all.deb ... 1559s Unpacking python3-apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 1559s Preparing to unpack .../2-python3-gi_3.50.0-3_armhf.deb ... 1559s Unpacking python3-gi (3.50.0-3) over (3.48.2-1) ... 1559s Preparing to unpack .../3-apport-core-dump-handler_2.30.0-0ubuntu5_all.deb ... 1559s Unpacking apport-core-dump-handler (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 1559s Preparing to unpack .../4-apport_2.30.0-0ubuntu5_all.deb ... 1559s Unpacking apport (2.30.0-0ubuntu5) over (2.30.0-0ubuntu4) ... 1559s Preparing to unpack .../5-libbsd0_0.12.2-2_armhf.deb ... 1559s Unpacking libbsd0:armhf (0.12.2-2) over (0.12.2-1) ... 1560s Setting up libbsd0:armhf (0.12.2-2) ... 1560s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1560s Preparing to unpack .../0-libedit2_3.1-20240808-1_armhf.deb ... 1560s Unpacking libedit2:armhf (3.1-20240808-1) over (3.1-20240517-1) ... 1560s Preparing to unpack .../1-openssh-sftp-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 1560s Unpacking openssh-sftp-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 1560s Preparing to unpack .../2-openssh-server_1%3a9.7p1-7ubuntu5_armhf.deb ... 1560s Unpacking openssh-server (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 1560s Preparing to unpack .../3-openssh-client_1%3a9.7p1-7ubuntu5_armhf.deb ... 1560s Unpacking openssh-client (1:9.7p1-7ubuntu5) over (1:9.7p1-7ubuntu4) ... 1560s Preparing to unpack .../4-libatomic1_14.2.0-8ubuntu1_armhf.deb ... 1560s Unpacking libatomic1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 1560s Preparing to unpack .../5-gcc-14-base_14.2.0-8ubuntu1_armhf.deb ... 1560s Unpacking gcc-14-base:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 1560s Setting up gcc-14-base:armhf (14.2.0-8ubuntu1) ... 1560s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1560s Preparing to unpack .../libstdc++6_14.2.0-8ubuntu1_armhf.deb ... 1560s Unpacking libstdc++6:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 1560s Setting up libstdc++6:armhf (14.2.0-8ubuntu1) ... 1560s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1560s Preparing to unpack .../libgcc-s1_14.2.0-8ubuntu1_armhf.deb ... 1560s Unpacking libgcc-s1:armhf (14.2.0-8ubuntu1) over (14.2.0-4ubuntu2) ... 1560s Setting up libgcc-s1:armhf (14.2.0-8ubuntu1) ... 1560s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1560s Preparing to unpack .../libattr1_1%3a2.5.2-2_armhf.deb ... 1560s Unpacking libattr1:armhf (1:2.5.2-2) over (1:2.5.2-1build2) ... 1560s Setting up libattr1:armhf (1:2.5.2-2) ... 1560s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1560s Preparing to unpack .../libgnutls30t64_3.8.8-2ubuntu1_armhf.deb ... 1560s Unpacking libgnutls30t64:armhf (3.8.8-2ubuntu1) over (3.8.6-2ubuntu1) ... 1560s Setting up libgnutls30t64:armhf (3.8.8-2ubuntu1) ... 1560s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1560s Preparing to unpack .../install-info_7.1.1-1_armhf.deb ... 1560s Unpacking install-info (7.1.1-1) over (7.1-3build2) ... 1561s Setting up install-info (7.1.1-1) ... 1561s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61456 files and directories currently installed.) 1561s Preparing to unpack .../000-mawk_1.3.4.20240905-1_armhf.deb ... 1561s Unpacking mawk (1.3.4.20240905-1) over (1.3.4.20240622-2) ... 1561s Preparing to unpack .../001-dhcpcd-base_1%3a10.1.0-2_armhf.deb ... 1561s Unpacking dhcpcd-base (1:10.1.0-2) over (1:10.0.8-3) ... 1561s Preparing to unpack .../002-distro-info-data_0.63_all.deb ... 1561s Unpacking distro-info-data (0.63) over (0.62) ... 1561s Preparing to unpack .../003-libdw1t64_0.192-4_armhf.deb ... 1561s Unpacking libdw1t64:armhf (0.192-4) over (0.191-2) ... 1561s Preparing to unpack .../004-libelf1t64_0.192-4_armhf.deb ... 1561s Unpacking libelf1t64:armhf (0.192-4) over (0.191-2) ... 1561s Preparing to unpack .../005-libbpf1_1%3a1.5.0-1_armhf.deb ... 1561s Unpacking libbpf1:armhf (1:1.5.0-1) over (1:1.4.5-1) ... 1561s Preparing to unpack .../006-libmnl0_1.0.5-3_armhf.deb ... 1561s Unpacking libmnl0:armhf (1.0.5-3) over (1.0.5-2build1) ... 1561s Preparing to unpack .../007-iproute2_6.10.0-2ubuntu1_armhf.deb ... 1561s Unpacking iproute2 (6.10.0-2ubuntu1) over (6.10.0-2) ... 1561s Preparing to unpack .../008-libfastjson4_1.2304.0-2_armhf.deb ... 1561s Unpacking libfastjson4:armhf (1.2304.0-2) over (1.2304.0-1build1) ... 1561s Preparing to unpack .../009-libjson-c5_0.18+ds-1_armhf.deb ... 1561s Unpacking libjson-c5:armhf (0.18+ds-1) over (0.17-1build1) ... 1561s Preparing to unpack .../010-libkeyutils1_1.6.3-4ubuntu2_armhf.deb ... 1561s Unpacking libkeyutils1:armhf (1.6.3-4ubuntu2) over (1.6.3-3build1) ... 1561s Preparing to unpack .../011-netplan-generator_1.1.1-1_armhf.deb ... 1561s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 1561s Unpacking netplan-generator (1.1.1-1) over (1.1-1) ... 1561s Preparing to unpack .../012-python3-cffi-backend_1.17.1-2_armhf.deb ... 1561s Unpacking python3-cffi-backend:armhf (1.17.1-2) over (1.17.1-1) ... 1561s Preparing to unpack .../013-python3-netplan_1.1.1-1_armhf.deb ... 1561s Unpacking python3-netplan (1.1.1-1) over (1.1-1) ... 1561s Preparing to unpack .../014-netplan.io_1.1.1-1_armhf.deb ... 1561s Unpacking netplan.io (1.1.1-1) over (1.1-1) ... 1561s Preparing to unpack .../015-libnetplan1_1.1.1-1_armhf.deb ... 1561s Unpacking libnetplan1:armhf (1.1.1-1) over (1.1-1) ... 1562s Preparing to unpack .../016-python3-newt_0.52.24-2ubuntu4_armhf.deb ... 1562s Unpacking python3-newt:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 1562s Preparing to unpack .../017-libnewt0.52_0.52.24-2ubuntu4_armhf.deb ... 1562s Unpacking libnewt0.52:armhf (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 1562s Preparing to unpack .../018-libpopt0_1.19+dfsg-2_armhf.deb ... 1562s Unpacking libpopt0:armhf (1.19+dfsg-2) over (1.19+dfsg-1build1) ... 1562s Preparing to unpack .../019-vim-tiny_2%3a9.1.0777-1ubuntu1_armhf.deb ... 1562s Unpacking vim-tiny (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 1562s Preparing to unpack .../020-vim-common_2%3a9.1.0777-1ubuntu1_all.deb ... 1562s Unpacking vim-common (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 1562s Preparing to unpack .../021-whiptail_0.52.24-2ubuntu4_armhf.deb ... 1562s Unpacking whiptail (0.52.24-2ubuntu4) over (0.52.24-2ubuntu3) ... 1562s Preparing to unpack .../022-xxd_2%3a9.1.0777-1ubuntu1_armhf.deb ... 1562s Unpacking xxd (2:9.1.0777-1ubuntu1) over (2:9.1.0496-1ubuntu6) ... 1562s Preparing to unpack .../023-bash-completion_1%3a2.14.0-2_all.deb ... 1562s Unpacking bash-completion (1:2.14.0-2) over (1:2.14.0-1) ... 1562s Preparing to unpack .../024-info_7.1.1-1_armhf.deb ... 1562s Unpacking info (7.1.1-1) over (7.1-3build2) ... 1562s Preparing to unpack .../025-libdrm-common_2.4.123-1_all.deb ... 1562s Unpacking libdrm-common (2.4.123-1) over (2.4.122-1) ... 1562s Preparing to unpack .../026-libdrm2_2.4.123-1_armhf.deb ... 1562s Unpacking libdrm2:armhf (2.4.123-1) over (2.4.122-1) ... 1562s Preparing to unpack .../027-libevdev2_1.13.3+dfsg-1_armhf.deb ... 1562s Unpacking libevdev2:armhf (1.13.3+dfsg-1) over (1.13.2+dfsg-1) ... 1562s Preparing to unpack .../028-libmaxminddb0_1.11.0-1_armhf.deb ... 1562s Unpacking libmaxminddb0:armhf (1.11.0-1) over (1.10.0-1) ... 1562s Preparing to unpack .../029-libnetfilter-conntrack3_1.1.0-1_armhf.deb ... 1562s Unpacking libnetfilter-conntrack3:armhf (1.1.0-1) over (1.0.9-6build1) ... 1562s Preparing to unpack .../030-libnghttp2-14_1.64.0-1_armhf.deb ... 1562s Unpacking libnghttp2-14:armhf (1.64.0-1) over (1.62.1-2) ... 1562s Preparing to unpack .../031-libpipeline1_1.5.8-1_armhf.deb ... 1562s Unpacking libpipeline1:armhf (1.5.8-1) over (1.5.7-2) ... 1562s Preparing to unpack .../032-libpng16-16t64_1.6.44-2_armhf.deb ... 1562s Unpacking libpng16-16t64:armhf (1.6.44-2) over (1.6.44-1) ... 1562s Preparing to unpack .../033-libplymouth5_24.004.60-1ubuntu11_armhf.deb ... 1562s Unpacking libplymouth5:armhf (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 1562s Preparing to unpack .../034-libtraceevent1-plugin_1%3a1.8.3-1ubuntu1_armhf.deb ... 1562s Unpacking libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 1562s Preparing to unpack .../035-libtraceevent1_1%3a1.8.3-1ubuntu1_armhf.deb ... 1562s Unpacking libtraceevent1:armhf (1:1.8.3-1ubuntu1) over (1:1.8.2-1ubuntu3) ... 1563s Preparing to unpack .../036-liburcu8t64_0.14.1-1_armhf.deb ... 1563s Unpacking liburcu8t64:armhf (0.14.1-1) over (0.14.0-4) ... 1563s Preparing to unpack .../037-libuv1t64_1.48.0-7_armhf.deb ... 1563s Unpacking libuv1t64:armhf (1.48.0-7) over (1.48.0-5) ... 1563s Preparing to unpack .../038-libx11-data_2%3a1.8.10-2_all.deb ... 1563s Unpacking libx11-data (2:1.8.10-2) over (2:1.8.7-1build1) ... 1563s Preparing to unpack .../039-libx11-6_2%3a1.8.10-2_armhf.deb ... 1563s Unpacking libx11-6:armhf (2:1.8.10-2) over (2:1.8.7-1build1) ... 1563s Preparing to unpack .../040-libxau6_1%3a1.0.11-1_armhf.deb ... 1563s Unpacking libxau6:armhf (1:1.0.11-1) over (1:1.0.9-1build6) ... 1563s Preparing to unpack .../041-nano_8.2-1_armhf.deb ... 1563s Unpacking nano (8.2-1) over (8.1-1) ... 1563s Preparing to unpack .../042-pci.ids_0.0~2024.10.24-1_all.deb ... 1563s Unpacking pci.ids (0.0~2024.10.24-1) over (0.0~2024.09.12-1) ... 1563s Preparing to unpack .../043-plymouth-theme-ubuntu-text_24.004.60-1ubuntu11_armhf.deb ... 1563s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 1563s Preparing to unpack .../044-plymouth_24.004.60-1ubuntu11_armhf.deb ... 1563s Unpacking plymouth (24.004.60-1ubuntu11) over (24.004.60-1ubuntu10) ... 1563s Preparing to unpack .../045-python3.12-gdbm_3.12.7-3_armhf.deb ... 1563s Unpacking python3.12-gdbm (3.12.7-3) over (3.12.7-1) ... 1563s Selecting previously unselected package python3.13-gdbm. 1563s Preparing to unpack .../046-python3.13-gdbm_3.13.0-2_armhf.deb ... 1563s Unpacking python3.13-gdbm (3.13.0-2) ... 1563s Preparing to unpack .../047-python3-gdbm_3.12.7-1_armhf.deb ... 1563s Unpacking python3-gdbm:armhf (3.12.7-1) over (3.12.6-1ubuntu1) ... 1563s Preparing to unpack .../048-ufw_0.36.2-8_all.deb ... 1563s Unpacking ufw (0.36.2-8) over (0.36.2-6) ... 1563s Preparing to unpack .../049-usbutils_1%3a018-1_armhf.deb ... 1563s Unpacking usbutils (1:018-1) over (1:017-3build1) ... 1563s Preparing to unpack .../050-dpkg-dev_1.22.11ubuntu3_all.deb ... 1563s Unpacking dpkg-dev (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 1563s Preparing to unpack .../051-libdpkg-perl_1.22.11ubuntu3_all.deb ... 1563s Unpacking libdpkg-perl (1.22.11ubuntu3) over (1.22.11ubuntu1) ... 1564s Preparing to unpack .../052-libarchive13t64_3.7.4-1.1_armhf.deb ... 1564s Unpacking libarchive13t64:armhf (3.7.4-1.1) over (3.7.4-1) ... 1564s Preparing to unpack .../053-libftdi1-2_1.5-7_armhf.deb ... 1564s Unpacking libftdi1-2:armhf (1.5-7) over (1.5-6build5) ... 1564s Preparing to unpack .../054-libflashrom1_1.4.0-3ubuntu1_armhf.deb ... 1564s Unpacking libflashrom1:armhf (1.4.0-3ubuntu1) over (1.3.0-2.1ubuntu2) ... 1564s Preparing to unpack .../055-libjson-glib-1.0-common_1.10.0+ds-3_all.deb ... 1564s Unpacking libjson-glib-1.0-common (1.10.0+ds-3) over (1.8.0-2build2) ... 1564s Preparing to unpack .../056-libjson-glib-1.0-0_1.10.0+ds-3_armhf.deb ... 1564s Unpacking libjson-glib-1.0-0:armhf (1.10.0+ds-3) over (1.8.0-2build2) ... 1564s Preparing to unpack .../057-libfwupd2_1.9.26-2_armhf.deb ... 1564s Unpacking libfwupd2:armhf (1.9.26-2) over (1.9.24-1) ... 1564s Preparing to unpack .../058-libxmlb2_0.3.21-1_armhf.deb ... 1564s Unpacking libxmlb2:armhf (0.3.21-1) over (0.3.19-1) ... 1564s Preparing to unpack .../059-fwupd_1.9.26-2_armhf.deb ... 1564s Unpacking fwupd (1.9.26-2) over (1.9.24-1) ... 1564s Preparing to unpack .../060-libblockdev-utils3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-utils3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../061-libblockdev-crypto3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-crypto3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../062-libblockdev-fs3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-fs3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../063-libblockdev-loop3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-loop3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../064-libbytesize1_2.11-1ubuntu1_armhf.deb ... 1564s Unpacking libbytesize1:armhf (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 1564s Preparing to unpack .../065-libbytesize-common_2.11-1ubuntu1_all.deb ... 1564s Unpacking libbytesize-common (2.11-1ubuntu1) over (2.10-1ubuntu2) ... 1564s Preparing to unpack .../066-libblockdev-mdraid3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-mdraid3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../067-libnvme1t64_1.11-1_armhf.deb ... 1564s Unpacking libnvme1t64 (1.11-1) over (1.10-1) ... 1564s Preparing to unpack .../068-libblockdev-nvme3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-nvme3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../069-libblockdev-part3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-part3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../070-libblockdev-swap3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev-swap3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../071-libblockdev3_3.2.1-1_armhf.deb ... 1564s Unpacking libblockdev3:armhf (3.2.1-1) over (3.1.1-2) ... 1564s Preparing to unpack .../072-libgpgme11t64_1.23.2-5ubuntu4_armhf.deb ... 1564s Unpacking libgpgme11t64:armhf (1.23.2-5ubuntu4) over (1.18.0-4.1ubuntu4) ... 1564s Preparing to unpack .../073-libinih1_58-1ubuntu1_armhf.deb ... 1564s Unpacking libinih1:armhf (58-1ubuntu1) over (55-1ubuntu2) ... 1565s Preparing to unpack .../074-libldap-common_2.6.8+dfsg-1~exp4ubuntu3_all.deb ... 1565s Unpacking libldap-common (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 1565s Preparing to unpack .../075-libldap2_2.6.8+dfsg-1~exp4ubuntu3_armhf.deb ... 1565s Unpacking libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) over (2.6.8+dfsg-1~exp4ubuntu1) ... 1565s Preparing to unpack .../076-libnspr4_2%3a4.35-1.1ubuntu2_armhf.deb ... 1565s Unpacking libnspr4:armhf (2:4.35-1.1ubuntu2) over (2:4.35-1.1ubuntu1) ... 1565s Preparing to unpack .../077-libsgutils2-1.46-2_1.46-3ubuntu5_armhf.deb ... 1565s Unpacking libsgutils2-1.46-2:armhf (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 1565s Preparing to unpack .../078-libssh2-1t64_1.11.1-1_armhf.deb ... 1565s Unpacking libssh2-1t64:armhf (1.11.1-1) over (1.11.0-7) ... 1565s Preparing to unpack .../079-udisks2_2.10.1-11ubuntu1_armhf.deb ... 1565s Unpacking udisks2 (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 1565s Preparing to unpack .../080-libudisks2-0_2.10.1-11ubuntu1_armhf.deb ... 1565s Unpacking libudisks2-0:armhf (2.10.1-11ubuntu1) over (2.10.1-9ubuntu2) ... 1565s Preparing to unpack .../081-libutempter0_1.2.1-4_armhf.deb ... 1565s Unpacking libutempter0:armhf (1.2.1-4) over (1.2.1-3build1) ... 1565s Preparing to unpack .../082-python3-certifi_2024.8.30+dfsg-1_all.deb ... 1565s Unpacking python3-certifi (2024.8.30+dfsg-1) over (2024.6.2-1) ... 1565s Preparing to unpack .../083-python3-configobj_5.0.9-1_all.deb ... 1565s Unpacking python3-configobj (5.0.9-1) over (5.0.8-3) ... 1565s Preparing to unpack .../084-python3-idna_3.8-2_all.deb ... 1565s Unpacking python3-idna (3.8-2) over (3.6-2.1) ... 1565s Preparing to unpack .../085-python3-more-itertools_10.5.0-1_all.deb ... 1565s Unpacking python3-more-itertools (10.5.0-1) over (10.3.0-1) ... 1565s Preparing to unpack .../086-python3-jaraco.functools_4.1.0-1_all.deb ... 1565s Unpacking python3-jaraco.functools (4.1.0-1) over (4.0.2-1) ... 1565s Selecting previously unselected package python3-jaraco.text. 1565s Preparing to unpack .../087-python3-jaraco.text_4.0.0-1_all.deb ... 1565s Unpacking python3-jaraco.text (4.0.0-1) ... 1565s Preparing to unpack .../088-python3-json-pointer_2.4-2_all.deb ... 1565s Unpacking python3-json-pointer (2.4-2) over (2.0-0ubuntu1) ... 1565s Preparing to unpack .../089-python3-jsonpatch_1.32-4_all.deb ... 1566s Unpacking python3-jsonpatch (1.32-4) over (1.32-3) ... 1566s Preparing to unpack .../090-python3-typeguard_4.4.1-1_all.deb ... 1566s Unpacking python3-typeguard (4.4.1-1) over (4.3.0-1) ... 1566s Preparing to unpack .../091-python3-zipp_3.21.0-1_all.deb ... 1566s Unpacking python3-zipp (3.21.0-1) over (3.20.0-1) ... 1566s Preparing to unpack .../092-python3-pkg-resources_75.2.0-1_all.deb ... 1566s Unpacking python3-pkg-resources (75.2.0-1) over (74.1.2-1) ... 1566s Preparing to unpack .../093-python3-setuptools_75.2.0-1_all.deb ... 1566s Unpacking python3-setuptools (75.2.0-1) over (74.1.2-1) ... 1566s Preparing to unpack .../094-python3-lazr.uri_1.0.6-4_all.deb ... 1566s Unpacking python3-lazr.uri (1.0.6-4) over (1.0.6-3) ... 1566s Preparing to unpack .../095-python3-wadllib_2.0.0-1_all.deb ... 1566s Unpacking python3-wadllib (2.0.0-1) over (1.3.6-5) ... 1566s Preparing to unpack .../096-python3-oauthlib_3.2.2-2_all.deb ... 1566s Unpacking python3-oauthlib (3.2.2-2) over (3.2.2-1) ... 1567s Preparing to unpack .../097-python3-lazr.restfulclient_0.14.6-2_all.deb ... 1567s Unpacking python3-lazr.restfulclient (0.14.6-2) over (0.14.6-1) ... 1567s Preparing to unpack .../098-python3-urllib3_2.0.7-2ubuntu0.1_all.deb ... 1567s Unpacking python3-urllib3 (2.0.7-2ubuntu0.1) over (2.0.7-2) ... 1567s Preparing to unpack .../099-sg3-utils_1.46-3ubuntu5_armhf.deb ... 1567s Unpacking sg3-utils (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 1567s Preparing to unpack .../100-sg3-utils-udev_1.46-3ubuntu5_all.deb ... 1567s Unpacking sg3-utils-udev (1.46-3ubuntu5) over (1.46-3ubuntu4) ... 1567s Selecting previously unselected package systemd-cryptsetup. 1567s Preparing to unpack .../101-systemd-cryptsetup_256.5-2ubuntu4_armhf.deb ... 1567s Unpacking systemd-cryptsetup (256.5-2ubuntu4) ... 1567s Preparing to unpack .../102-ssh-import-id_5.11-0ubuntu3_all.deb ... 1567s Unpacking ssh-import-id (5.11-0ubuntu3) over (5.11-0ubuntu2) ... 1567s Setting up libpipeline1:armhf (1.5.8-1) ... 1567s Setting up motd-news-config (13.5ubuntu3) ... 1567s Setting up libtext-iconv-perl:armhf (1.7-8build4) ... 1567s Setting up libtext-charwidth-perl:armhf (0.04-11build4) ... 1567s Setting up liburcu8t64:armhf (0.14.1-1) ... 1567s Setting up libxau6:armhf (1:1.0.11-1) ... 1567s Setting up libkeyutils1:armhf (1.6.3-4ubuntu2) ... 1567s Setting up pci.ids (0.0~2024.10.24-1) ... 1567s Setting up libnewt0.52:armhf (0.52.24-2ubuntu4) ... 1567s Setting up distro-info-data (0.63) ... 1567s Setting up libfastjson4:armhf (1.2304.0-2) ... 1567s Setting up libinih1:armhf (58-1ubuntu1) ... 1567s Setting up libmaxminddb0:armhf (1.11.0-1) ... 1567s Setting up python3.12-gdbm (3.12.7-3) ... 1567s Setting up libxmlb2:armhf (0.3.21-1) ... 1567s Setting up libedit2:armhf (3.1-20240808-1) ... 1567s Setting up libuv1t64:armhf (1.48.0-7) ... 1567s Setting up libpython3.12-minimal:armhf (3.12.7-3) ... 1567s Setting up libnghttp2-14:armhf (1.64.0-1) ... 1567s Setting up libsgutils2-1.46-2:armhf (1.46-3ubuntu5) ... 1567s Setting up libnetplan1:armhf (1.1.1-1) ... 1567s Setting up libldap-common (2.6.8+dfsg-1~exp4ubuntu3) ... 1567s Setting up usbutils (1:018-1) ... 1567s Setting up xxd (2:9.1.0777-1ubuntu1) ... 1567s Setting up libelf1t64:armhf (0.192-4) ... 1567s Setting up libdw1t64:armhf (0.192-4) ... 1567s Setting up tzdata (2024b-1ubuntu2) ... 1567s 1567s Current default time zone: 'Etc/UTC' 1567s Local time is now: Wed Nov 13 23:17:12 UTC 2024. 1567s Universal Time is now: Wed Nov 13 23:17:12 UTC 2024. 1567s Run 'dpkg-reconfigure tzdata' if you wish to change it. 1567s 1567s Setting up libftdi1-2:armhf (1.5-7) ... 1567s Setting up libflashrom1:armhf (1.4.0-3ubuntu1) ... 1567s Setting up vim-common (2:9.1.0777-1ubuntu1) ... 1567s Installing new version of config file /etc/vim/vimrc ... 1567s Setting up libx11-data (2:1.8.10-2) ... 1567s Setting up libnspr4:armhf (2:4.35-1.1ubuntu2) ... 1567s Setting up bash-completion (1:2.14.0-2) ... 1567s Setting up libbytesize-common (2.11-1ubuntu1) ... 1567s Setting up libblockdev-utils3:armhf (3.2.1-1) ... 1567s Setting up libpng16-16t64:armhf (1.6.44-2) ... 1567s Setting up libmnl0:armhf (1.0.5-3) ... 1567s Setting up libatomic1:armhf (14.2.0-8ubuntu1) ... 1567s Setting up libsystemd-shared:armhf (256.5-2ubuntu4) ... 1567s Setting up dhcpcd-base (1:10.1.0-2) ... 1567s Setting up libutempter0:armhf (1.2.1-4) ... 1567s Setting up nano (8.2-1) ... 1567s Setting up libblockdev-fs3:armhf (3.2.1-1) ... 1567s Setting up perl-modules-5.40 (5.40.0-7) ... 1567s Setting up libnetfilter-conntrack3:armhf (1.1.0-1) ... 1567s Setting up libtraceevent1:armhf (1:1.8.3-1ubuntu1) ... 1567s Setting up libx11-6:armhf (2:1.8.10-2) ... 1567s Setting up libjson-glib-1.0-common (1.10.0+ds-3) ... 1567s Setting up mawk (1.3.4.20240905-1) ... 1567s Setting up libbytesize1:armhf (2.11-1ubuntu1) ... 1567s Setting up libgpgme11t64:armhf (1.23.2-5ubuntu4) ... 1567s Setting up libssh2-1t64:armhf (1.11.1-1) ... 1567s Setting up libdrm-common (2.4.123-1) ... 1567s Setting up libarchive13t64:armhf (3.7.4-1.1) ... 1567s Setting up libjson-c5:armhf (0.18+ds-1) ... 1567s Setting up libevdev2:armhf (1.13.3+dfsg-1) ... 1567s Setting up libldap2:armhf (2.6.8+dfsg-1~exp4ubuntu3) ... 1567s Setting up info (7.1.1-1) ... 1567s Setting up liblocale-gettext-perl (1.07-7build1) ... 1567s Setting up libbpf1:armhf (1:1.5.0-1) ... 1567s Setting up libudisks2-0:armhf (2.10.1-11ubuntu1) ... 1567s Setting up python3.13-gdbm (3.13.0-2) ... 1567s Setting up libpopt0:armhf (1.19+dfsg-2) ... 1567s Setting up sg3-utils (1.46-3ubuntu5) ... 1567s Setting up python3.12-minimal (3.12.7-3) ... 1568s Setting up libpython3.12-stdlib:armhf (3.12.7-3) ... 1568s Setting up libblockdev-mdraid3:armhf (3.2.1-1) ... 1568s Setting up libblockdev-crypto3:armhf (3.2.1-1) ... 1568s Setting up libblockdev-swap3:armhf (3.2.1-1) ... 1568s Setting up iproute2 (6.10.0-2ubuntu1) ... 1568s Setting up openssh-client (1:9.7p1-7ubuntu5) ... 1568s Setting up python3.12 (3.12.7-3) ... 1570s Setting up libblockdev-loop3:armhf (3.2.1-1) ... 1570s Setting up systemd (256.5-2ubuntu4) ... 1570s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 1570s Created symlink '/run/systemd/system/tmp.mount' → '/dev/null'. 1570s /usr/lib/tmpfiles.d/legacy.conf:13: Duplicate line for path "/run/lock", ignoring. 1570s Setting up vim-tiny (2:9.1.0777-1ubuntu1) ... 1570s Setting up libblockdev3:armhf (3.2.1-1) ... 1570s Installing new version of config file /etc/libblockdev/3/conf.d/00-default.cfg ... 1570s Setting up libjson-glib-1.0-0:armhf (1.10.0+ds-3) ... 1570s Setting up libblockdev-part3:armhf (3.2.1-1) ... 1570s Setting up sg3-utils-udev (1.46-3ubuntu5) ... 1570s update-initramfs: deferring update (trigger activated) 1570s Setting up libperl5.40:armhf (5.40.0-7) ... 1570s Setting up perl (5.40.0-7) ... 1570s Setting up systemd-cryptsetup (256.5-2ubuntu4) ... 1570s Setting up libnvme1t64 (1.11-1) ... 1570s Setting up systemd-timesyncd (256.5-2ubuntu4) ... 1571s systemd-time-wait-sync.service is a disabled or a static unit not running, not starting it. 1571s Setting up udev (256.5-2ubuntu4) ... 1572s Setting up libdpkg-perl (1.22.11ubuntu3) ... 1572s Setting up libblockdev-nvme3:armhf (3.2.1-1) ... 1572s Setting up libdrm2:armhf (2.4.123-1) ... 1572s Setting up whiptail (0.52.24-2ubuntu4) ... 1572s Setting up libtraceevent1-plugin:armhf (1:1.8.3-1ubuntu1) ... 1572s Setting up libplymouth5:armhf (24.004.60-1ubuntu11) ... 1572s Setting up netplan-generator (1.1.1-1) ... 1572s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 1572s Setting up libpython3-stdlib:armhf (3.12.7-1) ... 1572s Setting up systemd-resolved (256.5-2ubuntu4) ... 1572s Setting up openssh-sftp-server (1:9.7p1-7ubuntu5) ... 1572s Setting up udisks2 (2.10.1-11ubuntu1) ... 1572s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 1572s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 1572s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 1572s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 1572s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 1572s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 1572s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 1572s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 1572s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 1572s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 1572s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 1572s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 1572s loop8: Failed to write 'change' to '/sys/devices/virtual/block/loop8/uevent': Permission denied 1573s Setting up systemd-sysv (256.5-2ubuntu4) ... 1573s Setting up openssh-server (1:9.7p1-7ubuntu5) ... 1574s Setting up plymouth (24.004.60-1ubuntu11) ... 1574s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 1575s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 1575s Setting up libfwupd2:armhf (1.9.26-2) ... 1575s Setting up libnss-systemd:armhf (256.5-2ubuntu4) ... 1575s Setting up python3 (3.12.7-1) ... 1575s Setting up python3-zipp (3.21.0-1) ... 1575s Setting up python3-newt:armhf (0.52.24-2ubuntu4) ... 1575s Setting up dpkg-dev (1.22.11ubuntu3) ... 1575s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu11) ... 1575s update-initramfs: deferring update (trigger activated) 1575s Setting up python3-oauthlib (3.2.2-2) ... 1576s Setting up python3-configobj (5.0.9-1) ... 1576s Setting up python3-certifi (2024.8.30+dfsg-1) ... 1576s Setting up python3-gi (3.50.0-3) ... 1576s Setting up python3-idna (3.8-2) ... 1577s Setting up python3-urllib3 (2.0.7-2ubuntu0.1) ... 1577s Setting up python3-json-pointer (2.4-2) ... 1577s Setting up libpam-systemd:armhf (256.5-2ubuntu4) ... 1577s Setting up fwupd (1.9.26-2) ... 1578s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 1578s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 1578s fwupd.service is a disabled or a static unit not running, not starting it. 1578s Setting up python3-cffi-backend:armhf (1.17.1-2) ... 1578s Setting up python3-more-itertools (10.5.0-1) ... 1578s Setting up python3-jaraco.functools (4.1.0-1) ... 1578s Setting up python3-gdbm:armhf (3.12.7-1) ... 1578s Setting up python3-problem-report (2.30.0-0ubuntu5) ... 1578s Setting up ssh-import-id (5.11-0ubuntu3) ... 1579s Setting up python3-jsonpatch (1.32-4) ... 1579s Setting up python3-typeguard (4.4.1-1) ... 1579s Setting up ufw (0.36.2-8) ... 1580s Setting up python3-apport (2.30.0-0ubuntu5) ... 1580s Setting up python3-jaraco.text (4.0.0-1) ... 1580s Setting up python3-netplan (1.1.1-1) ... 1581s Setting up python3-pkg-resources (75.2.0-1) ... 1581s Setting up python3-setuptools (75.2.0-1) ... 1582s Setting up python3-lazr.uri (1.0.6-4) ... 1582s Setting up netplan.io (1.1.1-1) ... 1582s Setting up python3-wadllib (2.0.0-1) ... 1582s Setting up python3-lazr.restfulclient (0.14.6-2) ... 1582s Setting up apport-core-dump-handler (2.30.0-0ubuntu5) ... 1583s Setting up apport (2.30.0-0ubuntu5) ... 1583s Installing new version of config file /etc/apport/crashdb.conf ... 1584s apport-autoreport.service is a disabled or a static unit not running, not starting it. 1584s Processing triggers for dbus (1.14.10-4ubuntu5) ... 1584s Processing triggers for shared-mime-info (2.4-5) ... 1584s Processing triggers for install-info (7.1.1-1) ... 1584s Processing triggers for initramfs-tools (0.142ubuntu34) ... 1584s Processing triggers for libc-bin (2.40-1ubuntu3) ... 1585s Processing triggers for rsyslog (8.2406.0-1ubuntu2) ... 1585s Processing triggers for man-db (2.12.1-3) ... 1585s Reading package lists... 1585s Building dependency tree... 1585s Reading state information... 1586s The following packages will be REMOVED: 1586s libperl5.38t64* perl-modules-5.38* python3-netifaces* 1586s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded. 1586s After this operation, 41.7 MB disk space will be freed. 1586s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 61516 files and directories currently installed.) 1586s Removing libperl5.38t64:armhf (5.38.2-5) ... 1586s Removing perl-modules-5.38 (5.38.2-5) ... 1586s Removing python3-netifaces:armhf (0.11.0-2build3) ... 1586s Processing triggers for man-db (2.12.1-3) ... 1587s Processing triggers for libc-bin (2.40-1ubuntu3) ... 1589s autopkgtest [23:17:34]: rebooting testbed after setup commands that affected boot 1692s Reading package lists... 1692s Building dependency tree... 1692s Reading state information... 1692s Starting pkgProblemResolver with broken count: 0 1692s Starting 2 pkgProblemResolver with broken count: 0 1692s Done 1693s The following additional packages will be installed: 1693s adwaita-icon-theme androguard apksigner at-spi2-common blt 1693s ca-certificates-java dconf-gsettings-backend dconf-service 1693s default-jdk-headless default-jre default-jre-headless fdroidserver 1693s fontconfig fontconfig-config fonts-dejavu-core fonts-dejavu-mono fonts-lyx 1693s git git-man graphviz gtk-update-icon-cache hicolor-icon-theme 1693s humanity-icon-theme java-common libaom3 libapksig-java libasound2-data 1693s libasound2t64 libatk-bridge2.0-0t64 libatk1.0-0t64 libatspi2.0-0t64 1693s libavahi-client3 libavahi-common-data libavahi-common3 libblas3 1693s libcairo-gobject2 libcairo2 libcdt5 libcgraph6 libcolord2 libcups2t64 1693s libdatrie1 libdconf1 libde265-0 libdeflate0 libdrm-amdgpu1 libdrm-radeon1 1693s libepoxy0 liberror-perl libfontconfig1 libfreetype6 libgbm1 libgd3 1693s libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1 1693s libgl1-mesa-dri libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 1693s libgraphite2-3 libgtk-3-0t64 libgtk-3-common libgts-0.7-5t64 libgvc6 1693s libgvpr2 libharfbuzz0b libheif-plugin-aomdec libheif-plugin-libde265 1693s libheif1 libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 1693s libjs-jquery libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 1693s liblerc4 libllvm19 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0 1693s libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0 libqhull-r8.0 1693s libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 1693s libtiff6 libtk8.6 libvulkan1 libwayland-client0 libwayland-cursor0 1693s libwayland-egl1 libwayland-server0 libwebp7 libwebpdemux2 libwebpmux3 1693s libx11-xcb1 libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 1693s libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 1693s libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 1693s libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 1693s libxss1 libxt6t64 libxtst6 libxxf86vm1 mesa-libgallium 1693s openjdk-21-jdk-headless openjdk-21-jre openjdk-21-jre-headless 1693s python-matplotlib-data python3-appdirs python3-args python3-asn1crypto 1693s python3-asttokens python3-bcrypt python3-biplist python3-brotli 1693s python3-click python3-clint python3-colorama python3-contourpy 1693s python3-cycler python3-dateutil python3-decorator python3-defusedxml 1693s python3-executing python3-fonttools python3-fs python3-git python3-gitdb 1693s python3-ipython python3-jedi python3-kiwisolver python3-looseversion 1693s python3-lxml python3-lz4 python3-magic python3-matplotlib 1693s python3-matplotlib-inline python3-mpmath python3-nacl python3-networkx 1693s python3-numpy python3-oscrypto python3-packaging python3-paramiko 1693s python3-parso python3-pathspec python3-pexpect python3-pil 1693s python3-pil.imagetk python3-platformdirs python3-png python3-prompt-toolkit 1693s python3-ptyprocess python3-pure-eval python3-pycountry python3-pydot 1693s python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy 1693s python3-six python3-smmap python3-stack-data python3-sympy python3-tk 1693s python3-traitlets python3-typeshed python3-tz python3-ufolib2 1693s python3-unicodedata2 python3-wcwidth python3.12-tk python3.13-tk s3cmd 1693s sdkmanager tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint 1693s Suggested packages: 1693s adwaita-icon-theme-legacy blt-demo gradle ipfs-cid vagrant vagrant-cachier 1693s vagrant-libvirt qemu-kvm git-daemon-run | git-daemon-sysvinit git-doc 1693s git-email git-gui gitk gitweb git-cvs git-mediawiki git-svn gsfonts 1693s graphviz-doc alsa-utils libasound2-plugins colord cups-common libgd-tools 1693s gvfs libheif-plugin-x265 libheif-plugin-ffmpegdec libheif-plugin-jpegdec 1693s libheif-plugin-jpegenc libheif-plugin-j2kdec libheif-plugin-j2kenc 1693s libheif-plugin-kvazaar libheif-plugin-rav1e libheif-plugin-svtenc 1693s libjs-jquery-ui-docs liblcms2-utils pcscd tcl8.6 tk8.6 openjdk-21-demo 1693s openjdk-21-source libnss-mdns fonts-dejavu-extra fonts-ipafont-gothic 1693s fonts-ipafont-mincho fonts-wqy-microhei | fonts-wqy-zenhei fonts-indic 1693s python-cycler-doc python-git-doc python-ipython-doc python-lxml-doc 1693s cm-super-minimal dvipng ffmpeg fonts-staypuft ghostscript gir1.2-gtk-3.0 1693s inkscape ipython3 librsvg2-common python-matplotlib-doc python3-cairocffi 1693s python3-gi-cairo python3-gobject python3-pyqt5 python3-sip python3-tornado 1693s texlive-extra-utils texlive-latex-extra python-mpmath-doc python3-gmpy2 1693s python-nacl-doc python3-gdal python3-pygraphviz gcc gfortran 1693s python-numpy-doc python3-dev python3-pytest python3-gssapi python3-invoke 1693s python-pexpect-doc python-pil-doc python-scipy-doc texlive-fonts-extra 1693s python-sympy-doc tix python3-tk-dbg python-traitlets-doc 1693s Recommended packages: 1693s librsvg2-common python3-pyperclip python3-pyqt5 android-sdk dexdump opensc 1693s fonts-liberation alsa-ucm-conf alsa-topology-conf at-spi2-core 1693s libgdk-pixbuf2.0-bin libgl1-amber-dri libgtk-3-bin libgts-bin 1693s libheif-plugin-aomenc javascript-common mesa-vulkan-drivers | vulkan-icd 1693s libatk-wrapper-java-jni fonts-dejavu-extra python3-bs4 python3-cssselect 1693s python3-html5lib python3-olefile g++ | c++-compiler isympy-common 1693s python3-argcomplete 1693s The following NEW packages will be installed: 1693s adwaita-icon-theme androguard apksigner at-spi2-common autopkgtest-satdep 1693s blt ca-certificates-java dconf-gsettings-backend dconf-service 1693s default-jdk-headless default-jre default-jre-headless fdroidserver 1693s fontconfig fontconfig-config fonts-dejavu-core fonts-dejavu-mono fonts-lyx 1693s git git-man graphviz gtk-update-icon-cache hicolor-icon-theme 1693s humanity-icon-theme java-common libaom3 libapksig-java libasound2-data 1693s libasound2t64 libatk-bridge2.0-0t64 libatk1.0-0t64 libatspi2.0-0t64 1693s libavahi-client3 libavahi-common-data libavahi-common3 libblas3 1693s libcairo-gobject2 libcairo2 libcdt5 libcgraph6 libcolord2 libcups2t64 1693s libdatrie1 libdconf1 libde265-0 libdeflate0 libdrm-amdgpu1 libdrm-radeon1 1693s libepoxy0 liberror-perl libfontconfig1 libfreetype6 libgbm1 libgd3 1693s libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1 1693s libgl1-mesa-dri libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 1693s libgraphite2-3 libgtk-3-0t64 libgtk-3-common libgts-0.7-5t64 libgvc6 1693s libgvpr2 libharfbuzz0b libheif-plugin-aomdec libheif-plugin-libde265 1693s libheif1 libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 1693s libjs-jquery libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 1693s liblerc4 libllvm19 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0 1693s libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0 libqhull-r8.0 1693s libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 1693s libtiff6 libtk8.6 libvulkan1 libwayland-client0 libwayland-cursor0 1693s libwayland-egl1 libwayland-server0 libwebp7 libwebpdemux2 libwebpmux3 1693s libx11-xcb1 libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 1693s libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 1693s libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 1693s libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 1693s libxss1 libxt6t64 libxtst6 libxxf86vm1 mesa-libgallium 1693s openjdk-21-jdk-headless openjdk-21-jre openjdk-21-jre-headless 1693s python-matplotlib-data python3-appdirs python3-args python3-asn1crypto 1693s python3-asttokens python3-bcrypt python3-biplist python3-brotli 1693s python3-click python3-clint python3-colorama python3-contourpy 1693s python3-cycler python3-dateutil python3-decorator python3-defusedxml 1693s python3-executing python3-fonttools python3-fs python3-git python3-gitdb 1693s python3-ipython python3-jedi python3-kiwisolver python3-looseversion 1693s python3-lxml python3-lz4 python3-magic python3-matplotlib 1693s python3-matplotlib-inline python3-mpmath python3-nacl python3-networkx 1693s python3-numpy python3-oscrypto python3-packaging python3-paramiko 1693s python3-parso python3-pathspec python3-pexpect python3-pil 1693s python3-pil.imagetk python3-platformdirs python3-png python3-prompt-toolkit 1693s python3-ptyprocess python3-pure-eval python3-pycountry python3-pydot 1693s python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy 1693s python3-six python3-smmap python3-stack-data python3-sympy python3-tk 1693s python3-traitlets python3-typeshed python3-tz python3-ufolib2 1693s python3-unicodedata2 python3-wcwidth python3.12-tk python3.13-tk s3cmd 1693s sdkmanager tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint 1693s 0 upgraded, 219 newly installed, 0 to remove and 0 not upgraded. 1693s Need to get 285 MB/285 MB of archives. 1693s After this operation, 909 MB of additional disk space will be used. 1693s Get:1 /tmp/autopkgtest.BGvKMW/2-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [704 B] 1694s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf libgdk-pixbuf2.0-common all 2.42.12+dfsg-1 [7888 B] 1694s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf libjpeg-turbo8 armhf 2.1.5-2ubuntu2 [125 kB] 1694s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf libjpeg8 armhf 8c-2ubuntu11 [2148 B] 1694s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libdeflate0 armhf 1.22-1 [38.9 kB] 1694s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf libjbig0 armhf 2.1-6.1ubuntu2 [24.9 kB] 1694s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf liblerc4 armhf 4.0.0+ds-4ubuntu2 [151 kB] 1694s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf libsharpyuv0 armhf 1.4.0-0.1 [16.3 kB] 1694s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf libwebp7 armhf 1.4.0-0.1 [184 kB] 1694s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf libtiff6 armhf 4.5.1+git230720-4ubuntu4 [179 kB] 1694s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf libgdk-pixbuf-2.0-0 armhf 2.42.12+dfsg-1 [135 kB] 1694s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf gtk-update-icon-cache armhf 4.16.5+ds-1 [50.6 kB] 1694s Get:13 http://ftpmaster.internal/ubuntu plucky/main armhf hicolor-icon-theme all 0.18-1 [13.5 kB] 1694s Get:14 http://ftpmaster.internal/ubuntu plucky/main armhf humanity-icon-theme all 0.6.16 [1282 kB] 1694s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf ubuntu-mono all 24.04-0ubuntu1 [151 kB] 1694s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf adwaita-icon-theme all 47.0-2 [525 kB] 1694s Get:17 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-asn1crypto all 1.5.1-3 [79.7 kB] 1694s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf python3-colorama all 0.4.6-4 [32.1 kB] 1694s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf python3-click all 8.1.7-2 [79.5 kB] 1694s Get:20 http://ftpmaster.internal/ubuntu plucky/main armhf python3-decorator all 5.1.1-5 [10.1 kB] 1694s Get:21 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-parso all 0.8.3-1 [67.2 kB] 1694s Get:22 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-typeshed all 0.0~git20231111.6764465-3 [1274 kB] 1694s Get:23 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-jedi all 0.19.1+ds1-1 [693 kB] 1694s Get:24 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-traitlets all 5.14.3+really5.14.3-1 [71.5 kB] 1694s Get:25 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-matplotlib-inline all 0.1.6-2 [8784 B] 1694s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf python3-ptyprocess all 0.7.0-6 [14.8 kB] 1694s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf python3-pexpect all 4.9-2 [48.1 kB] 1694s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wcwidth all 0.2.13+dfsg1-1 [26.3 kB] 1694s Get:29 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-prompt-toolkit all 3.0.48-1 [256 kB] 1694s Get:30 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-asttokens all 2.4.1-2 [20.8 kB] 1694s Get:31 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-executing all 2.1.0-0.1 [24.4 kB] 1694s Get:32 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pure-eval all 0.2.3-1 [11.4 kB] 1694s Get:33 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-stack-data all 0.6.3-1 [22.0 kB] 1694s Get:34 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ipython all 8.20.0-1ubuntu1 [561 kB] 1694s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf libxslt1.1 armhf 1.1.39-0exp1ubuntu1 [150 kB] 1694s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lxml armhf 5.3.0-1 [1234 kB] 1695s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf python3-magic all 2:0.4.27-3 [13.4 kB] 1695s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [328 kB] 1695s Get:39 http://ftpmaster.internal/ubuntu plucky/universe armhf libjs-jquery-ui all 1.13.2+dfsg-1 [252 kB] 1695s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf fonts-dejavu-mono all 2.37-8 [502 kB] 1695s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf fonts-dejavu-core all 2.37-8 [835 kB] 1695s Get:42 http://ftpmaster.internal/ubuntu plucky/universe armhf fonts-lyx all 2.4.2.1-1 [171 kB] 1695s Get:43 http://ftpmaster.internal/ubuntu plucky/universe armhf python-matplotlib-data all 3.8.3-3 [2928 kB] 1695s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf python3-six all 1.16.0-7 [13.1 kB] 1695s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf python3-dateutil all 2.9.0-2 [80.3 kB] 1695s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf libfreetype6 armhf 2.13.3+dfsg-1 [330 kB] 1695s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf libgomp1 armhf 14.2.0-8ubuntu1 [125 kB] 1695s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf libimagequant0 armhf 2.18.0-1build1 [31.1 kB] 1695s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf liblcms2-2 armhf 2.16-2 [137 kB] 1695s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf libopenjp2-7 armhf 2.5.0-2ubuntu1 [170 kB] 1695s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf libgraphite2-3 armhf 1.3.14-2ubuntu1 [64.8 kB] 1695s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf libharfbuzz0b armhf 10.0.1-1 [463 kB] 1695s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libraqm0 armhf 0.10.1-1build1 [12.4 kB] 1695s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libwebpdemux2 armhf 1.4.0-0.1 [11.8 kB] 1695s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf libwebpmux3 armhf 1.4.0-0.1 [22.5 kB] 1695s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf python3-pil armhf 10.4.0-1ubuntu1 [428 kB] 1695s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libtcl8.6 armhf 8.6.15+dfsg-2 [909 kB] 1695s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf fontconfig-config armhf 2.15.0-1.1ubuntu2 [37.4 kB] 1695s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf libfontconfig1 armhf 2.15.0-1.1ubuntu2 [113 kB] 1695s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf libxrender1 armhf 1:0.9.10-1.1build1 [16.0 kB] 1695s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf libxft2 armhf 2.3.6-1build1 [37.4 kB] 1695s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf x11-common all 1:7.7+23ubuntu3 [21.7 kB] 1695s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libxss1 armhf 1:1.2.3-1build3 [6500 B] 1695s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf libtk8.6 armhf 8.6.15-1 [685 kB] 1695s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-tk armhf 3.12.7-3 [112 kB] 1695s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-tk armhf 3.13.0-2 [103 kB] 1695s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf tk8.6-blt2.5 armhf 2.5.3+dfsg-7build1 [525 kB] 1695s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf blt armhf 2.5.3+dfsg-7build1 [4840 B] 1695s Get:69 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf python3-tk armhf 3.12.7-1 [9752 B] 1695s Get:70 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pil.imagetk armhf 10.4.0-1ubuntu1 [8848 B] 1695s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf libblas3 armhf 3.12.0-3build2 [126 kB] 1695s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf libgfortran5 armhf 14.2.0-8ubuntu1 [311 kB] 1695s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf liblapack3 armhf 3.12.0-3build2 [2086 kB] 1695s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf python3-numpy armhf 1:1.26.4+ds-11build1 [3570 kB] 1695s Get:75 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-contourpy armhf 1.3.0-2 [192 kB] 1695s Get:76 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-cycler all 0.12.1-1 [9716 B] 1695s Get:77 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-brotli armhf 1.1.0-2build2 [321 kB] 1695s Get:78 http://ftpmaster.internal/ubuntu plucky/universe armhf liblbfgsb0 armhf 3.0+dfsg.4-1build1 [27.4 kB] 1695s Get:79 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-scipy armhf 1.13.1-5 [16.4 MB] 1696s Get:80 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ufolib2 all 0.16.1+dfsg1-1 [33.4 kB] 1696s Get:81 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-mpmath all 1.3.0-1 [425 kB] 1696s Get:82 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-sympy all 1.13.3-1 [4228 kB] 1697s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf python3-tz all 2024.1-2 [31.4 kB] 1697s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf python3-appdirs all 1.4.4-4 [10.9 kB] 1697s Get:85 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-fs all 2.4.16-4 [91.3 kB] 1697s Get:86 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-lz4 armhf 4.0.2+dfsg-1build4 [24.8 kB] 1697s Get:87 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-unicodedata2 armhf 15.1.0+ds-1build1 [361 kB] 1697s Get:88 http://ftpmaster.internal/ubuntu plucky/universe armhf unicode-data all 15.1.0-1 [8878 kB] 1697s Get:89 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-fonttools armhf 4.46.0-1build2 [1402 kB] 1697s Get:90 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-kiwisolver armhf 1.4.7-2 [57.0 kB] 1697s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf python3-packaging all 24.1-1 [41.4 kB] 1697s Get:92 http://ftpmaster.internal/ubuntu plucky/universe armhf libqhull-r8.0 armhf 2020.2-6build1 [173 kB] 1697s Get:93 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-matplotlib armhf 3.8.3-3 [4500 kB] 1698s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf python3-networkx all 3.2.1-4ubuntu1 [11.5 MB] 1698s Get:95 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-oscrypto all 1.3.0-7 [128 kB] 1698s Get:96 http://ftpmaster.internal/ubuntu plucky/universe armhf libcdt5 armhf 2.42.4-2build3 [19.4 kB] 1698s Get:97 http://ftpmaster.internal/ubuntu plucky/universe armhf libcgraph6 armhf 2.42.4-2build3 [37.6 kB] 1698s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf libaom3 armhf 3.11.0~rc1-1 [1762 kB] 1698s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libheif-plugin-aomdec armhf 1.18.1-2 [10.6 kB] 1698s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libde265-0 armhf 1.0.15-1build4 [157 kB] 1698s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libheif-plugin-libde265 armhf 1.18.1-2 [11.1 kB] 1698s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libheif1 armhf 1.18.1-2 [288 kB] 1699s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libxpm4 armhf 1:3.5.17-1build2 [30.1 kB] 1699s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf libgd3 armhf 2.3.3-12ubuntu3 [108 kB] 1699s Get:105 http://ftpmaster.internal/ubuntu plucky/universe armhf libgts-0.7-5t64 armhf 0.7.6+darcs121130-5.2build1 [139 kB] 1699s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf libpixman-1-0 armhf 0.44.0-3 [183 kB] 1699s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-render0 armhf 1.17.0-2 [15.3 kB] 1699s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-shm0 armhf 1.17.0-2 [5774 B] 1699s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf libcairo2 armhf 1.18.2-2 [484 kB] 1699s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libltdl7 armhf 2.4.7-7build1 [37.6 kB] 1699s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf fontconfig armhf 2.15.0-1.1ubuntu2 [189 kB] 1699s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf libthai-data all 0.1.29-2build1 [158 kB] 1699s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf libdatrie1 armhf 0.2.13-3build1 [15.7 kB] 1699s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libthai0 armhf 0.1.29-2build1 [15.2 kB] 1699s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf libpango-1.0-0 armhf 1.54.0+ds-3 [212 kB] 1699s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libpangoft2-1.0-0 armhf 1.54.0+ds-3 [42.9 kB] 1699s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libpangocairo-1.0-0 armhf 1.54.0+ds-3 [24.8 kB] 1699s Get:118 http://ftpmaster.internal/ubuntu plucky/universe armhf libpathplan4 armhf 2.42.4-2build3 [21.7 kB] 1699s Get:119 http://ftpmaster.internal/ubuntu plucky/universe armhf libgvc6 armhf 2.42.4-2build3 [621 kB] 1699s Get:120 http://ftpmaster.internal/ubuntu plucky/universe armhf libgvpr2 armhf 2.42.4-2build3 [161 kB] 1699s Get:121 http://ftpmaster.internal/ubuntu plucky/universe armhf liblab-gamut1 armhf 2.42.4-2build3 [1833 kB] 1699s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf libice6 armhf 2:1.1.1-1 [36.5 kB] 1699s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf libsm6 armhf 2:1.2.4-1 [15.1 kB] 1699s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf libxt6t64 armhf 1:1.2.1-1.2build1 [145 kB] 1699s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf libxmu6 armhf 2:1.1.3-3build2 [40.4 kB] 1699s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf libxaw7 armhf 2:1.0.16-1 [154 kB] 1699s Get:127 http://ftpmaster.internal/ubuntu plucky/universe armhf graphviz armhf 2.42.4-2build3 [540 kB] 1699s Get:128 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pydot all 2.0.0-3 [24.9 kB] 1699s Get:129 http://ftpmaster.internal/ubuntu plucky/universe armhf androguard all 3.4.0~a1-15 [36.7 MB] 1701s Get:130 http://ftpmaster.internal/ubuntu plucky/main armhf ca-certificates-java all 20240118 [11.6 kB] 1701s Get:131 http://ftpmaster.internal/ubuntu plucky/main armhf java-common all 0.76 [6852 B] 1701s Get:132 http://ftpmaster.internal/ubuntu plucky/main armhf libpcsclite1 armhf 2.3.0-1 [24.8 kB] 1701s Get:133 http://ftpmaster.internal/ubuntu plucky/main armhf openjdk-21-jre-headless armhf 21.0.5+11-1 [39.7 MB] 1702s Get:134 http://ftpmaster.internal/ubuntu plucky/main armhf default-jre-headless armhf 2:1.21-76 [3182 B] 1702s Get:135 http://ftpmaster.internal/ubuntu plucky/main armhf at-spi2-common all 2.54.0-1 [8774 B] 1702s Get:136 http://ftpmaster.internal/ubuntu plucky/main armhf libatk1.0-0t64 armhf 2.54.0-1 [48.0 kB] 1702s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf libxi6 armhf 2:1.8.2-1 [26.5 kB] 1702s Get:138 http://ftpmaster.internal/ubuntu plucky/main armhf libatspi2.0-0t64 armhf 2.54.0-1 [70.8 kB] 1702s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf libatk-bridge2.0-0t64 armhf 2.54.0-1 [59.6 kB] 1702s Get:140 http://ftpmaster.internal/ubuntu plucky/main armhf libcairo-gobject2 armhf 1.18.2-2 [126 kB] 1702s Get:141 http://ftpmaster.internal/ubuntu plucky/main armhf libcolord2 armhf 1.4.7-1build2 [133 kB] 1702s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf libavahi-common-data armhf 0.8-13ubuntu6 [29.7 kB] 1702s Get:143 http://ftpmaster.internal/ubuntu plucky/main armhf libavahi-common3 armhf 0.8-13ubuntu6 [20.2 kB] 1702s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf libavahi-client3 armhf 0.8-13ubuntu6 [24.2 kB] 1703s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf libcups2t64 armhf 2.4.10-1ubuntu2 [239 kB] 1703s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf libepoxy0 armhf 1.5.10-2 [192 kB] 1703s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-client0 armhf 1.23.0-1 [22.7 kB] 1703s Get:148 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-cursor0 armhf 1.23.0-1 [9672 B] 1703s Get:149 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-egl1 armhf 1.23.0-1 [5352 B] 1703s Get:150 http://ftpmaster.internal/ubuntu plucky/main armhf libxcomposite1 armhf 1:0.4.6-1 [6060 B] 1703s Get:151 http://ftpmaster.internal/ubuntu plucky/main armhf libxfixes3 armhf 1:6.0.0-2build1 [9038 B] 1703s Get:152 http://ftpmaster.internal/ubuntu plucky/main armhf libxcursor1 armhf 1:1.2.2-1 [17.6 kB] 1703s Get:153 http://ftpmaster.internal/ubuntu plucky/main armhf libxdamage1 armhf 1:1.1.6-1build1 [5462 B] 1703s Get:154 http://ftpmaster.internal/ubuntu plucky/main armhf libxinerama1 armhf 2:1.1.4-3build1 [5866 B] 1703s Get:155 http://ftpmaster.internal/ubuntu plucky/main armhf libxrandr2 armhf 2:1.5.4-1 [15.8 kB] 1703s Get:156 http://ftpmaster.internal/ubuntu plucky/main armhf libdconf1 armhf 0.40.0-4build2 [38.4 kB] 1703s Get:157 http://ftpmaster.internal/ubuntu plucky/main armhf dconf-service armhf 0.40.0-4build2 [27.4 kB] 1703s Get:158 http://ftpmaster.internal/ubuntu plucky/main armhf dconf-gsettings-backend armhf 0.40.0-4build2 [23.6 kB] 1703s Get:159 http://ftpmaster.internal/ubuntu plucky/main armhf libgtk-3-common all 3.24.43-3ubuntu2 [1202 kB] 1703s Get:160 http://ftpmaster.internal/ubuntu plucky/main armhf libgtk-3-0t64 armhf 3.24.43-3ubuntu2 [2608 kB] 1703s Get:161 http://ftpmaster.internal/ubuntu plucky/main armhf libglvnd0 armhf 1.7.0-1build1 [83.7 kB] 1703s Get:162 http://ftpmaster.internal/ubuntu plucky/main armhf libglapi-mesa armhf 24.2.3-1ubuntu1 [49.4 kB] 1703s Get:163 http://ftpmaster.internal/ubuntu plucky/main armhf libx11-xcb1 armhf 2:1.8.10-2 [7902 B] 1703s Get:164 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-dri2-0 armhf 1.17.0-2 [6868 B] 1703s Get:165 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-dri3-0 armhf 1.17.0-2 [7120 B] 1703s Get:166 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-glx0 armhf 1.17.0-2 [22.6 kB] 1703s Get:167 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-present0 armhf 1.17.0-2 [5940 B] 1703s Get:168 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-randr0 armhf 1.17.0-2 [17.0 kB] 1703s Get:169 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-sync1 armhf 1.17.0-2 [8732 B] 1703s Get:170 http://ftpmaster.internal/ubuntu plucky/main armhf libxcb-xfixes0 armhf 1.17.0-2 [10.0 kB] 1703s Get:171 http://ftpmaster.internal/ubuntu plucky/main armhf libxshmfence1 armhf 1.3-1build5 [4464 B] 1703s Get:172 http://ftpmaster.internal/ubuntu plucky/main armhf libxxf86vm1 armhf 1:1.1.4-1build4 [8068 B] 1703s Get:173 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-amdgpu1 armhf 2.4.123-1 [18.9 kB] 1703s Get:174 http://ftpmaster.internal/ubuntu plucky/main armhf libdrm-radeon1 armhf 2.4.123-1 [18.1 kB] 1703s Get:175 http://ftpmaster.internal/ubuntu plucky/main armhf libllvm19 armhf 1:19.1.2-1ubuntu1 [27.8 MB] 1704s Get:176 http://ftpmaster.internal/ubuntu plucky/main armhf mesa-libgallium armhf 24.2.3-1ubuntu1 [7895 kB] 1704s Get:177 http://ftpmaster.internal/ubuntu plucky/main armhf libvulkan1 armhf 1.3.296.0-1 [114 kB] 1704s Get:178 http://ftpmaster.internal/ubuntu plucky/main armhf libwayland-server0 armhf 1.23.0-1 [29.4 kB] 1704s Get:179 http://ftpmaster.internal/ubuntu plucky/main armhf libgbm1 armhf 24.2.3-1ubuntu1 [28.2 kB] 1704s Get:180 http://ftpmaster.internal/ubuntu plucky/main armhf libgl1-mesa-dri armhf 24.2.3-1ubuntu1 [30.8 kB] 1704s Get:181 http://ftpmaster.internal/ubuntu plucky/main armhf libglx-mesa0 armhf 24.2.3-1ubuntu1 [131 kB] 1704s Get:182 http://ftpmaster.internal/ubuntu plucky/main armhf libglx0 armhf 1.7.0-1build1 [39.3 kB] 1704s Get:183 http://ftpmaster.internal/ubuntu plucky/main armhf libgl1 armhf 1.7.0-1build1 [105 kB] 1704s Get:184 http://ftpmaster.internal/ubuntu plucky/main armhf libasound2-data all 1.2.12-1 [21.0 kB] 1704s Get:185 http://ftpmaster.internal/ubuntu plucky/main armhf libasound2t64 armhf 1.2.12-1 [344 kB] 1705s Get:186 http://ftpmaster.internal/ubuntu plucky/main armhf libgif7 armhf 5.2.2-1ubuntu1 [32.6 kB] 1705s Get:187 http://ftpmaster.internal/ubuntu plucky/main armhf libxtst6 armhf 2:1.2.3-1.1build1 [10.7 kB] 1705s Get:188 http://ftpmaster.internal/ubuntu plucky/main armhf openjdk-21-jre armhf 21.0.5+11-1 [197 kB] 1705s Get:189 http://ftpmaster.internal/ubuntu plucky/main armhf default-jre armhf 2:1.21-76 [918 B] 1705s Get:190 http://ftpmaster.internal/ubuntu plucky/universe armhf libapksig-java all 31.0.2-2 [406 kB] 1705s Get:191 http://ftpmaster.internal/ubuntu plucky/universe armhf apksigner all 31.0.2-2 [444 kB] 1705s Get:192 http://ftpmaster.internal/ubuntu plucky/main armhf openjdk-21-jdk-headless armhf 21.0.5+11-1 [78.2 MB] 1708s Get:193 http://ftpmaster.internal/ubuntu plucky/main armhf default-jdk-headless armhf 2:1.21-76 [966 B] 1708s Get:194 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-args all 0.1.0-5 [6082 B] 1708s Get:195 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-clint all 0.5.1-4 [27.8 kB] 1708s Get:196 http://ftpmaster.internal/ubuntu plucky/main armhf python3-defusedxml all 0.7.1-2 [42.0 kB] 1708s Get:197 http://ftpmaster.internal/ubuntu plucky/main armhf liberror-perl all 0.17029-2 [25.6 kB] 1708s Get:198 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf git-man all 1:2.45.2-1.2ubuntu1 [1122 kB] 1708s Get:199 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf git armhf 1:2.45.2-1.2ubuntu1 [4509 kB] 1708s Get:200 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-smmap all 6.0.0-1 [20.5 kB] 1708s Get:201 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-gitdb all 4.0.11-1 [46.2 kB] 1708s Get:202 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-git all 3.1.37-3 [138 kB] 1708s Get:203 http://ftpmaster.internal/ubuntu plucky/main armhf python3-bcrypt armhf 4.2.0-1 [218 kB] 1708s Get:204 http://ftpmaster.internal/ubuntu plucky/main armhf libsodium23 armhf 1.0.18-1build3 [139 kB] 1709s Get:205 http://ftpmaster.internal/ubuntu plucky/main armhf python3-nacl armhf 1.5.0-6 [54.1 kB] 1709s Get:206 http://ftpmaster.internal/ubuntu plucky/main armhf python3-paramiko all 3.4.0-1ubuntu2 [145 kB] 1709s Get:207 http://ftpmaster.internal/ubuntu plucky/main armhf python3-platformdirs all 4.3.6-1 [16.8 kB] 1709s Get:208 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-png all 0.20231004.0-4 [30.3 kB] 1709s Get:209 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-qrcode all 7.4.2-5 [40.2 kB] 1709s Get:210 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ruamel.yaml.clib armhf 0.2.8+ds-2 [125 kB] 1709s Get:211 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-ruamel.yaml all 0.18.6+ds-3 [126 kB] 1709s Get:212 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-looseversion all 1.3.0-3 [8354 B] 1709s Get:213 http://ftpmaster.internal/ubuntu plucky/universe armhf sdkmanager all 0.6.10-1 [34.3 kB] 1709s Get:214 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pathspec all 0.12.1-1 [24.5 kB] 1709s Get:215 http://ftpmaster.internal/ubuntu plucky/universe armhf yamllint all 1.35.1-2 [43.6 kB] 1709s Get:216 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-biplist all 1.0.3-5 [11.3 kB] 1709s Get:217 http://ftpmaster.internal/ubuntu plucky/universe armhf python3-pycountry all 24.6.1+ds1-1 [30.0 kB] 1709s Get:218 http://ftpmaster.internal/ubuntu plucky/universe armhf s3cmd all 2.4.0-2 [128 kB] 1709s Get:219 http://ftpmaster.internal/ubuntu plucky/universe armhf fdroidserver all 2.3~a2-1 [439 kB] 1710s Fetched 285 MB in 15s (18.4 MB/s) 1710s Selecting previously unselected package libgdk-pixbuf2.0-common. 1710s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59576 files and directories currently installed.) 1710s Preparing to unpack .../000-libgdk-pixbuf2.0-common_2.42.12+dfsg-1_all.deb ... 1710s Unpacking libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... 1710s Selecting previously unselected package libjpeg-turbo8:armhf. 1710s Preparing to unpack .../001-libjpeg-turbo8_2.1.5-2ubuntu2_armhf.deb ... 1710s Unpacking libjpeg-turbo8:armhf (2.1.5-2ubuntu2) ... 1710s Selecting previously unselected package libjpeg8:armhf. 1710s Preparing to unpack .../002-libjpeg8_8c-2ubuntu11_armhf.deb ... 1710s Unpacking libjpeg8:armhf (8c-2ubuntu11) ... 1710s Selecting previously unselected package libdeflate0:armhf. 1710s Preparing to unpack .../003-libdeflate0_1.22-1_armhf.deb ... 1710s Unpacking libdeflate0:armhf (1.22-1) ... 1710s Selecting previously unselected package libjbig0:armhf. 1710s Preparing to unpack .../004-libjbig0_2.1-6.1ubuntu2_armhf.deb ... 1710s Unpacking libjbig0:armhf (2.1-6.1ubuntu2) ... 1710s Selecting previously unselected package liblerc4:armhf. 1710s Preparing to unpack .../005-liblerc4_4.0.0+ds-4ubuntu2_armhf.deb ... 1710s Unpacking liblerc4:armhf (4.0.0+ds-4ubuntu2) ... 1710s Selecting previously unselected package libsharpyuv0:armhf. 1710s Preparing to unpack .../006-libsharpyuv0_1.4.0-0.1_armhf.deb ... 1710s Unpacking libsharpyuv0:armhf (1.4.0-0.1) ... 1710s Selecting previously unselected package libwebp7:armhf. 1710s Preparing to unpack .../007-libwebp7_1.4.0-0.1_armhf.deb ... 1710s Unpacking libwebp7:armhf (1.4.0-0.1) ... 1710s Selecting previously unselected package libtiff6:armhf. 1710s Preparing to unpack .../008-libtiff6_4.5.1+git230720-4ubuntu4_armhf.deb ... 1710s Unpacking libtiff6:armhf (4.5.1+git230720-4ubuntu4) ... 1710s Selecting previously unselected package libgdk-pixbuf-2.0-0:armhf. 1710s Preparing to unpack .../009-libgdk-pixbuf-2.0-0_2.42.12+dfsg-1_armhf.deb ... 1710s Unpacking libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1) ... 1710s Selecting previously unselected package gtk-update-icon-cache. 1710s Preparing to unpack .../010-gtk-update-icon-cache_4.16.5+ds-1_armhf.deb ... 1710s No diversion 'diversion of /usr/sbin/update-icon-caches to /usr/sbin/update-icon-caches.gtk2 by libgtk-3-bin', none removed. 1710s No diversion 'diversion of /usr/share/man/man8/update-icon-caches.8.gz to /usr/share/man/man8/update-icon-caches.gtk2.8.gz by libgtk-3-bin', none removed. 1710s Unpacking gtk-update-icon-cache (4.16.5+ds-1) ... 1710s Selecting previously unselected package hicolor-icon-theme. 1710s Preparing to unpack .../011-hicolor-icon-theme_0.18-1_all.deb ... 1710s Unpacking hicolor-icon-theme (0.18-1) ... 1710s Selecting previously unselected package humanity-icon-theme. 1710s Preparing to unpack .../012-humanity-icon-theme_0.6.16_all.deb ... 1710s Unpacking humanity-icon-theme (0.6.16) ... 1711s Selecting previously unselected package ubuntu-mono. 1711s Preparing to unpack .../013-ubuntu-mono_24.04-0ubuntu1_all.deb ... 1711s Unpacking ubuntu-mono (24.04-0ubuntu1) ... 1711s Selecting previously unselected package adwaita-icon-theme. 1711s Preparing to unpack .../014-adwaita-icon-theme_47.0-2_all.deb ... 1711s Unpacking adwaita-icon-theme (47.0-2) ... 1711s Selecting previously unselected package python3-asn1crypto. 1711s Preparing to unpack .../015-python3-asn1crypto_1.5.1-3_all.deb ... 1711s Unpacking python3-asn1crypto (1.5.1-3) ... 1711s Selecting previously unselected package python3-colorama. 1711s Preparing to unpack .../016-python3-colorama_0.4.6-4_all.deb ... 1711s Unpacking python3-colorama (0.4.6-4) ... 1712s Selecting previously unselected package python3-click. 1712s Preparing to unpack .../017-python3-click_8.1.7-2_all.deb ... 1712s Unpacking python3-click (8.1.7-2) ... 1712s Selecting previously unselected package python3-decorator. 1712s Preparing to unpack .../018-python3-decorator_5.1.1-5_all.deb ... 1712s Unpacking python3-decorator (5.1.1-5) ... 1712s Selecting previously unselected package python3-parso. 1712s Preparing to unpack .../019-python3-parso_0.8.3-1_all.deb ... 1712s Unpacking python3-parso (0.8.3-1) ... 1712s Selecting previously unselected package python3-typeshed. 1712s Preparing to unpack .../020-python3-typeshed_0.0~git20231111.6764465-3_all.deb ... 1712s Unpacking python3-typeshed (0.0~git20231111.6764465-3) ... 1712s Selecting previously unselected package python3-jedi. 1712s Preparing to unpack .../021-python3-jedi_0.19.1+ds1-1_all.deb ... 1712s Unpacking python3-jedi (0.19.1+ds1-1) ... 1713s Selecting previously unselected package python3-traitlets. 1713s Preparing to unpack .../022-python3-traitlets_5.14.3+really5.14.3-1_all.deb ... 1713s Unpacking python3-traitlets (5.14.3+really5.14.3-1) ... 1713s Selecting previously unselected package python3-matplotlib-inline. 1713s Preparing to unpack .../023-python3-matplotlib-inline_0.1.6-2_all.deb ... 1713s Unpacking python3-matplotlib-inline (0.1.6-2) ... 1713s Selecting previously unselected package python3-ptyprocess. 1713s Preparing to unpack .../024-python3-ptyprocess_0.7.0-6_all.deb ... 1713s Unpacking python3-ptyprocess (0.7.0-6) ... 1713s Selecting previously unselected package python3-pexpect. 1713s Preparing to unpack .../025-python3-pexpect_4.9-2_all.deb ... 1713s Unpacking python3-pexpect (4.9-2) ... 1713s Selecting previously unselected package python3-wcwidth. 1713s Preparing to unpack .../026-python3-wcwidth_0.2.13+dfsg1-1_all.deb ... 1713s Unpacking python3-wcwidth (0.2.13+dfsg1-1) ... 1713s Selecting previously unselected package python3-prompt-toolkit. 1713s Preparing to unpack .../027-python3-prompt-toolkit_3.0.48-1_all.deb ... 1713s Unpacking python3-prompt-toolkit (3.0.48-1) ... 1713s Selecting previously unselected package python3-asttokens. 1713s Preparing to unpack .../028-python3-asttokens_2.4.1-2_all.deb ... 1713s Unpacking python3-asttokens (2.4.1-2) ... 1713s Selecting previously unselected package python3-executing. 1713s Preparing to unpack .../029-python3-executing_2.1.0-0.1_all.deb ... 1713s Unpacking python3-executing (2.1.0-0.1) ... 1713s Selecting previously unselected package python3-pure-eval. 1713s Preparing to unpack .../030-python3-pure-eval_0.2.3-1_all.deb ... 1713s Unpacking python3-pure-eval (0.2.3-1) ... 1713s Selecting previously unselected package python3-stack-data. 1713s Preparing to unpack .../031-python3-stack-data_0.6.3-1_all.deb ... 1713s Unpacking python3-stack-data (0.6.3-1) ... 1713s Selecting previously unselected package python3-ipython. 1713s Preparing to unpack .../032-python3-ipython_8.20.0-1ubuntu1_all.deb ... 1713s Unpacking python3-ipython (8.20.0-1ubuntu1) ... 1713s Selecting previously unselected package libxslt1.1:armhf. 1713s Preparing to unpack .../033-libxslt1.1_1.1.39-0exp1ubuntu1_armhf.deb ... 1713s Unpacking libxslt1.1:armhf (1.1.39-0exp1ubuntu1) ... 1713s Selecting previously unselected package python3-lxml:armhf. 1713s Preparing to unpack .../034-python3-lxml_5.3.0-1_armhf.deb ... 1713s Unpacking python3-lxml:armhf (5.3.0-1) ... 1713s Selecting previously unselected package python3-magic. 1713s Preparing to unpack .../035-python3-magic_2%3a0.4.27-3_all.deb ... 1713s Unpacking python3-magic (2:0.4.27-3) ... 1713s Selecting previously unselected package libjs-jquery. 1713s Preparing to unpack .../036-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... 1713s Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 1713s Selecting previously unselected package libjs-jquery-ui. 1713s Preparing to unpack .../037-libjs-jquery-ui_1.13.2+dfsg-1_all.deb ... 1713s Unpacking libjs-jquery-ui (1.13.2+dfsg-1) ... 1713s Selecting previously unselected package fonts-dejavu-mono. 1713s Preparing to unpack .../038-fonts-dejavu-mono_2.37-8_all.deb ... 1713s Unpacking fonts-dejavu-mono (2.37-8) ... 1713s Selecting previously unselected package fonts-dejavu-core. 1713s Preparing to unpack .../039-fonts-dejavu-core_2.37-8_all.deb ... 1713s Unpacking fonts-dejavu-core (2.37-8) ... 1713s Selecting previously unselected package fonts-lyx. 1713s Preparing to unpack .../040-fonts-lyx_2.4.2.1-1_all.deb ... 1713s Unpacking fonts-lyx (2.4.2.1-1) ... 1713s Selecting previously unselected package python-matplotlib-data. 1713s Preparing to unpack .../041-python-matplotlib-data_3.8.3-3_all.deb ... 1713s Unpacking python-matplotlib-data (3.8.3-3) ... 1714s Selecting previously unselected package python3-six. 1714s Preparing to unpack .../042-python3-six_1.16.0-7_all.deb ... 1714s Unpacking python3-six (1.16.0-7) ... 1714s Selecting previously unselected package python3-dateutil. 1714s Preparing to unpack .../043-python3-dateutil_2.9.0-2_all.deb ... 1714s Unpacking python3-dateutil (2.9.0-2) ... 1714s Selecting previously unselected package libfreetype6:armhf. 1714s Preparing to unpack .../044-libfreetype6_2.13.3+dfsg-1_armhf.deb ... 1714s Unpacking libfreetype6:armhf (2.13.3+dfsg-1) ... 1714s Selecting previously unselected package libgomp1:armhf. 1714s Preparing to unpack .../045-libgomp1_14.2.0-8ubuntu1_armhf.deb ... 1714s Unpacking libgomp1:armhf (14.2.0-8ubuntu1) ... 1714s Selecting previously unselected package libimagequant0:armhf. 1714s Preparing to unpack .../046-libimagequant0_2.18.0-1build1_armhf.deb ... 1714s Unpacking libimagequant0:armhf (2.18.0-1build1) ... 1714s Selecting previously unselected package liblcms2-2:armhf. 1714s Preparing to unpack .../047-liblcms2-2_2.16-2_armhf.deb ... 1714s Unpacking liblcms2-2:armhf (2.16-2) ... 1714s Selecting previously unselected package libopenjp2-7:armhf. 1714s Preparing to unpack .../048-libopenjp2-7_2.5.0-2ubuntu1_armhf.deb ... 1714s Unpacking libopenjp2-7:armhf (2.5.0-2ubuntu1) ... 1714s Selecting previously unselected package libgraphite2-3:armhf. 1714s Preparing to unpack .../049-libgraphite2-3_1.3.14-2ubuntu1_armhf.deb ... 1714s Unpacking libgraphite2-3:armhf (1.3.14-2ubuntu1) ... 1714s Selecting previously unselected package libharfbuzz0b:armhf. 1714s Preparing to unpack .../050-libharfbuzz0b_10.0.1-1_armhf.deb ... 1714s Unpacking libharfbuzz0b:armhf (10.0.1-1) ... 1714s Selecting previously unselected package libraqm0:armhf. 1714s Preparing to unpack .../051-libraqm0_0.10.1-1build1_armhf.deb ... 1714s Unpacking libraqm0:armhf (0.10.1-1build1) ... 1714s Selecting previously unselected package libwebpdemux2:armhf. 1714s Preparing to unpack .../052-libwebpdemux2_1.4.0-0.1_armhf.deb ... 1714s Unpacking libwebpdemux2:armhf (1.4.0-0.1) ... 1714s Selecting previously unselected package libwebpmux3:armhf. 1714s Preparing to unpack .../053-libwebpmux3_1.4.0-0.1_armhf.deb ... 1714s Unpacking libwebpmux3:armhf (1.4.0-0.1) ... 1714s Selecting previously unselected package python3-pil:armhf. 1714s Preparing to unpack .../054-python3-pil_10.4.0-1ubuntu1_armhf.deb ... 1714s Unpacking python3-pil:armhf (10.4.0-1ubuntu1) ... 1714s Selecting previously unselected package libtcl8.6:armhf. 1714s Preparing to unpack .../055-libtcl8.6_8.6.15+dfsg-2_armhf.deb ... 1714s Unpacking libtcl8.6:armhf (8.6.15+dfsg-2) ... 1714s Selecting previously unselected package fontconfig-config. 1714s Preparing to unpack .../056-fontconfig-config_2.15.0-1.1ubuntu2_armhf.deb ... 1714s Unpacking fontconfig-config (2.15.0-1.1ubuntu2) ... 1714s Selecting previously unselected package libfontconfig1:armhf. 1714s Preparing to unpack .../057-libfontconfig1_2.15.0-1.1ubuntu2_armhf.deb ... 1714s Unpacking libfontconfig1:armhf (2.15.0-1.1ubuntu2) ... 1714s Selecting previously unselected package libxrender1:armhf. 1714s Preparing to unpack .../058-libxrender1_1%3a0.9.10-1.1build1_armhf.deb ... 1714s Unpacking libxrender1:armhf (1:0.9.10-1.1build1) ... 1714s Selecting previously unselected package libxft2:armhf. 1714s Preparing to unpack .../059-libxft2_2.3.6-1build1_armhf.deb ... 1714s Unpacking libxft2:armhf (2.3.6-1build1) ... 1714s Selecting previously unselected package x11-common. 1714s Preparing to unpack .../060-x11-common_1%3a7.7+23ubuntu3_all.deb ... 1714s Unpacking x11-common (1:7.7+23ubuntu3) ... 1715s Selecting previously unselected package libxss1:armhf. 1715s Preparing to unpack .../061-libxss1_1%3a1.2.3-1build3_armhf.deb ... 1715s Unpacking libxss1:armhf (1:1.2.3-1build3) ... 1715s Selecting previously unselected package libtk8.6:armhf. 1715s Preparing to unpack .../062-libtk8.6_8.6.15-1_armhf.deb ... 1715s Unpacking libtk8.6:armhf (8.6.15-1) ... 1715s Selecting previously unselected package python3.12-tk. 1715s Preparing to unpack .../063-python3.12-tk_3.12.7-3_armhf.deb ... 1715s Unpacking python3.12-tk (3.12.7-3) ... 1715s Selecting previously unselected package python3.13-tk. 1715s Preparing to unpack .../064-python3.13-tk_3.13.0-2_armhf.deb ... 1715s Unpacking python3.13-tk (3.13.0-2) ... 1715s Selecting previously unselected package tk8.6-blt2.5. 1715s Preparing to unpack .../065-tk8.6-blt2.5_2.5.3+dfsg-7build1_armhf.deb ... 1715s Unpacking tk8.6-blt2.5 (2.5.3+dfsg-7build1) ... 1715s Selecting previously unselected package blt. 1715s Preparing to unpack .../066-blt_2.5.3+dfsg-7build1_armhf.deb ... 1715s Unpacking blt (2.5.3+dfsg-7build1) ... 1715s Selecting previously unselected package python3-tk:armhf. 1715s Preparing to unpack .../067-python3-tk_3.12.7-1_armhf.deb ... 1715s Unpacking python3-tk:armhf (3.12.7-1) ... 1715s Selecting previously unselected package python3-pil.imagetk:armhf. 1715s Preparing to unpack .../068-python3-pil.imagetk_10.4.0-1ubuntu1_armhf.deb ... 1715s Unpacking python3-pil.imagetk:armhf (10.4.0-1ubuntu1) ... 1715s Selecting previously unselected package libblas3:armhf. 1715s Preparing to unpack .../069-libblas3_3.12.0-3build2_armhf.deb ... 1715s Unpacking libblas3:armhf (3.12.0-3build2) ... 1715s Selecting previously unselected package libgfortran5:armhf. 1715s Preparing to unpack .../070-libgfortran5_14.2.0-8ubuntu1_armhf.deb ... 1715s Unpacking libgfortran5:armhf (14.2.0-8ubuntu1) ... 1715s Selecting previously unselected package liblapack3:armhf. 1715s Preparing to unpack .../071-liblapack3_3.12.0-3build2_armhf.deb ... 1715s Unpacking liblapack3:armhf (3.12.0-3build2) ... 1715s Selecting previously unselected package python3-numpy. 1715s Preparing to unpack .../072-python3-numpy_1%3a1.26.4+ds-11build1_armhf.deb ... 1715s Unpacking python3-numpy (1:1.26.4+ds-11build1) ... 1715s Selecting previously unselected package python3-contourpy. 1715s Preparing to unpack .../073-python3-contourpy_1.3.0-2_armhf.deb ... 1715s Unpacking python3-contourpy (1.3.0-2) ... 1715s Selecting previously unselected package python3-cycler. 1715s Preparing to unpack .../074-python3-cycler_0.12.1-1_all.deb ... 1715s Unpacking python3-cycler (0.12.1-1) ... 1715s Selecting previously unselected package python3-brotli. 1715s Preparing to unpack .../075-python3-brotli_1.1.0-2build2_armhf.deb ... 1715s Unpacking python3-brotli (1.1.0-2build2) ... 1715s Selecting previously unselected package liblbfgsb0:armhf. 1715s Preparing to unpack .../076-liblbfgsb0_3.0+dfsg.4-1build1_armhf.deb ... 1715s Unpacking liblbfgsb0:armhf (3.0+dfsg.4-1build1) ... 1715s Selecting previously unselected package python3-scipy. 1715s Preparing to unpack .../077-python3-scipy_1.13.1-5_armhf.deb ... 1715s Unpacking python3-scipy (1.13.1-5) ... 1716s Selecting previously unselected package python3-ufolib2. 1716s Preparing to unpack .../078-python3-ufolib2_0.16.1+dfsg1-1_all.deb ... 1716s Unpacking python3-ufolib2 (0.16.1+dfsg1-1) ... 1716s Selecting previously unselected package python3-mpmath. 1716s Preparing to unpack .../079-python3-mpmath_1.3.0-1_all.deb ... 1716s Unpacking python3-mpmath (1.3.0-1) ... 1716s Selecting previously unselected package python3-sympy. 1716s Preparing to unpack .../080-python3-sympy_1.13.3-1_all.deb ... 1716s Unpacking python3-sympy (1.13.3-1) ... 1716s Selecting previously unselected package python3-tz. 1716s Preparing to unpack .../081-python3-tz_2024.1-2_all.deb ... 1716s Unpacking python3-tz (2024.1-2) ... 1716s Selecting previously unselected package python3-appdirs. 1716s Preparing to unpack .../082-python3-appdirs_1.4.4-4_all.deb ... 1716s Unpacking python3-appdirs (1.4.4-4) ... 1716s Selecting previously unselected package python3-fs. 1716s Preparing to unpack .../083-python3-fs_2.4.16-4_all.deb ... 1716s Unpacking python3-fs (2.4.16-4) ... 1716s Selecting previously unselected package python3-lz4. 1716s Preparing to unpack .../084-python3-lz4_4.0.2+dfsg-1build4_armhf.deb ... 1716s Unpacking python3-lz4 (4.0.2+dfsg-1build4) ... 1716s Selecting previously unselected package python3-unicodedata2. 1716s Preparing to unpack .../085-python3-unicodedata2_15.1.0+ds-1build1_armhf.deb ... 1716s Unpacking python3-unicodedata2 (15.1.0+ds-1build1) ... 1717s Selecting previously unselected package unicode-data. 1717s Preparing to unpack .../086-unicode-data_15.1.0-1_all.deb ... 1717s Unpacking unicode-data (15.1.0-1) ... 1717s Selecting previously unselected package python3-fonttools. 1717s Preparing to unpack .../087-python3-fonttools_4.46.0-1build2_armhf.deb ... 1717s Unpacking python3-fonttools (4.46.0-1build2) ... 1717s Selecting previously unselected package python3-kiwisolver. 1717s Preparing to unpack .../088-python3-kiwisolver_1.4.7-2_armhf.deb ... 1717s Unpacking python3-kiwisolver (1.4.7-2) ... 1717s Selecting previously unselected package python3-packaging. 1717s Preparing to unpack .../089-python3-packaging_24.1-1_all.deb ... 1717s Unpacking python3-packaging (24.1-1) ... 1717s Selecting previously unselected package libqhull-r8.0:armhf. 1717s Preparing to unpack .../090-libqhull-r8.0_2020.2-6build1_armhf.deb ... 1717s Unpacking libqhull-r8.0:armhf (2020.2-6build1) ... 1717s Selecting previously unselected package python3-matplotlib. 1717s Preparing to unpack .../091-python3-matplotlib_3.8.3-3_armhf.deb ... 1717s Unpacking python3-matplotlib (3.8.3-3) ... 1717s Selecting previously unselected package python3-networkx. 1717s Preparing to unpack .../092-python3-networkx_3.2.1-4ubuntu1_all.deb ... 1717s Unpacking python3-networkx (3.2.1-4ubuntu1) ... 1718s Selecting previously unselected package python3-oscrypto. 1718s Preparing to unpack .../093-python3-oscrypto_1.3.0-7_all.deb ... 1718s Unpacking python3-oscrypto (1.3.0-7) ... 1718s Selecting previously unselected package libcdt5:armhf. 1718s Preparing to unpack .../094-libcdt5_2.42.4-2build3_armhf.deb ... 1718s Unpacking libcdt5:armhf (2.42.4-2build3) ... 1718s Selecting previously unselected package libcgraph6:armhf. 1718s Preparing to unpack .../095-libcgraph6_2.42.4-2build3_armhf.deb ... 1718s Unpacking libcgraph6:armhf (2.42.4-2build3) ... 1718s Selecting previously unselected package libaom3:armhf. 1718s Preparing to unpack .../096-libaom3_3.11.0~rc1-1_armhf.deb ... 1718s Unpacking libaom3:armhf (3.11.0~rc1-1) ... 1718s Selecting previously unselected package libheif-plugin-aomdec:armhf. 1718s Preparing to unpack .../097-libheif-plugin-aomdec_1.18.1-2_armhf.deb ... 1718s Unpacking libheif-plugin-aomdec:armhf (1.18.1-2) ... 1718s Selecting previously unselected package libde265-0:armhf. 1718s Preparing to unpack .../098-libde265-0_1.0.15-1build4_armhf.deb ... 1718s Unpacking libde265-0:armhf (1.0.15-1build4) ... 1718s Selecting previously unselected package libheif-plugin-libde265:armhf. 1718s Preparing to unpack .../099-libheif-plugin-libde265_1.18.1-2_armhf.deb ... 1718s Unpacking libheif-plugin-libde265:armhf (1.18.1-2) ... 1718s Selecting previously unselected package libheif1:armhf. 1718s Preparing to unpack .../100-libheif1_1.18.1-2_armhf.deb ... 1718s Unpacking libheif1:armhf (1.18.1-2) ... 1718s Selecting previously unselected package libxpm4:armhf. 1718s Preparing to unpack .../101-libxpm4_1%3a3.5.17-1build2_armhf.deb ... 1718s Unpacking libxpm4:armhf (1:3.5.17-1build2) ... 1718s Selecting previously unselected package libgd3:armhf. 1718s Preparing to unpack .../102-libgd3_2.3.3-12ubuntu3_armhf.deb ... 1718s Unpacking libgd3:armhf (2.3.3-12ubuntu3) ... 1718s Selecting previously unselected package libgts-0.7-5t64:armhf. 1718s Preparing to unpack .../103-libgts-0.7-5t64_0.7.6+darcs121130-5.2build1_armhf.deb ... 1718s Unpacking libgts-0.7-5t64:armhf (0.7.6+darcs121130-5.2build1) ... 1718s Selecting previously unselected package libpixman-1-0:armhf. 1718s Preparing to unpack .../104-libpixman-1-0_0.44.0-3_armhf.deb ... 1718s Unpacking libpixman-1-0:armhf (0.44.0-3) ... 1718s Selecting previously unselected package libxcb-render0:armhf. 1718s Preparing to unpack .../105-libxcb-render0_1.17.0-2_armhf.deb ... 1718s Unpacking libxcb-render0:armhf (1.17.0-2) ... 1718s Selecting previously unselected package libxcb-shm0:armhf. 1718s Preparing to unpack .../106-libxcb-shm0_1.17.0-2_armhf.deb ... 1718s Unpacking libxcb-shm0:armhf (1.17.0-2) ... 1718s Selecting previously unselected package libcairo2:armhf. 1718s Preparing to unpack .../107-libcairo2_1.18.2-2_armhf.deb ... 1718s Unpacking libcairo2:armhf (1.18.2-2) ... 1718s Selecting previously unselected package libltdl7:armhf. 1718s Preparing to unpack .../108-libltdl7_2.4.7-7build1_armhf.deb ... 1718s Unpacking libltdl7:armhf (2.4.7-7build1) ... 1718s Selecting previously unselected package fontconfig. 1718s Preparing to unpack .../109-fontconfig_2.15.0-1.1ubuntu2_armhf.deb ... 1718s Unpacking fontconfig (2.15.0-1.1ubuntu2) ... 1718s Selecting previously unselected package libthai-data. 1718s Preparing to unpack .../110-libthai-data_0.1.29-2build1_all.deb ... 1718s Unpacking libthai-data (0.1.29-2build1) ... 1719s Selecting previously unselected package libdatrie1:armhf. 1719s Preparing to unpack .../111-libdatrie1_0.2.13-3build1_armhf.deb ... 1719s Unpacking libdatrie1:armhf (0.2.13-3build1) ... 1719s Selecting previously unselected package libthai0:armhf. 1719s Preparing to unpack .../112-libthai0_0.1.29-2build1_armhf.deb ... 1719s Unpacking libthai0:armhf (0.1.29-2build1) ... 1719s Selecting previously unselected package libpango-1.0-0:armhf. 1719s Preparing to unpack .../113-libpango-1.0-0_1.54.0+ds-3_armhf.deb ... 1719s Unpacking libpango-1.0-0:armhf (1.54.0+ds-3) ... 1719s Selecting previously unselected package libpangoft2-1.0-0:armhf. 1719s Preparing to unpack .../114-libpangoft2-1.0-0_1.54.0+ds-3_armhf.deb ... 1719s Unpacking libpangoft2-1.0-0:armhf (1.54.0+ds-3) ... 1719s Selecting previously unselected package libpangocairo-1.0-0:armhf. 1719s Preparing to unpack .../115-libpangocairo-1.0-0_1.54.0+ds-3_armhf.deb ... 1719s Unpacking libpangocairo-1.0-0:armhf (1.54.0+ds-3) ... 1719s Selecting previously unselected package libpathplan4:armhf. 1719s Preparing to unpack .../116-libpathplan4_2.42.4-2build3_armhf.deb ... 1719s Unpacking libpathplan4:armhf (2.42.4-2build3) ... 1719s Selecting previously unselected package libgvc6. 1719s Preparing to unpack .../117-libgvc6_2.42.4-2build3_armhf.deb ... 1719s Unpacking libgvc6 (2.42.4-2build3) ... 1719s Selecting previously unselected package libgvpr2:armhf. 1719s Preparing to unpack .../118-libgvpr2_2.42.4-2build3_armhf.deb ... 1719s Unpacking libgvpr2:armhf (2.42.4-2build3) ... 1719s Selecting previously unselected package liblab-gamut1:armhf. 1719s Preparing to unpack .../119-liblab-gamut1_2.42.4-2build3_armhf.deb ... 1719s Unpacking liblab-gamut1:armhf (2.42.4-2build3) ... 1719s Selecting previously unselected package libice6:armhf. 1719s Preparing to unpack .../120-libice6_2%3a1.1.1-1_armhf.deb ... 1719s Unpacking libice6:armhf (2:1.1.1-1) ... 1719s Selecting previously unselected package libsm6:armhf. 1719s Preparing to unpack .../121-libsm6_2%3a1.2.4-1_armhf.deb ... 1719s Unpacking libsm6:armhf (2:1.2.4-1) ... 1719s Selecting previously unselected package libxt6t64:armhf. 1719s Preparing to unpack .../122-libxt6t64_1%3a1.2.1-1.2build1_armhf.deb ... 1719s Unpacking libxt6t64:armhf (1:1.2.1-1.2build1) ... 1719s Selecting previously unselected package libxmu6:armhf. 1719s Preparing to unpack .../123-libxmu6_2%3a1.1.3-3build2_armhf.deb ... 1719s Unpacking libxmu6:armhf (2:1.1.3-3build2) ... 1719s Selecting previously unselected package libxaw7:armhf. 1719s Preparing to unpack .../124-libxaw7_2%3a1.0.16-1_armhf.deb ... 1719s Unpacking libxaw7:armhf (2:1.0.16-1) ... 1719s Selecting previously unselected package graphviz. 1719s Preparing to unpack .../125-graphviz_2.42.4-2build3_armhf.deb ... 1719s Unpacking graphviz (2.42.4-2build3) ... 1719s Selecting previously unselected package python3-pydot. 1719s Preparing to unpack .../126-python3-pydot_2.0.0-3_all.deb ... 1719s Unpacking python3-pydot (2.0.0-3) ... 1719s Selecting previously unselected package androguard. 1719s Preparing to unpack .../127-androguard_3.4.0~a1-15_all.deb ... 1719s Unpacking androguard (3.4.0~a1-15) ... 1720s Selecting previously unselected package ca-certificates-java. 1720s Preparing to unpack .../128-ca-certificates-java_20240118_all.deb ... 1720s Unpacking ca-certificates-java (20240118) ... 1720s Selecting previously unselected package java-common. 1720s Preparing to unpack .../129-java-common_0.76_all.deb ... 1720s Unpacking java-common (0.76) ... 1720s Selecting previously unselected package libpcsclite1:armhf. 1720s Preparing to unpack .../130-libpcsclite1_2.3.0-1_armhf.deb ... 1720s Unpacking libpcsclite1:armhf (2.3.0-1) ... 1720s Selecting previously unselected package openjdk-21-jre-headless:armhf. 1720s Preparing to unpack .../131-openjdk-21-jre-headless_21.0.5+11-1_armhf.deb ... 1720s Unpacking openjdk-21-jre-headless:armhf (21.0.5+11-1) ... 1721s Selecting previously unselected package default-jre-headless. 1721s Preparing to unpack .../132-default-jre-headless_2%3a1.21-76_armhf.deb ... 1721s Unpacking default-jre-headless (2:1.21-76) ... 1721s Selecting previously unselected package at-spi2-common. 1721s Preparing to unpack .../133-at-spi2-common_2.54.0-1_all.deb ... 1721s Unpacking at-spi2-common (2.54.0-1) ... 1721s Selecting previously unselected package libatk1.0-0t64:armhf. 1721s Preparing to unpack .../134-libatk1.0-0t64_2.54.0-1_armhf.deb ... 1721s Unpacking libatk1.0-0t64:armhf (2.54.0-1) ... 1721s Selecting previously unselected package libxi6:armhf. 1721s Preparing to unpack .../135-libxi6_2%3a1.8.2-1_armhf.deb ... 1721s Unpacking libxi6:armhf (2:1.8.2-1) ... 1721s Selecting previously unselected package libatspi2.0-0t64:armhf. 1721s Preparing to unpack .../136-libatspi2.0-0t64_2.54.0-1_armhf.deb ... 1721s Unpacking libatspi2.0-0t64:armhf (2.54.0-1) ... 1721s Selecting previously unselected package libatk-bridge2.0-0t64:armhf. 1721s Preparing to unpack .../137-libatk-bridge2.0-0t64_2.54.0-1_armhf.deb ... 1721s Unpacking libatk-bridge2.0-0t64:armhf (2.54.0-1) ... 1721s Selecting previously unselected package libcairo-gobject2:armhf. 1721s Preparing to unpack .../138-libcairo-gobject2_1.18.2-2_armhf.deb ... 1721s Unpacking libcairo-gobject2:armhf (1.18.2-2) ... 1721s Selecting previously unselected package libcolord2:armhf. 1721s Preparing to unpack .../139-libcolord2_1.4.7-1build2_armhf.deb ... 1721s Unpacking libcolord2:armhf (1.4.7-1build2) ... 1721s Selecting previously unselected package libavahi-common-data:armhf. 1721s Preparing to unpack .../140-libavahi-common-data_0.8-13ubuntu6_armhf.deb ... 1721s Unpacking libavahi-common-data:armhf (0.8-13ubuntu6) ... 1722s Selecting previously unselected package libavahi-common3:armhf. 1722s Preparing to unpack .../141-libavahi-common3_0.8-13ubuntu6_armhf.deb ... 1722s Unpacking libavahi-common3:armhf (0.8-13ubuntu6) ... 1722s Selecting previously unselected package libavahi-client3:armhf. 1722s Preparing to unpack .../142-libavahi-client3_0.8-13ubuntu6_armhf.deb ... 1722s Unpacking libavahi-client3:armhf (0.8-13ubuntu6) ... 1722s Selecting previously unselected package libcups2t64:armhf. 1722s Preparing to unpack .../143-libcups2t64_2.4.10-1ubuntu2_armhf.deb ... 1722s Unpacking libcups2t64:armhf (2.4.10-1ubuntu2) ... 1722s Selecting previously unselected package libepoxy0:armhf. 1722s Preparing to unpack .../144-libepoxy0_1.5.10-2_armhf.deb ... 1722s Unpacking libepoxy0:armhf (1.5.10-2) ... 1722s Selecting previously unselected package libwayland-client0:armhf. 1722s Preparing to unpack .../145-libwayland-client0_1.23.0-1_armhf.deb ... 1722s Unpacking libwayland-client0:armhf (1.23.0-1) ... 1722s Selecting previously unselected package libwayland-cursor0:armhf. 1722s Preparing to unpack .../146-libwayland-cursor0_1.23.0-1_armhf.deb ... 1722s Unpacking libwayland-cursor0:armhf (1.23.0-1) ... 1722s Selecting previously unselected package libwayland-egl1:armhf. 1722s Preparing to unpack .../147-libwayland-egl1_1.23.0-1_armhf.deb ... 1722s Unpacking libwayland-egl1:armhf (1.23.0-1) ... 1722s Selecting previously unselected package libxcomposite1:armhf. 1722s Preparing to unpack .../148-libxcomposite1_1%3a0.4.6-1_armhf.deb ... 1722s Unpacking libxcomposite1:armhf (1:0.4.6-1) ... 1722s Selecting previously unselected package libxfixes3:armhf. 1722s Preparing to unpack .../149-libxfixes3_1%3a6.0.0-2build1_armhf.deb ... 1722s Unpacking libxfixes3:armhf (1:6.0.0-2build1) ... 1722s Selecting previously unselected package libxcursor1:armhf. 1722s Preparing to unpack .../150-libxcursor1_1%3a1.2.2-1_armhf.deb ... 1722s Unpacking libxcursor1:armhf (1:1.2.2-1) ... 1722s Selecting previously unselected package libxdamage1:armhf. 1722s Preparing to unpack .../151-libxdamage1_1%3a1.1.6-1build1_armhf.deb ... 1722s Unpacking libxdamage1:armhf (1:1.1.6-1build1) ... 1722s Selecting previously unselected package libxinerama1:armhf. 1722s Preparing to unpack .../152-libxinerama1_2%3a1.1.4-3build1_armhf.deb ... 1722s Unpacking libxinerama1:armhf (2:1.1.4-3build1) ... 1722s Selecting previously unselected package libxrandr2:armhf. 1722s Preparing to unpack .../153-libxrandr2_2%3a1.5.4-1_armhf.deb ... 1722s Unpacking libxrandr2:armhf (2:1.5.4-1) ... 1722s Selecting previously unselected package libdconf1:armhf. 1722s Preparing to unpack .../154-libdconf1_0.40.0-4build2_armhf.deb ... 1722s Unpacking libdconf1:armhf (0.40.0-4build2) ... 1722s Selecting previously unselected package dconf-service. 1722s Preparing to unpack .../155-dconf-service_0.40.0-4build2_armhf.deb ... 1722s Unpacking dconf-service (0.40.0-4build2) ... 1722s Selecting previously unselected package dconf-gsettings-backend:armhf. 1722s Preparing to unpack .../156-dconf-gsettings-backend_0.40.0-4build2_armhf.deb ... 1722s Unpacking dconf-gsettings-backend:armhf (0.40.0-4build2) ... 1722s Selecting previously unselected package libgtk-3-common. 1722s Preparing to unpack .../157-libgtk-3-common_3.24.43-3ubuntu2_all.deb ... 1722s Unpacking libgtk-3-common (3.24.43-3ubuntu2) ... 1722s Selecting previously unselected package libgtk-3-0t64:armhf. 1722s Preparing to unpack .../158-libgtk-3-0t64_3.24.43-3ubuntu2_armhf.deb ... 1722s Unpacking libgtk-3-0t64:armhf (3.24.43-3ubuntu2) ... 1722s Selecting previously unselected package libglvnd0:armhf. 1722s Preparing to unpack .../159-libglvnd0_1.7.0-1build1_armhf.deb ... 1722s Unpacking libglvnd0:armhf (1.7.0-1build1) ... 1722s Selecting previously unselected package libglapi-mesa:armhf. 1722s Preparing to unpack .../160-libglapi-mesa_24.2.3-1ubuntu1_armhf.deb ... 1722s Unpacking libglapi-mesa:armhf (24.2.3-1ubuntu1) ... 1722s Selecting previously unselected package libx11-xcb1:armhf. 1722s Preparing to unpack .../161-libx11-xcb1_2%3a1.8.10-2_armhf.deb ... 1722s Unpacking libx11-xcb1:armhf (2:1.8.10-2) ... 1722s Selecting previously unselected package libxcb-dri2-0:armhf. 1722s Preparing to unpack .../162-libxcb-dri2-0_1.17.0-2_armhf.deb ... 1722s Unpacking libxcb-dri2-0:armhf (1.17.0-2) ... 1722s Selecting previously unselected package libxcb-dri3-0:armhf. 1722s Preparing to unpack .../163-libxcb-dri3-0_1.17.0-2_armhf.deb ... 1722s Unpacking libxcb-dri3-0:armhf (1.17.0-2) ... 1723s Selecting previously unselected package libxcb-glx0:armhf. 1723s Preparing to unpack .../164-libxcb-glx0_1.17.0-2_armhf.deb ... 1723s Unpacking libxcb-glx0:armhf (1.17.0-2) ... 1723s Selecting previously unselected package libxcb-present0:armhf. 1723s Preparing to unpack .../165-libxcb-present0_1.17.0-2_armhf.deb ... 1723s Unpacking libxcb-present0:armhf (1.17.0-2) ... 1723s Selecting previously unselected package libxcb-randr0:armhf. 1723s Preparing to unpack .../166-libxcb-randr0_1.17.0-2_armhf.deb ... 1723s Unpacking libxcb-randr0:armhf (1.17.0-2) ... 1723s Selecting previously unselected package libxcb-sync1:armhf. 1723s Preparing to unpack .../167-libxcb-sync1_1.17.0-2_armhf.deb ... 1723s Unpacking libxcb-sync1:armhf (1.17.0-2) ... 1723s Selecting previously unselected package libxcb-xfixes0:armhf. 1723s Preparing to unpack .../168-libxcb-xfixes0_1.17.0-2_armhf.deb ... 1723s Unpacking libxcb-xfixes0:armhf (1.17.0-2) ... 1723s Selecting previously unselected package libxshmfence1:armhf. 1723s Preparing to unpack .../169-libxshmfence1_1.3-1build5_armhf.deb ... 1723s Unpacking libxshmfence1:armhf (1.3-1build5) ... 1723s Selecting previously unselected package libxxf86vm1:armhf. 1723s Preparing to unpack .../170-libxxf86vm1_1%3a1.1.4-1build4_armhf.deb ... 1723s Unpacking libxxf86vm1:armhf (1:1.1.4-1build4) ... 1723s Selecting previously unselected package libdrm-amdgpu1:armhf. 1723s Preparing to unpack .../171-libdrm-amdgpu1_2.4.123-1_armhf.deb ... 1723s Unpacking libdrm-amdgpu1:armhf (2.4.123-1) ... 1723s Selecting previously unselected package libdrm-radeon1:armhf. 1723s Preparing to unpack .../172-libdrm-radeon1_2.4.123-1_armhf.deb ... 1723s Unpacking libdrm-radeon1:armhf (2.4.123-1) ... 1723s Selecting previously unselected package libllvm19:armhf. 1723s Preparing to unpack .../173-libllvm19_1%3a19.1.2-1ubuntu1_armhf.deb ... 1723s Unpacking libllvm19:armhf (1:19.1.2-1ubuntu1) ... 1724s Selecting previously unselected package mesa-libgallium:armhf. 1724s Preparing to unpack .../174-mesa-libgallium_24.2.3-1ubuntu1_armhf.deb ... 1724s Unpacking mesa-libgallium:armhf (24.2.3-1ubuntu1) ... 1724s Selecting previously unselected package libvulkan1:armhf. 1724s Preparing to unpack .../175-libvulkan1_1.3.296.0-1_armhf.deb ... 1724s Unpacking libvulkan1:armhf (1.3.296.0-1) ... 1724s Selecting previously unselected package libwayland-server0:armhf. 1724s Preparing to unpack .../176-libwayland-server0_1.23.0-1_armhf.deb ... 1724s Unpacking libwayland-server0:armhf (1.23.0-1) ... 1724s Selecting previously unselected package libgbm1:armhf. 1724s Preparing to unpack .../177-libgbm1_24.2.3-1ubuntu1_armhf.deb ... 1724s Unpacking libgbm1:armhf (24.2.3-1ubuntu1) ... 1724s Selecting previously unselected package libgl1-mesa-dri:armhf. 1724s Preparing to unpack .../178-libgl1-mesa-dri_24.2.3-1ubuntu1_armhf.deb ... 1724s Unpacking libgl1-mesa-dri:armhf (24.2.3-1ubuntu1) ... 1724s Selecting previously unselected package libglx-mesa0:armhf. 1724s Preparing to unpack .../179-libglx-mesa0_24.2.3-1ubuntu1_armhf.deb ... 1724s Unpacking libglx-mesa0:armhf (24.2.3-1ubuntu1) ... 1724s Selecting previously unselected package libglx0:armhf. 1724s Preparing to unpack .../180-libglx0_1.7.0-1build1_armhf.deb ... 1724s Unpacking libglx0:armhf (1.7.0-1build1) ... 1724s Selecting previously unselected package libgl1:armhf. 1724s Preparing to unpack .../181-libgl1_1.7.0-1build1_armhf.deb ... 1724s Unpacking libgl1:armhf (1.7.0-1build1) ... 1724s Selecting previously unselected package libasound2-data. 1724s Preparing to unpack .../182-libasound2-data_1.2.12-1_all.deb ... 1724s Unpacking libasound2-data (1.2.12-1) ... 1724s Selecting previously unselected package libasound2t64:armhf. 1724s Preparing to unpack .../183-libasound2t64_1.2.12-1_armhf.deb ... 1724s Unpacking libasound2t64:armhf (1.2.12-1) ... 1724s Selecting previously unselected package libgif7:armhf. 1724s Preparing to unpack .../184-libgif7_5.2.2-1ubuntu1_armhf.deb ... 1724s Unpacking libgif7:armhf (5.2.2-1ubuntu1) ... 1724s Selecting previously unselected package libxtst6:armhf. 1725s Preparing to unpack .../185-libxtst6_2%3a1.2.3-1.1build1_armhf.deb ... 1725s Unpacking libxtst6:armhf (2:1.2.3-1.1build1) ... 1725s Selecting previously unselected package openjdk-21-jre:armhf. 1725s Preparing to unpack .../186-openjdk-21-jre_21.0.5+11-1_armhf.deb ... 1725s Unpacking openjdk-21-jre:armhf (21.0.5+11-1) ... 1725s Selecting previously unselected package default-jre. 1725s Preparing to unpack .../187-default-jre_2%3a1.21-76_armhf.deb ... 1725s Unpacking default-jre (2:1.21-76) ... 1725s Selecting previously unselected package libapksig-java. 1725s Preparing to unpack .../188-libapksig-java_31.0.2-2_all.deb ... 1725s Unpacking libapksig-java (31.0.2-2) ... 1725s Selecting previously unselected package apksigner. 1725s Preparing to unpack .../189-apksigner_31.0.2-2_all.deb ... 1725s Unpacking apksigner (31.0.2-2) ... 1725s Selecting previously unselected package openjdk-21-jdk-headless:armhf. 1725s Preparing to unpack .../190-openjdk-21-jdk-headless_21.0.5+11-1_armhf.deb ... 1725s Unpacking openjdk-21-jdk-headless:armhf (21.0.5+11-1) ... 1725s Selecting previously unselected package default-jdk-headless. 1725s Preparing to unpack .../191-default-jdk-headless_2%3a1.21-76_armhf.deb ... 1725s Unpacking default-jdk-headless (2:1.21-76) ... 1725s Selecting previously unselected package python3-args. 1725s Preparing to unpack .../192-python3-args_0.1.0-5_all.deb ... 1725s Unpacking python3-args (0.1.0-5) ... 1725s Selecting previously unselected package python3-clint. 1725s Preparing to unpack .../193-python3-clint_0.5.1-4_all.deb ... 1725s Unpacking python3-clint (0.5.1-4) ... 1725s Selecting previously unselected package python3-defusedxml. 1725s Preparing to unpack .../194-python3-defusedxml_0.7.1-2_all.deb ... 1725s Unpacking python3-defusedxml (0.7.1-2) ... 1725s Selecting previously unselected package liberror-perl. 1725s Preparing to unpack .../195-liberror-perl_0.17029-2_all.deb ... 1725s Unpacking liberror-perl (0.17029-2) ... 1725s Selecting previously unselected package git-man. 1725s Preparing to unpack .../196-git-man_1%3a2.45.2-1.2ubuntu1_all.deb ... 1725s Unpacking git-man (1:2.45.2-1.2ubuntu1) ... 1725s Selecting previously unselected package git. 1725s Preparing to unpack .../197-git_1%3a2.45.2-1.2ubuntu1_armhf.deb ... 1725s Unpacking git (1:2.45.2-1.2ubuntu1) ... 1726s Selecting previously unselected package python3-smmap. 1726s Preparing to unpack .../198-python3-smmap_6.0.0-1_all.deb ... 1726s Unpacking python3-smmap (6.0.0-1) ... 1726s Selecting previously unselected package python3-gitdb. 1726s Preparing to unpack .../199-python3-gitdb_4.0.11-1_all.deb ... 1726s Unpacking python3-gitdb (4.0.11-1) ... 1726s Selecting previously unselected package python3-git. 1726s Preparing to unpack .../200-python3-git_3.1.37-3_all.deb ... 1726s Unpacking python3-git (3.1.37-3) ... 1726s Selecting previously unselected package python3-bcrypt. 1726s Preparing to unpack .../201-python3-bcrypt_4.2.0-1_armhf.deb ... 1726s Unpacking python3-bcrypt (4.2.0-1) ... 1726s Selecting previously unselected package libsodium23:armhf. 1726s Preparing to unpack .../202-libsodium23_1.0.18-1build3_armhf.deb ... 1726s Unpacking libsodium23:armhf (1.0.18-1build3) ... 1726s Selecting previously unselected package python3-nacl. 1726s Preparing to unpack .../203-python3-nacl_1.5.0-6_armhf.deb ... 1726s Unpacking python3-nacl (1.5.0-6) ... 1726s Selecting previously unselected package python3-paramiko. 1726s Preparing to unpack .../204-python3-paramiko_3.4.0-1ubuntu2_all.deb ... 1726s Unpacking python3-paramiko (3.4.0-1ubuntu2) ... 1726s Selecting previously unselected package python3-platformdirs. 1726s Preparing to unpack .../205-python3-platformdirs_4.3.6-1_all.deb ... 1726s Unpacking python3-platformdirs (4.3.6-1) ... 1726s Selecting previously unselected package python3-png. 1726s Preparing to unpack .../206-python3-png_0.20231004.0-4_all.deb ... 1726s Unpacking python3-png (0.20231004.0-4) ... 1726s Selecting previously unselected package python3-qrcode. 1726s Preparing to unpack .../207-python3-qrcode_7.4.2-5_all.deb ... 1726s Unpacking python3-qrcode (7.4.2-5) ... 1726s Selecting previously unselected package python3-ruamel.yaml.clib:armhf. 1726s Preparing to unpack .../208-python3-ruamel.yaml.clib_0.2.8+ds-2_armhf.deb ... 1726s Unpacking python3-ruamel.yaml.clib:armhf (0.2.8+ds-2) ... 1726s Selecting previously unselected package python3-ruamel.yaml. 1726s Preparing to unpack .../209-python3-ruamel.yaml_0.18.6+ds-3_all.deb ... 1726s Unpacking python3-ruamel.yaml (0.18.6+ds-3) ... 1726s Selecting previously unselected package python3-looseversion. 1726s Preparing to unpack .../210-python3-looseversion_1.3.0-3_all.deb ... 1726s Unpacking python3-looseversion (1.3.0-3) ... 1726s Selecting previously unselected package sdkmanager. 1726s Preparing to unpack .../211-sdkmanager_0.6.10-1_all.deb ... 1726s Unpacking sdkmanager (0.6.10-1) ... 1726s Selecting previously unselected package python3-pathspec. 1726s Preparing to unpack .../212-python3-pathspec_0.12.1-1_all.deb ... 1726s Unpacking python3-pathspec (0.12.1-1) ... 1726s Selecting previously unselected package yamllint. 1726s Preparing to unpack .../213-yamllint_1.35.1-2_all.deb ... 1726s Unpacking yamllint (1.35.1-2) ... 1726s Selecting previously unselected package python3-biplist. 1727s Preparing to unpack .../214-python3-biplist_1.0.3-5_all.deb ... 1727s Unpacking python3-biplist (1.0.3-5) ... 1727s Selecting previously unselected package python3-pycountry. 1727s Preparing to unpack .../215-python3-pycountry_24.6.1+ds1-1_all.deb ... 1727s Unpacking python3-pycountry (24.6.1+ds1-1) ... 1727s Selecting previously unselected package s3cmd. 1727s Preparing to unpack .../216-s3cmd_2.4.0-2_all.deb ... 1727s Unpacking s3cmd (2.4.0-2) ... 1727s Selecting previously unselected package fdroidserver. 1727s Preparing to unpack .../217-fdroidserver_2.3~a2-1_all.deb ... 1727s Unpacking fdroidserver (2.3~a2-1) ... 1727s Selecting previously unselected package autopkgtest-satdep. 1727s Preparing to unpack .../218-2-autopkgtest-satdep.deb ... 1727s Unpacking autopkgtest-satdep (0) ... 1727s Setting up libgraphite2-3:armhf (1.3.14-2ubuntu1) ... 1727s Setting up libxcb-dri3-0:armhf (1.17.0-2) ... 1727s Setting up liblcms2-2:armhf (2.16-2) ... 1727s Setting up libpixman-1-0:armhf (0.44.0-3) ... 1727s Setting up libllvm19:armhf (1:19.1.2-1ubuntu1) ... 1727s Setting up libsharpyuv0:armhf (1.4.0-0.1) ... 1727s Setting up libwayland-server0:armhf (1.23.0-1) ... 1727s Setting up libaom3:armhf (3.11.0~rc1-1) ... 1727s Setting up libx11-xcb1:armhf (2:1.8.10-2) ... 1727s Setting up python3-pure-eval (0.2.3-1) ... 1727s Setting up libsodium23:armhf (1.0.18-1build3) ... 1727s Setting up libxdamage1:armhf (1:1.1.6-1build1) ... 1727s Setting up libxcb-xfixes0:armhf (1.17.0-2) ... 1727s Setting up liblerc4:armhf (4.0.0+ds-4ubuntu2) ... 1727s Setting up libxpm4:armhf (1:3.5.17-1build2) ... 1727s Setting up hicolor-icon-theme (0.18-1) ... 1727s Setting up libxi6:armhf (2:1.8.2-1) ... 1727s Setting up java-common (0.76) ... 1727s Setting up libxrender1:armhf (1:0.9.10-1.1build1) ... 1727s Setting up libdatrie1:armhf (0.2.13-3build1) ... 1727s Setting up python3-parso (0.8.3-1) ... 1727s Setting up python3-colorama (0.4.6-4) ... 1727s Setting up python3-lz4 (4.0.2+dfsg-1build4) ... 1728s Setting up libxcb-render0:armhf (1.17.0-2) ... 1728s Setting up python3-defusedxml (0.7.1-2) ... 1728s Setting up python3-asttokens (2.4.1-2) ... 1728s Setting up libdrm-radeon1:armhf (2.4.123-1) ... 1728s Setting up libglvnd0:armhf (1.7.0-1build1) ... 1728s Setting up python3-unicodedata2 (15.1.0+ds-1build1) ... 1728s Setting up fonts-lyx (2.4.2.1-1) ... 1728s Setting up libxcb-glx0:armhf (1.17.0-2) ... 1728s Setting up python3-bcrypt (4.2.0-1) ... 1728s Setting up liblab-gamut1:armhf (2.42.4-2build3) ... 1728s Setting up libgdk-pixbuf2.0-common (2.42.12+dfsg-1) ... 1728s Setting up python3-ruamel.yaml.clib:armhf (0.2.8+ds-2) ... 1728s Setting up x11-common (1:7.7+23ubuntu3) ... 1728s Setting up libdeflate0:armhf (1.22-1) ... 1728s Setting up libqhull-r8.0:armhf (2020.2-6build1) ... 1728s Setting up libxcb-shm0:armhf (1.17.0-2) ... 1728s Setting up libgomp1:armhf (14.2.0-8ubuntu1) ... 1728s Setting up python3-click (8.1.7-2) ... 1729s Setting up python3-networkx (3.2.1-4ubuntu1) ... 1730s Setting up libjbig0:armhf (2.1-6.1ubuntu2) ... 1730s Setting up libcolord2:armhf (1.4.7-1build2) ... 1730s Setting up python3-platformdirs (4.3.6-1) ... 1730s Setting up python3-tz (2024.1-2) ... 1731s Setting up libxxf86vm1:armhf (1:1.1.4-1build4) ... 1731s Setting up python3-png (0.20231004.0-4) ... 1731s Setting up libxcb-present0:armhf (1.17.0-2) ... 1731s Setting up liberror-perl (0.17029-2) ... 1731s Setting up libdconf1:armhf (0.40.0-4build2) ... 1731s Setting up unicode-data (15.1.0-1) ... 1731s Setting up python3-six (1.16.0-7) ... 1731s Setting up libasound2-data (1.2.12-1) ... 1731s Setting up python3-decorator (5.1.1-5) ... 1731s Setting up libblas3:armhf (3.12.0-3build2) ... 1731s update-alternatives: using /usr/lib/arm-linux-gnueabihf/blas/libblas.so.3 to provide /usr/lib/arm-linux-gnueabihf/libblas.so.3 (libblas.so.3-arm-linux-gnueabihf) in auto mode 1731s Setting up python3-packaging (24.1-1) ... 1731s Setting up libasound2t64:armhf (1.2.12-1) ... 1731s Setting up python3-wcwidth (0.2.13+dfsg1-1) ... 1731s Setting up libfreetype6:armhf (2.13.3+dfsg-1) ... 1731s Setting up python3-args (0.1.0-5) ... 1731s Setting up libepoxy0:armhf (1.5.10-2) ... 1731s Setting up python3-typeshed (0.0~git20231111.6764465-3) ... 1731s Setting up libxfixes3:armhf (1:6.0.0-2build1) ... 1731s Setting up libxcb-sync1:armhf (1.17.0-2) ... 1731s Setting up python3-executing (2.1.0-0.1) ... 1732s Setting up libpathplan4:armhf (2.42.4-2build3) ... 1732s Setting up python3-brotli (1.1.0-2build2) ... 1732s Setting up libavahi-common-data:armhf (0.8-13ubuntu6) ... 1732s Setting up libatspi2.0-0t64:armhf (2.54.0-1) ... 1732s Setting up python3-cycler (0.12.1-1) ... 1732s Setting up python3-pycountry (24.6.1+ds1-1) ... 1732s Setting up libxinerama1:armhf (2:1.1.4-3build1) ... 1732s Setting up libimagequant0:armhf (2.18.0-1build1) ... 1732s Setting up fonts-dejavu-mono (2.37-8) ... 1732s Setting up python3-kiwisolver (1.4.7-2) ... 1732s Setting up libxrandr2:armhf (2:1.5.4-1) ... 1732s Setting up libtcl8.6:armhf (8.6.15+dfsg-2) ... 1732s Setting up fonts-dejavu-core (2.37-8) ... 1732s Setting up libpcsclite1:armhf (2.3.0-1) ... 1732s Setting up libjpeg-turbo8:armhf (2.1.5-2ubuntu2) ... 1732s Setting up libltdl7:armhf (2.4.7-7build1) ... 1732s Setting up libglapi-mesa:armhf (24.2.3-1ubuntu1) ... 1732s Setting up libgfortran5:armhf (14.2.0-8ubuntu1) ... 1732s Setting up libvulkan1:armhf (1.3.296.0-1) ... 1732s Setting up libwebp7:armhf (1.4.0-0.1) ... 1732s Setting up libxcb-dri2-0:armhf (1.17.0-2) ... 1732s Setting up python3-ruamel.yaml (0.18.6+ds-3) ... 1732s Setting up libgif7:armhf (5.2.2-1ubuntu1) ... 1732s Setting up python3-looseversion (1.3.0-3) ... 1733s Setting up libxshmfence1:armhf (1.3-1build5) ... 1733s Setting up at-spi2-common (2.54.0-1) ... 1733s Setting up libxcb-randr0:armhf (1.17.0-2) ... 1733s Setting up python3-traitlets (5.14.3+really5.14.3-1) ... 1733s Setting up libxslt1.1:armhf (1.1.39-0exp1ubuntu1) ... 1733s Setting up libopenjp2-7:armhf (2.5.0-2ubuntu1) ... 1733s Setting up git-man (1:2.45.2-1.2ubuntu1) ... 1733s Setting up libharfbuzz0b:armhf (10.0.1-1) ... 1733s Setting up libthai-data (0.1.29-2build1) ... 1733s Setting up python3-dateutil (2.9.0-2) ... 1733s Setting up libgts-0.7-5t64:armhf (0.7.6+darcs121130-5.2build1) ... 1733s Setting up libcdt5:armhf (2.42.4-2build3) ... 1733s Setting up libcgraph6:armhf (2.42.4-2build3) ... 1733s Setting up libwayland-egl1:armhf (1.23.0-1) ... 1733s Setting up libxss1:armhf (1:1.2.3-1build3) ... 1733s Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 1733s Setting up ca-certificates-java (20240118) ... 1733s No JRE found. Skipping Java certificates setup. 1733s Setting up python3-biplist (1.0.3-5) ... 1733s Setting up python3-mpmath (1.3.0-1) ... 1734s Setting up libde265-0:armhf (1.0.15-1build4) ... 1734s Setting up python3-magic (2:0.4.27-3) ... 1734s Setting up python-matplotlib-data (3.8.3-3) ... 1734s Setting up libwebpmux3:armhf (1.4.0-0.1) ... 1734s Setting up python3-pathspec (0.12.1-1) ... 1734s Setting up python3-appdirs (1.4.4-4) ... 1734s Setting up python3-smmap (6.0.0-1) ... 1734s Setting up libxcomposite1:armhf (1:0.4.6-1) ... 1734s Setting up python3-stack-data (0.6.3-1) ... 1734s Setting up python3-asn1crypto (1.5.1-3) ... 1734s Setting up python3-nacl (1.5.0-6) ... 1735s Setting up libapksig-java (31.0.2-2) ... 1735s Setting up python3-ptyprocess (0.7.0-6) ... 1735s Setting up libdrm-amdgpu1:armhf (2.4.123-1) ... 1735s Setting up sdkmanager (0.6.10-1) ... 1735s Setting up libwayland-client0:armhf (1.23.0-1) ... 1735s Setting up libjpeg8:armhf (8c-2ubuntu11) ... 1735s Setting up python3-prompt-toolkit (3.0.48-1) ... 1735s Setting up python3-sympy (1.13.3-1) ... 1743s Setting up libice6:armhf (2:1.1.1-1) ... 1743s Setting up mesa-libgallium:armhf (24.2.3-1ubuntu1) ... 1743s Setting up liblapack3:armhf (3.12.0-3build2) ... 1743s update-alternatives: using /usr/lib/arm-linux-gnueabihf/lapack/liblapack.so.3 to provide /usr/lib/arm-linux-gnueabihf/liblapack.so.3 (liblapack.so.3-arm-linux-gnueabihf) in auto mode 1743s Setting up python3-clint (0.5.1-4) ... 1743s /usr/lib/python3/dist-packages/clint/packages/appdirs.py:82: SyntaxWarning: invalid escape sequence '\D' 1743s """Return full path to the user-shared data dir for this application. 1743s /usr/lib/python3/dist-packages/clint/packages/colorama/ansitowin32.py:43: SyntaxWarning: invalid escape sequence '\[' 1743s ANSI_RE = re.compile('\033\[((?:\d|;)*)([a-zA-Z])') 1743s /usr/lib/python3/dist-packages/clint/textui/colored.py:118: SyntaxWarning: invalid escape sequence '\$' 1743s strip = re.compile("([^-_a-zA-Z0-9!@#%&=,/'\";:~`\$\^\*\(\)\+\[\]\.\{\}\|\?\<\>\\]+|[^\s]+)") 1743s Setting up libatk1.0-0t64:armhf (2.54.0-1) ... 1743s Setting up openjdk-21-jre-headless:armhf (21.0.5+11-1) ... 1743s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/java to provide /usr/bin/java (java) in auto mode 1743s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode 1743s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode 1743s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode 1743s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode 1743s Setting up python3-jedi (0.19.1+ds1-1) ... 1743s Setting up libgbm1:armhf (24.2.3-1ubuntu1) ... 1743s Setting up fontconfig-config (2.15.0-1.1ubuntu2) ... 1743s Setting up libxtst6:armhf (2:1.2.3-1.1build1) ... 1743s Setting up libwebpdemux2:armhf (1.4.0-0.1) ... 1743s Setting up libxcursor1:armhf (1:1.2.2-1) ... 1743s Setting up libgl1-mesa-dri:armhf (24.2.3-1ubuntu1) ... 1743s Setting up libavahi-common3:armhf (0.8-13ubuntu6) ... 1743s Setting up dconf-service (0.40.0-4build2) ... 1743s Setting up python3-gitdb (4.0.11-1) ... 1744s Setting up s3cmd (2.4.0-2) ... 1744s /usr/lib/python3/dist-packages/S3/FileLists.py:525: SyntaxWarning: invalid escape sequence '\*' 1744s wildcard_split_result = re.split("\*|\?", uri_str, maxsplit=1) 1744s /usr/lib/python3/dist-packages/S3/S3Uri.py:122: SyntaxWarning: invalid escape sequence '\.' 1744s m = re.match("(.*\.)?s3(?:\-[^\.]*)?(?:\.dualstack)?(?:\.[^\.]*)?\.amazonaws\.com(?:\.cn)?$", 1744s /usr/lib/python3/dist-packages/S3/S3Uri.py:170: SyntaxWarning: invalid escape sequence '\w' 1744s _re = re.compile("^(\w+://)?(.*)", re.UNICODE) 1744s Setting up python3-matplotlib-inline (0.1.6-2) ... 1744s Setting up python3-fs (2.4.16-4) ... 1744s Setting up libthai0:armhf (0.1.29-2build1) ... 1744s Setting up yamllint (1.35.1-2) ... 1744s Setting up python3-oscrypto (1.3.0-7) ... 1745s Setting up libjs-jquery-ui (1.13.2+dfsg-1) ... 1745s Setting up python3-pexpect (4.9-2) ... 1745s Setting up libraqm0:armhf (0.10.1-1build1) ... 1745s Setting up git (1:2.45.2-1.2ubuntu1) ... 1745s Setting up python3-numpy (1:1.26.4+ds-11build1) ... 1747s Setting up libgvpr2:armhf (2.42.4-2build3) ... 1747s Setting up python3-lxml:armhf (5.3.0-1) ... 1747s Setting up libtiff6:armhf (4.5.1+git230720-4ubuntu4) ... 1747s Setting up libwayland-cursor0:armhf (1.23.0-1) ... 1747s Setting up libgdk-pixbuf-2.0-0:armhf (2.42.12+dfsg-1) ... 1747s Setting up python3-contourpy (1.3.0-2) ... 1748s Setting up libfontconfig1:armhf (2.15.0-1.1ubuntu2) ... 1748s Setting up python3-paramiko (3.4.0-1ubuntu2) ... 1748s Setting up libsm6:armhf (2:1.2.4-1) ... 1748s Setting up libavahi-client3:armhf (0.8-13ubuntu6) ... 1748s Setting up liblbfgsb0:armhf (3.0+dfsg.4-1build1) ... 1748s Setting up libatk-bridge2.0-0t64:armhf (2.54.0-1) ... 1748s Setting up gtk-update-icon-cache (4.16.5+ds-1) ... 1748s Setting up fontconfig (2.15.0-1.1ubuntu2) ... 1750s Regenerating fonts cache... done. 1750s Setting up libxft2:armhf (2.3.6-1build1) ... 1750s Setting up libglx-mesa0:armhf (24.2.3-1ubuntu1) ... 1750s Setting up python3-scipy (1.13.1-5) ... 1754s Setting up libglx0:armhf (1.7.0-1build1) ... 1754s Setting up dconf-gsettings-backend:armhf (0.40.0-4build2) ... 1754s Setting up libtk8.6:armhf (8.6.15-1) ... 1754s Setting up libpango-1.0-0:armhf (1.54.0+ds-3) ... 1754s Setting up python3.12-tk (3.12.7-3) ... 1754s Setting up libcairo2:armhf (1.18.2-2) ... 1754s Setting up python3.13-tk (3.13.0-2) ... 1754s Setting up python3-pil:armhf (10.4.0-1ubuntu1) ... 1754s Setting up libgl1:armhf (1.7.0-1build1) ... 1754s Setting up python3-ipython (8.20.0-1ubuntu1) ... 1755s Setting up python3-git (3.1.37-3) ... 1755s Setting up libxt6t64:armhf (1:1.2.1-1.2build1) ... 1755s Setting up libcairo-gobject2:armhf (1.18.2-2) ... 1755s Setting up python3-qrcode (7.4.2-5) ... 1755s update-alternatives: using /usr/bin/python3-qr to provide /usr/bin/qr (qr) in auto mode 1755s Setting up libpangoft2-1.0-0:armhf (1.54.0+ds-3) ... 1755s Setting up libcups2t64:armhf (2.4.10-1ubuntu2) ... 1755s Setting up libgtk-3-common (3.24.43-3ubuntu2) ... 1755s Setting up libpangocairo-1.0-0:armhf (1.54.0+ds-3) ... 1755s Setting up tk8.6-blt2.5 (2.5.3+dfsg-7build1) ... 1755s Setting up libxmu6:armhf (2:1.1.3-3build2) ... 1755s Setting up blt (2.5.3+dfsg-7build1) ... 1755s Setting up python3-tk:armhf (3.12.7-1) ... 1755s Setting up libxaw7:armhf (2:1.0.16-1) ... 1755s Setting up python3-pil.imagetk:armhf (10.4.0-1ubuntu1) ... 1755s Setting up python3-ufolib2 (0.16.1+dfsg1-1) ... 1756s Setting up libheif-plugin-aomdec:armhf (1.18.1-2) ... 1756s Setting up libheif-plugin-libde265:armhf (1.18.1-2) ... 1756s Setting up libheif1:armhf (1.18.1-2) ... 1756s Setting up python3-fonttools (4.46.0-1build2) ... 1757s Setting up adwaita-icon-theme (47.0-2) ... 1757s update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode 1757s Setting up libgd3:armhf (2.3.3-12ubuntu3) ... 1757s Setting up libgvc6 (2.42.4-2build3) ... 1757s Setting up graphviz (2.42.4-2build3) ... 1757s Setting up python3-matplotlib (3.8.3-3) ... 1758s Setting up python3-pydot (2.0.0-3) ... 1759s Setting up androguard (3.4.0~a1-15) ... 1759s /usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:1027: SyntaxWarning: invalid escape sequence '\>' 1759s """ 1759s Setting up humanity-icon-theme (0.6.16) ... 1759s Setting up ubuntu-mono (24.04-0ubuntu1) ... 1759s Processing triggers for man-db (2.12.1-3) ... 1760s Processing triggers for libglib2.0-0t64:armhf (2.82.1-0ubuntu1) ... 1760s Setting up libgtk-3-0t64:armhf (3.24.43-3ubuntu2) ... 1760s Processing triggers for libc-bin (2.40-1ubuntu3) ... 1760s Processing triggers for ca-certificates-java (20240118) ... 1761s Adding debian:ACCVRAIZ1.pem 1761s Adding debian:AC_RAIZ_FNMT-RCM.pem 1761s Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem 1761s Adding debian:ANF_Secure_Server_Root_CA.pem 1761s Adding debian:Actalis_Authentication_Root_CA.pem 1761s Adding debian:AffirmTrust_Commercial.pem 1761s Adding debian:AffirmTrust_Networking.pem 1761s Adding debian:AffirmTrust_Premium.pem 1761s Adding debian:AffirmTrust_Premium_ECC.pem 1761s Adding debian:Amazon_Root_CA_1.pem 1761s Adding debian:Amazon_Root_CA_2.pem 1761s Adding debian:Amazon_Root_CA_3.pem 1761s Adding debian:Amazon_Root_CA_4.pem 1761s Adding debian:Atos_TrustedRoot_2011.pem 1761s Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem 1761s Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem 1761s Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem 1761s Adding debian:BJCA_Global_Root_CA1.pem 1761s Adding debian:BJCA_Global_Root_CA2.pem 1761s Adding debian:Baltimore_CyberTrust_Root.pem 1761s Adding debian:Buypass_Class_2_Root_CA.pem 1761s Adding debian:Buypass_Class_3_Root_CA.pem 1761s Adding debian:CA_Disig_Root_R2.pem 1761s Adding debian:CFCA_EV_ROOT.pem 1761s Adding debian:COMODO_Certification_Authority.pem 1761s Adding debian:COMODO_ECC_Certification_Authority.pem 1761s Adding debian:COMODO_RSA_Certification_Authority.pem 1761s Adding debian:Certainly_Root_E1.pem 1761s Adding debian:Certainly_Root_R1.pem 1761s Adding debian:Certigna.pem 1761s Adding debian:Certigna_Root_CA.pem 1761s Adding debian:Certum_EC-384_CA.pem 1761s Adding debian:Certum_Trusted_Network_CA.pem 1761s Adding debian:Certum_Trusted_Network_CA_2.pem 1761s Adding debian:Certum_Trusted_Root_CA.pem 1761s Adding debian:CommScope_Public_Trust_ECC_Root-01.pem 1761s Adding debian:CommScope_Public_Trust_ECC_Root-02.pem 1761s Adding debian:CommScope_Public_Trust_RSA_Root-01.pem 1761s Adding debian:CommScope_Public_Trust_RSA_Root-02.pem 1761s Adding debian:Comodo_AAA_Services_root.pem 1761s Adding debian:D-TRUST_BR_Root_CA_1_2020.pem 1761s Adding debian:D-TRUST_EV_Root_CA_1_2020.pem 1761s Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem 1761s Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem 1761s Adding debian:DigiCert_Assured_ID_Root_CA.pem 1761s Adding debian:DigiCert_Assured_ID_Root_G2.pem 1761s Adding debian:DigiCert_Assured_ID_Root_G3.pem 1761s Adding debian:DigiCert_Global_Root_CA.pem 1761s Adding debian:DigiCert_Global_Root_G2.pem 1761s Adding debian:DigiCert_Global_Root_G3.pem 1761s Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem 1761s Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem 1761s Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem 1761s Adding debian:DigiCert_Trusted_Root_G4.pem 1761s Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem 1761s Adding debian:Entrust_Root_Certification_Authority.pem 1761s Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem 1761s Adding debian:Entrust_Root_Certification_Authority_-_G2.pem 1761s Adding debian:Entrust_Root_Certification_Authority_-_G4.pem 1761s Adding debian:GDCA_TrustAUTH_R5_ROOT.pem 1761s Adding debian:GLOBALTRUST_2020.pem 1761s Adding debian:GTS_Root_R1.pem 1761s Adding debian:GTS_Root_R2.pem 1761s Adding debian:GTS_Root_R3.pem 1761s Adding debian:GTS_Root_R4.pem 1761s Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem 1761s Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem 1761s Adding debian:GlobalSign_Root_CA.pem 1761s Adding debian:GlobalSign_Root_CA_-_R3.pem 1761s Adding debian:GlobalSign_Root_CA_-_R6.pem 1761s Adding debian:GlobalSign_Root_E46.pem 1761s Adding debian:GlobalSign_Root_R46.pem 1761s Adding debian:Go_Daddy_Class_2_CA.pem 1761s Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem 1761s Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem 1761s Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem 1761s Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem 1761s Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem 1761s Adding debian:HiPKI_Root_CA_-_G1.pem 1761s Adding debian:Hongkong_Post_Root_CA_3.pem 1761s Adding debian:ISRG_Root_X1.pem 1761s Adding debian:ISRG_Root_X2.pem 1761s Adding debian:IdenTrust_Commercial_Root_CA_1.pem 1761s Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem 1761s Adding debian:Izenpe.com.pem 1761s Adding debian:Microsec_e-Szigno_Root_CA_2009.pem 1761s Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem 1761s Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem 1761s Adding debian:NAVER_Global_Root_Certification_Authority.pem 1761s Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem 1761s Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem 1761s Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem 1761s Adding debian:QuoVadis_Root_CA_1_G3.pem 1761s Adding debian:QuoVadis_Root_CA_2.pem 1761s Adding debian:QuoVadis_Root_CA_2_G3.pem 1761s Adding debian:QuoVadis_Root_CA_3.pem 1761s Adding debian:QuoVadis_Root_CA_3_G3.pem 1761s Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem 1761s Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem 1761s Adding debian:SSL.com_Root_Certification_Authority_ECC.pem 1761s Adding debian:SSL.com_Root_Certification_Authority_RSA.pem 1761s Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem 1761s Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem 1761s Adding debian:SZAFIR_ROOT_CA2.pem 1761s Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem 1761s Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem 1761s Adding debian:SecureSign_RootCA11.pem 1761s Adding debian:SecureTrust_CA.pem 1761s Adding debian:Secure_Global_CA.pem 1761s Adding debian:Security_Communication_ECC_RootCA1.pem 1761s Adding debian:Security_Communication_RootCA2.pem 1761s Adding debian:Security_Communication_RootCA3.pem 1761s Adding debian:Security_Communication_Root_CA.pem 1761s Adding debian:Starfield_Class_2_CA.pem 1761s Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem 1761s Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem 1761s Adding debian:SwissSign_Gold_CA_-_G2.pem 1761s Adding debian:SwissSign_Silver_CA_-_G2.pem 1761s Adding debian:T-TeleSec_GlobalRoot_Class_2.pem 1761s Adding debian:T-TeleSec_GlobalRoot_Class_3.pem 1761s Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem 1761s Adding debian:TWCA_Global_Root_CA.pem 1761s Adding debian:TWCA_Root_Certification_Authority.pem 1761s Adding debian:TeliaSonera_Root_CA_v1.pem 1761s Adding debian:Telia_Root_CA_v2.pem 1761s Adding debian:TrustAsia_Global_Root_CA_G3.pem 1761s Adding debian:TrustAsia_Global_Root_CA_G4.pem 1761s Adding debian:Trustwave_Global_Certification_Authority.pem 1761s Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem 1761s Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem 1761s Adding debian:TunTrust_Root_CA.pem 1761s Adding debian:UCA_Extended_Validation_Root.pem 1761s Adding debian:UCA_Global_G2_Root.pem 1761s Adding debian:USERTrust_ECC_Certification_Authority.pem 1761s Adding debian:USERTrust_RSA_Certification_Authority.pem 1761s Adding debian:XRamp_Global_CA_Root.pem 1761s Adding debian:certSIGN_ROOT_CA.pem 1761s Adding debian:certSIGN_Root_CA_G2.pem 1761s Adding debian:e-Szigno_Root_CA_2017.pem 1761s Adding debian:ePKI_Root_Certification_Authority.pem 1761s Adding debian:emSign_ECC_Root_CA_-_C3.pem 1761s Adding debian:emSign_ECC_Root_CA_-_G3.pem 1761s Adding debian:emSign_Root_CA_-_C1.pem 1761s Adding debian:emSign_Root_CA_-_G1.pem 1761s Adding debian:vTrus_ECC_Root_CA.pem 1761s Adding debian:vTrus_Root_CA.pem 1761s done. 1761s Setting up openjdk-21-jre:armhf (21.0.5+11-1) ... 1761s Setting up openjdk-21-jdk-headless:armhf (21.0.5+11-1) ... 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jar to provide /usr/bin/jar (jar) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javac to provide /usr/bin/javac (javac) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/javap to provide /usr/bin/javap (javap) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jps to provide /usr/bin/jps (jps) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode 1761s update-alternatives: using /usr/lib/jvm/java-21-openjdk-armhf/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode 1761s Setting up default-jre-headless (2:1.21-76) ... 1761s Setting up apksigner (31.0.2-2) ... 1761s Setting up fdroidserver (2.3~a2-1) ... 1761s Setting up default-jre (2:1.21-76) ... 1761s Setting up default-jdk-headless (2:1.21-76) ... 1761s Setting up autopkgtest-satdep (0) ... 1798s (Reading database ... 95807 files and directories currently installed.) 1798s Removing autopkgtest-satdep (0) ... 1812s autopkgtest [23:21:17]: test locales: [----------------------- 1814s + LC_ALL=bo fdroid update --help 1814s + grep པ 1814s + LC_ALL=de fdroid update --help 1814s + grep gewöhnlich 1815s + LC_ALL=en fdroid update --help 1815s + grep show this help 1815s + LC_ALL=es fdroid update --help 1815s + grep información 1816s + LC_ALL=fr fdroid update --help 1816s + grep métadonnées 1816s + LC_ALL=hu fdroid update --help 1816s + grep Metaadatfájl 1817s + LC_ALL=ko fdroid update --help 1817s + grep 명 1817s + LC_ALL=ru fdroid update --help 1817s + grep неподписанны 1818s + LC_ALL=uk fdroid update --help 1818s + grep репозитор 1819s + LC_ALL=zh_Hans fdroid update --help 1819s + grep 签 1819s + LC_ALL=zh_Hant fdroid update --help 1819s + grep 簽 1820s autopkgtest [23:21:25]: test locales: -----------------------] 1824s autopkgtest [23:21:29]: test locales: - - - - - - - - - - results - - - - - - - - - - 1824s locales PASS 1828s autopkgtest [23:21:33]: @@@@@@@@@@@@@@@@@@@@ summary 1828s command1 PASS 1828s locales PASS