0s autopkgtest [04:44:21]: starting date and time: 2025-02-22 04:44:21+0000 0s autopkgtest [04:44:21]: git checkout: 325255d2 Merge branch 'pin-any-arch' into 'ubuntu/production' 0s autopkgtest [04:44:21]: host juju-7f2275-prod-proposed-migration-environment-9; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.ua0w2jb9/out --timeout-copy=6000 --setup-commands 'ln -s /dev/null /etc/systemd/system/bluetooth.service; printf "http_proxy=http://squid.internal:3128\nhttps_proxy=http://squid.internal:3128\nno_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com,radosgw.ps5.canonical.com\n" >> /etc/environment' --apt-pocket=proposed=src:glib2.0 --apt-upgrade exonerate --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=glib2.0/2.83.4-1 -- lxd -r lxd-armhf-10.145.243.28 lxd-armhf-10.145.243.28:autopkgtest/ubuntu/plucky/armhf 56s autopkgtest [04:45:17]: testbed dpkg architecture: armhf 59s autopkgtest [04:45:20]: testbed apt version: 2.9.14ubuntu1 63s autopkgtest [04:45:24]: @@@@@@@@@@@@@@@@@@@@ test bed setup 66s autopkgtest [04:45:27]: testbed release detected to be: None 75s autopkgtest [04:45:36]: updating testbed package index (apt update) 77s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [110 kB] 77s Get:2 http://ftpmaster.internal/ubuntu plucky InRelease [249 kB] 78s Get:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease [110 kB] 78s Get:4 http://ftpmaster.internal/ubuntu plucky-security InRelease [110 kB] 78s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [3120 B] 78s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [13.5 kB] 78s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [508 kB] 78s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [80.1 kB] 78s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Packages [125 kB] 78s Get:10 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf Components [26.6 kB] 78s Get:11 http://ftpmaster.internal/ubuntu plucky-proposed/restricted armhf Packages [760 B] 78s Get:12 http://ftpmaster.internal/ubuntu plucky-proposed/restricted armhf Components [216 B] 78s Get:13 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Packages [424 kB] 78s Get:14 http://ftpmaster.internal/ubuntu plucky-proposed/universe armhf Components [213 kB] 78s Get:15 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Packages [1796 B] 78s Get:16 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse armhf Components [1076 B] 78s Get:17 http://ftpmaster.internal/ubuntu plucky/multiverse Sources [298 kB] 78s Get:18 http://ftpmaster.internal/ubuntu plucky/main Sources [1384 kB] 79s Get:19 http://ftpmaster.internal/ubuntu plucky/restricted Sources [16.3 kB] 79s Get:20 http://ftpmaster.internal/ubuntu plucky/universe Sources [21.0 MB] 87s Get:21 http://ftpmaster.internal/ubuntu plucky/main armhf Packages [1370 kB] 87s Get:22 http://ftpmaster.internal/ubuntu plucky/main armhf Components [401 kB] 88s Get:23 http://ftpmaster.internal/ubuntu plucky/restricted armhf Packages [2900 B] 88s Get:24 http://ftpmaster.internal/ubuntu plucky/restricted armhf Components [196 B] 88s Get:25 http://ftpmaster.internal/ubuntu plucky/universe armhf Packages [15.1 MB] 93s Get:26 http://ftpmaster.internal/ubuntu plucky/universe armhf Components [3953 kB] 95s Get:27 http://ftpmaster.internal/ubuntu plucky/multiverse armhf Packages [173 kB] 95s Get:28 http://ftpmaster.internal/ubuntu plucky/multiverse armhf Components [39.8 kB] 95s Get:29 http://ftpmaster.internal/ubuntu plucky-updates/main armhf Components [208 B] 95s Get:30 http://ftpmaster.internal/ubuntu plucky-updates/restricted armhf Components [212 B] 95s Get:31 http://ftpmaster.internal/ubuntu plucky-updates/universe armhf Components [212 B] 95s Get:32 http://ftpmaster.internal/ubuntu plucky-updates/multiverse armhf Components [212 B] 95s Get:33 http://ftpmaster.internal/ubuntu plucky-security/main armhf Components [204 B] 95s Get:34 http://ftpmaster.internal/ubuntu plucky-security/restricted armhf Components [208 B] 95s Get:35 http://ftpmaster.internal/ubuntu plucky-security/universe armhf Components [208 B] 95s Get:36 http://ftpmaster.internal/ubuntu plucky-security/multiverse armhf Components [208 B] 99s Fetched 45.7 MB in 19s (2371 kB/s) 100s Reading package lists... 106s autopkgtest [04:46:07]: upgrading testbed (apt dist-upgrade and autopurge) 108s Reading package lists... 108s Building dependency tree... 108s Reading state information... 109s Calculating upgrade...Starting pkgProblemResolver with broken count: 0 109s Starting 2 pkgProblemResolver with broken count: 0 109s Done 110s Entering ResolveByKeep 110s 111s The following packages were automatically installed and are no longer required: 111s libapt-pkg6.0t64 libassuan0 libicu74 libnsl2 libpython3.12-minimal 111s libpython3.12-stdlib libunwind8 linux-headers-6.11.0-8 111s linux-headers-6.11.0-8-generic python3.12 python3.12-minimal 111s Use 'apt autoremove' to remove them. 111s The following NEW packages will be installed: 111s gcc-15-base libapt-pkg7.0 libicu76 libjemalloc2 libpython3.13-minimal 111s libpython3.13-stdlib linux-headers-6.12.0-15 linux-headers-6.12.0-15-generic 111s login.defs openssl-provider-legacy python3-bcrypt python3.13 111s python3.13-minimal 111s The following packages will be upgraded: 111s apparmor apport apport-core-dump-handler appstream apt apt-utils base-files 111s base-passwd bash bash-completion bind9-dnsutils bind9-host bind9-libs 111s binutils binutils-arm-linux-gnueabihf binutils-common bsdextrautils bsdutils 111s btrfs-progs busybox-initramfs busybox-static ca-certificates cloud-init 111s cloud-init-base console-setup console-setup-linux coreutils cron 111s cron-daemon-common cryptsetup-bin curl dash dbus dbus-bin dbus-daemon 111s dbus-session-bus-common dbus-system-bus-common dbus-user-session dhcpcd-base 111s diffutils dirmngr distro-info dmsetup dpkg dpkg-dev dracut-install e2fsprogs 111s e2fsprogs-l10n ed eject ethtool fdisk fwupd gcc-14-base gettext-base 111s gir1.2-girepository-2.0 gir1.2-glib-2.0 gir1.2-packagekitglib-1.0 gnupg 111s gnupg-l10n gnupg-utils gpg gpg-agent gpg-wks-client gpgconf gpgsm gpgv 111s groff-base gzip htop ibverbs-providers inetutils-telnet init 111s init-system-helpers initramfs-tools initramfs-tools-bin initramfs-tools-core 111s iproute2 iptables iputils-ping iputils-tracepath kbd keyboard-configuration 111s keyboxd kpartx krb5-locales libapparmor1 libappstream5 libapt-pkg6.0t64 111s libarchive13t64 libatomic1 libbinutils libblkid1 libblockdev-crypto3 111s libblockdev-fs3 libblockdev-loop3 libblockdev-mdraid3 libblockdev-nvme3 111s libblockdev-part3 libblockdev-swap3 libblockdev-utils3 libblockdev3 libbpf1 111s libc-bin libc6 libcap-ng0 libcbor0.10 libcom-err2 libcrypt1 libcryptsetup12 111s libctf-nobfd0 libctf0 libcurl3t64-gnutls libcurl4t64 libdbus-1-3 111s libdebconfclient0 libdevmapper1.02.1 libdpkg-perl libedit2 libext2fs2t64 111s libfdisk1 libffi8 libfribidi0 libftdi1-2 libfwupd3 libgcc-s1 111s libgirepository-1.0-1 libglib2.0-0t64 libglib2.0-bin libglib2.0-data 111s libgnutls30t64 libgpg-error-l10n libgpg-error0 libgpgme11t64 111s libgssapi-krb5-2 libgstreamer1.0-0 libgudev-1.0-0 libhogweed6t64 libibverbs1 111s libicu74 libip4tc2 libip6tc2 libjson-glib-1.0-0 libjson-glib-1.0-common 111s libk5crypto3 libkrb5-3 libkrb5support0 libldap-common libldap2 liblsof0 111s liblz4-1 libmaxminddb0 libmount1 libncurses6 libncursesw6 libnetplan1 111s libnettle8t64 libnewt0.52 libnftables1 libnftnl11 libnpth0t64 libnspr4 111s libnss-systemd libnss3 libnvme1t64 libp11-kit0 libpackagekit-glib2-18 111s libpam-systemd libpcap0.8t64 libperl5.40 libplymouth5 libpng16-16t64 111s libpolkit-agent-1-0 libpolkit-gobject-1-0 libprotobuf-c1 libpython3-stdlib 111s libpython3.12-minimal libpython3.12-stdlib libqmi-glib5 libqmi-proxy 111s libreadline8t64 libsasl2-2 libsasl2-modules libsasl2-modules-db libselinux1 111s libsemanage-common libsemanage2 libsframe1 libsmartcols1 libss2 libssl3t64 111s libstdc++6 libsystemd-shared libsystemd0 libtasn1-6 libtinfo6 libtraceevent1 111s libtraceevent1-plugin libudev1 libudisks2-0 libunistring5 liburcu8t64 111s libusb-1.0-0 libuuid1 libvolume-key1 libwrap0 libxdmcp6 libxkbcommon0 111s libxml2 libxtables12 libxxhash0 libyaml-0-2 libzstd1 linux-headers-generic 111s locales login logsave lshw lsof lto-disabled-list make mawk motd-news-config 111s mount multipath-tools nano ncurses-base ncurses-bin ncurses-term 111s netcat-openbsd netplan-generator netplan.io nftables openssl packagekit 111s packagekit-tools passwd pci.ids perl perl-base perl-modules-5.40 111s pinentry-curses plymouth plymouth-theme-ubuntu-text polkitd pollinate 111s powermgmt-base psmisc publicsuffix python-apt-common python-babel-localedata 111s python3 python3-apport python3-apt python3-attr python3-babel 111s python3-certifi python3-chardet python3-cryptography python3-distro-info 111s python3-gdbm python3-gi python3-idna python3-jinja2 python3-json-pointer 111s python3-jsonpatch python3-jsonschema python3-jwt python3-launchpadlib 111s python3-lazr.uri python3-minimal python3-more-itertools python3-netplan 111s python3-newt python3-oauthlib python3-openssl python3-pkg-resources 111s python3-problem-report python3-pygments python3-referencing python3-requests 111s python3-rich python3-setuptools python3-software-properties python3-urllib3 111s python3-wadllib python3.12 python3.12-gdbm python3.12-minimal 111s python3.13-gdbm readline-common rsync rsyslog software-properties-common 111s systemd systemd-cryptsetup systemd-resolved systemd-sysv systemd-timesyncd 111s sysvinit-utils tar telnet tmux tzdata ubuntu-minimal ubuntu-pro-client 111s ubuntu-pro-client-l10n ubuntu-standard ucf udev udisks2 ufw 111s unattended-upgrades usb.ids util-linux uuid-runtime vim-common vim-tiny 111s whiptail xauth xfsprogs xxd zstd 111s 323 upgraded, 13 newly installed, 0 to remove and 0 not upgraded. 111s Need to get 148 MB of archives. 111s After this operation, 204 MB of additional disk space will be used. 111s Get:1 http://ftpmaster.internal/ubuntu plucky/main armhf motd-news-config all 13.6ubuntu1 [5168 B] 111s Get:2 http://ftpmaster.internal/ubuntu plucky/main armhf gcc-15-base armhf 15-20250213-1ubuntu1 [53.2 kB] 111s Get:3 http://ftpmaster.internal/ubuntu plucky/main armhf libgcc-s1 armhf 15-20250213-1ubuntu1 [40.6 kB] 112s Get:4 http://ftpmaster.internal/ubuntu plucky/main armhf libc6 armhf 2.40-4ubuntu1 [2866 kB] 112s Get:5 http://ftpmaster.internal/ubuntu plucky/main armhf libcrypt1 armhf 1:4.4.38-1 [91.7 kB] 112s Get:6 http://ftpmaster.internal/ubuntu plucky/main armhf base-files armhf 13.6ubuntu1 [75.3 kB] 112s Get:7 http://ftpmaster.internal/ubuntu plucky/main armhf bash armhf 5.2.37-1ubuntu1 [677 kB] 113s Get:8 http://ftpmaster.internal/ubuntu plucky/main armhf bsdutils armhf 1:2.40.2-14ubuntu1 [110 kB] 113s Get:9 http://ftpmaster.internal/ubuntu plucky/main armhf coreutils armhf 9.5-1ubuntu1 [1275 kB] 113s Get:10 http://ftpmaster.internal/ubuntu plucky/main armhf dash armhf 0.5.12-12ubuntu1 [87.4 kB] 113s Get:11 http://ftpmaster.internal/ubuntu plucky/main armhf diffutils armhf 1:3.10-2 [172 kB] 113s Get:12 http://ftpmaster.internal/ubuntu plucky/main armhf libxxhash0 armhf 0.8.3-2 [30.8 kB] 113s Get:13 http://ftpmaster.internal/ubuntu plucky/main armhf liblz4-1 armhf 1.10.0-3 [57.2 kB] 113s Get:14 http://ftpmaster.internal/ubuntu plucky/main armhf openssl-provider-legacy armhf 3.4.1-1ubuntu1 [29.5 kB] 113s Get:15 http://ftpmaster.internal/ubuntu plucky/main armhf libssl3t64 armhf 3.4.1-1ubuntu1 [1771 kB] 114s Get:16 http://ftpmaster.internal/ubuntu plucky/main armhf libzstd1 armhf 1.5.6+dfsg-2 [266 kB] 114s Get:17 http://ftpmaster.internal/ubuntu plucky/main armhf libstdc++6 armhf 15-20250213-1ubuntu1 [725 kB] 114s Get:18 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-timesyncd armhf 257.2-3ubuntu1 [42.1 kB] 114s Get:19 http://ftpmaster.internal/ubuntu plucky/main armhf dbus-session-bus-common all 1.16.0-1ubuntu1 [53.1 kB] 114s Get:20 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-sysv armhf 257.2-3ubuntu1 [11.9 kB] 114s Get:21 http://ftpmaster.internal/ubuntu plucky/main armhf libpam-systemd armhf 257.2-3ubuntu1 [238 kB] 114s Get:22 http://ftpmaster.internal/ubuntu plucky/main armhf dbus-user-session armhf 1.16.0-1ubuntu1 [9684 B] 114s Get:23 http://ftpmaster.internal/ubuntu plucky/main armhf libapparmor1 armhf 4.1.0~beta5-0ubuntu5 [48.7 kB] 114s Get:24 http://ftpmaster.internal/ubuntu plucky/main armhf libcap-ng0 armhf 0.8.5-4 [13.8 kB] 114s Get:25 http://ftpmaster.internal/ubuntu plucky/main armhf libselinux1 armhf 3.7-3ubuntu2 [73.2 kB] 114s Get:26 http://ftpmaster.internal/ubuntu plucky/main armhf dbus-system-bus-common all 1.16.0-1ubuntu1 [54.3 kB] 114s Get:27 http://ftpmaster.internal/ubuntu plucky/main armhf dbus-bin armhf 1.16.0-1ubuntu1 [37.9 kB] 114s Get:28 http://ftpmaster.internal/ubuntu plucky/main armhf dbus armhf 1.16.0-1ubuntu1 [28.1 kB] 114s Get:29 http://ftpmaster.internal/ubuntu plucky/main armhf dbus-daemon armhf 1.16.0-1ubuntu1 [111 kB] 114s Get:30 http://ftpmaster.internal/ubuntu plucky/main armhf libdbus-1-3 armhf 1.16.0-1ubuntu1 [162 kB] 114s Get:31 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-resolved armhf 257.2-3ubuntu1 [315 kB] 115s Get:32 http://ftpmaster.internal/ubuntu plucky/main armhf libncurses6 armhf 6.5+20250125-2 [88.8 kB] 115s Get:33 http://ftpmaster.internal/ubuntu plucky/main armhf libncursesw6 armhf 6.5+20250125-2 [118 kB] 115s Get:34 http://ftpmaster.internal/ubuntu plucky/main armhf libtinfo6 armhf 6.5+20250125-2 [91.9 kB] 115s Get:35 http://ftpmaster.internal/ubuntu plucky/main armhf bsdextrautils armhf 2.40.2-14ubuntu1 [94.2 kB] 115s Get:36 http://ftpmaster.internal/ubuntu plucky/main armhf eject armhf 2.40.2-14ubuntu1 [63.4 kB] 115s Get:37 http://ftpmaster.internal/ubuntu plucky/main armhf fdisk armhf 2.40.2-14ubuntu1 [157 kB] 115s Get:38 http://ftpmaster.internal/ubuntu plucky/main armhf libblkid1 armhf 2.40.2-14ubuntu1 [169 kB] 115s Get:39 http://ftpmaster.internal/ubuntu plucky/main armhf libmount1 armhf 2.40.2-14ubuntu1 [194 kB] 115s Get:40 http://ftpmaster.internal/ubuntu plucky/main armhf libsmartcols1 armhf 2.40.2-14ubuntu1 [137 kB] 115s Get:41 http://ftpmaster.internal/ubuntu plucky/main armhf libuuid1 armhf 2.40.2-14ubuntu1 [41.0 kB] 115s Get:42 http://ftpmaster.internal/ubuntu plucky/main armhf util-linux armhf 2.40.2-14ubuntu1 [1190 kB] 116s Get:43 http://ftpmaster.internal/ubuntu plucky/main armhf uuid-runtime armhf 2.40.2-14ubuntu1 [63.7 kB] 116s Get:44 http://ftpmaster.internal/ubuntu plucky/main armhf libfdisk1 armhf 2.40.2-14ubuntu1 [217 kB] 116s Get:45 http://ftpmaster.internal/ubuntu plucky/main armhf mount armhf 2.40.2-14ubuntu1 [158 kB] 116s Get:46 http://ftpmaster.internal/ubuntu plucky/main armhf readline-common all 8.2-6 [56.5 kB] 116s Get:47 http://ftpmaster.internal/ubuntu plucky/main armhf libreadline8t64 armhf 8.2-6 [131 kB] 116s Get:48 http://ftpmaster.internal/ubuntu plucky/main armhf systemd-cryptsetup armhf 257.2-3ubuntu1 [126 kB] 116s Get:49 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd-shared armhf 257.2-3ubuntu1 [2203 kB] 117s Get:50 http://ftpmaster.internal/ubuntu plucky/main armhf libnss-systemd armhf 257.2-3ubuntu1 [164 kB] 117s Get:51 http://ftpmaster.internal/ubuntu plucky/main armhf systemd armhf 257.2-3ubuntu1 [3028 kB] 119s Get:52 http://ftpmaster.internal/ubuntu plucky/main armhf udev armhf 257.2-3ubuntu1 [1402 kB] 120s Get:53 http://ftpmaster.internal/ubuntu plucky/main armhf libudev1 armhf 257.2-3ubuntu1 [193 kB] 121s Get:54 http://ftpmaster.internal/ubuntu plucky/main armhf libdevmapper1.02.1 armhf 2:1.02.201-1ubuntu1 [137 kB] 121s Get:55 http://ftpmaster.internal/ubuntu plucky/main armhf libcryptsetup12 armhf 2:2.7.5-1ubuntu2 [246 kB] 121s Get:56 http://ftpmaster.internal/ubuntu plucky/main armhf libsystemd0 armhf 257.2-3ubuntu1 [494 kB] 121s Get:57 http://ftpmaster.internal/ubuntu plucky/main armhf libapt-pkg6.0t64 armhf 2.9.29 [1086 kB] 122s Get:58 http://ftpmaster.internal/ubuntu plucky/main armhf tar armhf 1.35+dfsg-3.1 [240 kB] 122s Get:59 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg armhf 1.22.11ubuntu4 [1242 kB] 123s Get:60 http://ftpmaster.internal/ubuntu plucky/main armhf gzip armhf 1.13-1ubuntu2 [98.1 kB] 123s Get:61 http://ftpmaster.internal/ubuntu plucky/main armhf ncurses-bin armhf 6.5+20250125-2 [179 kB] 123s Get:62 http://ftpmaster.internal/ubuntu plucky/main armhf perl-modules-5.40 all 5.40.1-2 [3217 kB] 125s Get:63 http://ftpmaster.internal/ubuntu plucky/main armhf libperl5.40 armhf 5.40.1-2 [4135 kB] 128s Get:64 http://ftpmaster.internal/ubuntu plucky/main armhf perl armhf 5.40.1-2 [262 kB] 128s Get:65 http://ftpmaster.internal/ubuntu plucky/main armhf perl-base armhf 5.40.1-2 [1667 kB] 129s Get:66 http://ftpmaster.internal/ubuntu plucky/main armhf libdebconfclient0 armhf 0.274ubuntu1 [11.2 kB] 129s Get:67 http://ftpmaster.internal/ubuntu plucky/main armhf base-passwd armhf 3.6.6 [53.4 kB] 129s Get:68 http://ftpmaster.internal/ubuntu plucky/main armhf init-system-helpers all 1.68 [39.0 kB] 129s Get:69 http://ftpmaster.internal/ubuntu plucky/main armhf libc-bin armhf 2.40-4ubuntu1 [542 kB] 129s Get:70 http://ftpmaster.internal/ubuntu plucky/main armhf ncurses-base all 6.5+20250125-2 [25.8 kB] 129s Get:71 http://ftpmaster.internal/ubuntu plucky/main armhf ncurses-term all 6.5+20250125-2 [276 kB] 129s Get:72 http://ftpmaster.internal/ubuntu plucky/main armhf kbd armhf 2.7.1-2ubuntu1 [214 kB] 129s Get:73 http://ftpmaster.internal/ubuntu plucky/main armhf console-setup-linux all 1.226ubuntu3 [1880 kB] 130s Get:74 http://ftpmaster.internal/ubuntu plucky/main armhf console-setup all 1.226ubuntu3 [110 kB] 130s Get:75 http://ftpmaster.internal/ubuntu plucky/main armhf keyboard-configuration all 1.226ubuntu3 [212 kB] 131s Get:76 http://ftpmaster.internal/ubuntu plucky/main armhf sysvinit-utils armhf 3.14-1ubuntu1 [35.1 kB] 131s Get:77 http://ftpmaster.internal/ubuntu plucky/main armhf libapt-pkg7.0 armhf 2.9.30ubuntu1 [1067 kB] 131s Get:78 http://ftpmaster.internal/ubuntu plucky/main armhf apt armhf 2.9.30ubuntu1 [1392 kB] 132s Get:79 http://ftpmaster.internal/ubuntu plucky/main armhf apt-utils armhf 2.9.30ubuntu1 [214 kB] 132s Get:80 http://ftpmaster.internal/ubuntu plucky/main armhf libgpg-error-l10n all 1.51-3 [8800 B] 132s Get:81 http://ftpmaster.internal/ubuntu plucky/main armhf libgpg-error0 armhf 1.51-3 [64.8 kB] 132s Get:82 http://ftpmaster.internal/ubuntu plucky/main armhf libnpth0t64 armhf 1.8-2 [7572 B] 132s Get:83 http://ftpmaster.internal/ubuntu plucky/main armhf gpg-wks-client armhf 2.4.4-2ubuntu22 [87.5 kB] 132s Get:84 http://ftpmaster.internal/ubuntu plucky/main armhf dirmngr armhf 2.4.4-2ubuntu22 [347 kB] 132s Get:85 http://ftpmaster.internal/ubuntu plucky/main armhf gpgsm armhf 2.4.4-2ubuntu22 [242 kB] 133s Get:86 http://ftpmaster.internal/ubuntu plucky/main armhf gnupg-utils armhf 2.4.4-2ubuntu22 [159 kB] 133s Get:87 http://ftpmaster.internal/ubuntu plucky/main armhf gpg-agent armhf 2.4.4-2ubuntu22 [237 kB] 133s Get:88 http://ftpmaster.internal/ubuntu plucky/main armhf gpg armhf 2.4.4-2ubuntu22 [525 kB] 133s Get:89 http://ftpmaster.internal/ubuntu plucky/main armhf gpgconf armhf 2.4.4-2ubuntu22 [116 kB] 133s Get:90 http://ftpmaster.internal/ubuntu plucky/main armhf gnupg all 2.4.4-2ubuntu22 [359 kB] 133s Get:91 http://ftpmaster.internal/ubuntu plucky/main armhf keyboxd armhf 2.4.4-2ubuntu22 [111 kB] 134s Get:92 http://ftpmaster.internal/ubuntu plucky/main armhf pinentry-curses armhf 1.3.1-2ubuntu2 [40.6 kB] 134s Get:93 http://ftpmaster.internal/ubuntu plucky/main armhf libnettle8t64 armhf 3.10.1-1 [188 kB] 134s Get:94 http://ftpmaster.internal/ubuntu plucky/main armhf libhogweed6t64 armhf 3.10.1-1 [188 kB] 134s Get:95 http://ftpmaster.internal/ubuntu plucky/main armhf libffi8 armhf 3.4.7-1 [21.1 kB] 134s Get:96 http://ftpmaster.internal/ubuntu plucky/main armhf libp11-kit0 armhf 0.25.5-2ubuntu3 [261 kB] 134s Get:97 http://ftpmaster.internal/ubuntu plucky/main armhf libtasn1-6 armhf 4.20.0-2 [38.2 kB] 134s Get:98 http://ftpmaster.internal/ubuntu plucky/main armhf libunistring5 armhf 1.3-1 [583 kB] 134s Get:99 http://ftpmaster.internal/ubuntu plucky/main armhf libgnutls30t64 armhf 3.8.9-2ubuntu2 [961 kB] 135s Get:100 http://ftpmaster.internal/ubuntu plucky/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-8build1 [19.0 kB] 135s Get:101 http://ftpmaster.internal/ubuntu plucky/main armhf libsasl2-2 armhf 2.1.28+dfsg1-8build1 [49.9 kB] 135s Get:102 http://ftpmaster.internal/ubuntu plucky/main armhf libldap-common all 2.6.9+dfsg-1~exp2ubuntu1 [33.2 kB] 135s Get:103 http://ftpmaster.internal/ubuntu plucky/main armhf libldap2 armhf 2.6.9+dfsg-1~exp2ubuntu1 [177 kB] 135s Get:104 http://ftpmaster.internal/ubuntu plucky/main armhf gpgv armhf 2.4.4-2ubuntu22 [225 kB] 135s Get:105 http://ftpmaster.internal/ubuntu plucky/main armhf e2fsprogs-l10n all 1.47.2-1ubuntu1 [7030 B] 135s Get:106 http://ftpmaster.internal/ubuntu plucky/main armhf logsave armhf 1.47.2-1ubuntu1 [25.7 kB] 135s Get:107 http://ftpmaster.internal/ubuntu plucky/main armhf ubuntu-minimal armhf 1.547 [11.4 kB] 135s Get:108 http://ftpmaster.internal/ubuntu plucky/main armhf initramfs-tools all 0.145ubuntu2 [7948 B] 135s Get:109 http://ftpmaster.internal/ubuntu plucky/main armhf initramfs-tools-core all 0.145ubuntu2 [51.5 kB] 135s Get:110 http://ftpmaster.internal/ubuntu plucky/main armhf libext2fs2t64 armhf 1.47.2-1ubuntu1 [207 kB] 135s Get:111 http://ftpmaster.internal/ubuntu plucky/main armhf e2fsprogs armhf 1.47.2-1ubuntu1 [588 kB] 136s Get:112 http://ftpmaster.internal/ubuntu plucky/main armhf dhcpcd-base armhf 1:10.1.0-7 [188 kB] 136s Get:113 http://ftpmaster.internal/ubuntu plucky/main armhf init armhf 1.68 [6296 B] 136s Get:114 http://ftpmaster.internal/ubuntu plucky/main armhf libbpf1 armhf 1:1.5.0-2 [158 kB] 136s Get:115 http://ftpmaster.internal/ubuntu plucky/main armhf iptables armhf 1.8.11-2ubuntu1 [342 kB] 136s Get:116 http://ftpmaster.internal/ubuntu plucky/main armhf libip4tc2 armhf 1.8.11-2ubuntu1 [21.7 kB] 136s Get:117 http://ftpmaster.internal/ubuntu plucky/main armhf libip6tc2 armhf 1.8.11-2ubuntu1 [22.1 kB] 136s Get:118 http://ftpmaster.internal/ubuntu plucky/main armhf libnftnl11 armhf 1.2.8-1 [53.3 kB] 136s Get:119 http://ftpmaster.internal/ubuntu plucky/main armhf libxtables12 armhf 1.8.11-2ubuntu1 [33.0 kB] 136s Get:120 http://ftpmaster.internal/ubuntu plucky/main armhf iproute2 armhf 6.13.0-1ubuntu1 [1096 kB] 137s Get:121 http://ftpmaster.internal/ubuntu plucky/main armhf iputils-ping armhf 3:20240905-1ubuntu1 [45.0 kB] 137s Get:122 http://ftpmaster.internal/ubuntu plucky/main armhf locales all 2.40-4ubuntu1 [4224 kB] 139s Get:123 http://ftpmaster.internal/ubuntu plucky/main armhf login.defs all 1:4.16.0-7ubuntu1 [38.5 kB] 139s Get:124 http://ftpmaster.internal/ubuntu plucky/main armhf login armhf 1:4.16.0-2+really2.40.2-14ubuntu1 [85.0 kB] 139s Get:125 http://ftpmaster.internal/ubuntu plucky/main armhf mawk armhf 1.3.4.20250131-1 [119 kB] 139s Get:126 http://ftpmaster.internal/ubuntu plucky/main armhf netcat-openbsd armhf 1.228-1 [42.4 kB] 139s Get:127 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.13-minimal armhf 3.13.2-1 [868 kB] 139s Get:128 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-minimal armhf 3.13.2-1 [2012 kB] 140s Get:129 http://ftpmaster.internal/ubuntu plucky/main armhf python3-cryptography armhf 43.0.0-1 [925 kB] 141s Get:130 http://ftpmaster.internal/ubuntu plucky/main armhf python3-minimal armhf 3.13.1-1~exp2 [27.6 kB] 141s Get:131 http://ftpmaster.internal/ubuntu plucky/main armhf python3 armhf 3.13.1-1~exp2 [23.9 kB] 141s Get:132 http://ftpmaster.internal/ubuntu plucky/main armhf python3-bcrypt armhf 4.2.0-2.1 [239 kB] 141s Get:133 http://ftpmaster.internal/ubuntu plucky/main armhf tzdata all 2025a-2ubuntu1 [198 kB] 141s Get:134 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.13-stdlib armhf 3.13.2-1 [1969 kB] 141s Get:135 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13 armhf 3.13.2-1 [734 kB] 141s Get:136 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3-stdlib armhf 3.13.1-1~exp2 [10.2 kB] 141s Get:137 http://ftpmaster.internal/ubuntu plucky/main armhf gir1.2-girepository-2.0 armhf 1.82.0-4 [25.3 kB] 141s Get:138 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf gir1.2-glib-2.0 armhf 2.83.4-1 [185 kB] 141s Get:139 http://ftpmaster.internal/ubuntu plucky/main armhf libgirepository-1.0-1 armhf 1.82.0-4 [109 kB] 141s Get:140 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libglib2.0-data all 2.83.4-1 [52.9 kB] 141s Get:141 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libglib2.0-bin armhf 2.83.4-1 [92.7 kB] 141s Get:142 http://ftpmaster.internal/ubuntu plucky/main armhf libatomic1 armhf 15-20250213-1ubuntu1 [7938 B] 141s Get:143 http://ftpmaster.internal/ubuntu plucky-proposed/main armhf libglib2.0-0t64 armhf 2.83.4-1 [1453 kB] 142s Get:144 http://ftpmaster.internal/ubuntu plucky/main armhf netplan-generator armhf 1.1.2-2ubuntu1 [60.8 kB] 142s Get:145 http://ftpmaster.internal/ubuntu plucky/main armhf libyaml-0-2 armhf 0.2.5-2 [45.3 kB] 142s Get:146 http://ftpmaster.internal/ubuntu plucky/main armhf python3-netplan armhf 1.1.2-2ubuntu1 [24.2 kB] 142s Get:147 http://ftpmaster.internal/ubuntu plucky/main armhf netplan.io armhf 1.1.2-2ubuntu1 [67.7 kB] 142s Get:148 http://ftpmaster.internal/ubuntu plucky/main armhf libnetplan1 armhf 1.1.2-2ubuntu1 [123 kB] 142s Get:149 http://ftpmaster.internal/ubuntu plucky/main armhf ethtool armhf 1:6.11-1 [222 kB] 142s Get:150 http://ftpmaster.internal/ubuntu plucky/main armhf libsemanage-common all 3.7-2.1 [7198 B] 142s Get:151 http://ftpmaster.internal/ubuntu plucky/main armhf libsemanage2 armhf 3.7-2.1 [85.4 kB] 142s Get:152 http://ftpmaster.internal/ubuntu plucky/main armhf passwd armhf 1:4.16.0-7ubuntu1 [1041 kB] 142s Get:153 http://ftpmaster.internal/ubuntu plucky/main armhf ubuntu-pro-client-l10n armhf 34.1.3 [18.3 kB] 142s Get:154 http://ftpmaster.internal/ubuntu plucky/main armhf python-apt-common all 2.9.9 [21.2 kB] 142s Get:155 http://ftpmaster.internal/ubuntu plucky/main armhf python3-apt armhf 2.9.9 [173 kB] 142s Get:156 http://ftpmaster.internal/ubuntu plucky/main armhf distro-info armhf 1.13 [19.1 kB] 142s Get:157 http://ftpmaster.internal/ubuntu plucky/main armhf ubuntu-pro-client armhf 34.1.3 [243 kB] 142s Get:158 http://ftpmaster.internal/ubuntu plucky/main armhf vim-tiny armhf 2:9.1.0967-1ubuntu2 [696 kB] 142s Get:159 http://ftpmaster.internal/ubuntu plucky/main armhf vim-common all 2:9.1.0967-1ubuntu2 [396 kB] 142s Get:160 http://ftpmaster.internal/ubuntu plucky/main armhf python3-newt armhf 0.52.24-4ubuntu1 [20.1 kB] 142s Get:161 http://ftpmaster.internal/ubuntu plucky/main armhf libnewt0.52 armhf 0.52.24-4ubuntu1 [39.7 kB] 142s Get:162 http://ftpmaster.internal/ubuntu plucky/main armhf whiptail armhf 0.52.24-4ubuntu1 [17.3 kB] 142s Get:163 http://ftpmaster.internal/ubuntu plucky/main armhf dracut-install armhf 106-2ubuntu1 [38.7 kB] 142s Get:164 http://ftpmaster.internal/ubuntu plucky/main armhf initramfs-tools-bin armhf 0.145ubuntu2 [24.5 kB] 142s Get:165 http://ftpmaster.internal/ubuntu plucky/main armhf busybox-initramfs armhf 1:1.37.0-4ubuntu1 [188 kB] 142s Get:166 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12 armhf 3.12.9-1 [671 kB] 142s Get:167 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-stdlib armhf 3.12.9-1 [1946 kB] 142s Get:168 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-minimal armhf 3.12.9-1 [2012 kB] 143s Get:169 http://ftpmaster.internal/ubuntu plucky/main armhf libpython3.12-minimal armhf 3.12.9-1 [825 kB] 143s Get:170 http://ftpmaster.internal/ubuntu plucky/main armhf cron armhf 3.0pl1-192ubuntu1 [84.2 kB] 143s Get:171 http://ftpmaster.internal/ubuntu plucky/main armhf rsync armhf 3.4.1-0syncable1 [422 kB] 143s Get:172 http://ftpmaster.internal/ubuntu plucky/main armhf python3-lazr.uri all 1.0.6-5 [13.6 kB] 143s Get:173 http://ftpmaster.internal/ubuntu plucky/main armhf python3-launchpadlib all 2.1.0-1 [126 kB] 143s Get:174 http://ftpmaster.internal/ubuntu plucky/main armhf python3-problem-report all 2.31.0+git20250220-0ubuntu1 [26.0 kB] 143s Get:175 http://ftpmaster.internal/ubuntu plucky/main armhf python3-apport all 2.31.0+git20250220-0ubuntu1 [93.5 kB] 143s Get:176 http://ftpmaster.internal/ubuntu plucky/main armhf python3-gi armhf 3.50.0-4 [260 kB] 143s Get:177 http://ftpmaster.internal/ubuntu plucky/main armhf apport-core-dump-handler all 2.31.0+git20250220-0ubuntu1 [18.7 kB] 143s Get:178 http://ftpmaster.internal/ubuntu plucky/main armhf apport all 2.31.0+git20250220-0ubuntu1 [83.1 kB] 143s Get:179 http://ftpmaster.internal/ubuntu plucky/main armhf gcc-14-base armhf 14.2.0-17ubuntu3 [53.6 kB] 143s Get:180 http://ftpmaster.internal/ubuntu plucky/main armhf libcom-err2 armhf 1.47.2-1ubuntu1 [25.6 kB] 143s Get:181 http://ftpmaster.internal/ubuntu plucky/main armhf libss2 armhf 1.47.2-1ubuntu1 [15.6 kB] 143s Get:182 http://ftpmaster.internal/ubuntu plucky/main armhf openssl armhf 3.4.1-1ubuntu1 [1152 kB] 143s Get:183 http://ftpmaster.internal/ubuntu plucky/main armhf ca-certificates all 20241223 [165 kB] 143s Get:184 http://ftpmaster.internal/ubuntu plucky/main armhf krb5-locales all 1.21.3-4ubuntu1 [14.7 kB] 143s Get:185 http://ftpmaster.internal/ubuntu plucky/main armhf libfribidi0 armhf 1.0.16-1 [24.3 kB] 143s Get:186 http://ftpmaster.internal/ubuntu plucky/main armhf libgssapi-krb5-2 armhf 1.21.3-4ubuntu1 [121 kB] 143s Get:187 http://ftpmaster.internal/ubuntu plucky/main armhf libkrb5-3 armhf 1.21.3-4ubuntu1 [314 kB] 143s Get:188 http://ftpmaster.internal/ubuntu plucky/main armhf libkrb5support0 armhf 1.21.3-4ubuntu1 [31.8 kB] 143s Get:189 http://ftpmaster.internal/ubuntu plucky/main armhf libk5crypto3 armhf 1.21.3-4ubuntu1 [78.6 kB] 143s Get:190 http://ftpmaster.internal/ubuntu plucky/main armhf libicu74 armhf 74.2-1ubuntu6 [10.5 MB] 144s Get:191 http://ftpmaster.internal/ubuntu plucky/main armhf libxml2 armhf 2.12.7+dfsg+really2.9.14-0.2ubuntu3 [599 kB] 144s Get:192 http://ftpmaster.internal/ubuntu plucky/main armhf python3-pygments all 2.18.0+dfsg-2 [835 kB] 144s Get:193 http://ftpmaster.internal/ubuntu plucky/main armhf python3-rich all 13.9.4-1 [190 kB] 144s Get:194 http://ftpmaster.internal/ubuntu plucky/main armhf ucf all 3.0050 [43.5 kB] 144s Get:195 http://ftpmaster.internal/ubuntu plucky/main armhf rsyslog armhf 8.2412.0-2ubuntu1 [471 kB] 144s Get:196 http://ftpmaster.internal/ubuntu plucky/main armhf xxd armhf 2:9.1.0967-1ubuntu2 [67.5 kB] 144s Get:197 http://ftpmaster.internal/ubuntu plucky/main armhf apparmor armhf 4.1.0~beta5-0ubuntu5 [605 kB] 144s Get:198 http://ftpmaster.internal/ubuntu plucky/main armhf bash-completion all 1:2.16.0-7 [214 kB] 144s Get:199 http://ftpmaster.internal/ubuntu plucky/main armhf libjemalloc2 armhf 5.3.0-2build1 [200 kB] 144s Get:200 http://ftpmaster.internal/ubuntu plucky/main armhf libmaxminddb0 armhf 1.12.2-1 [16.9 kB] 144s Get:201 http://ftpmaster.internal/ubuntu plucky/main armhf liburcu8t64 armhf 0.15.1-1 [57.1 kB] 144s Get:202 http://ftpmaster.internal/ubuntu plucky/main armhf bind9-dnsutils armhf 1:9.20.4-3ubuntu1 [155 kB] 144s Get:203 http://ftpmaster.internal/ubuntu plucky/main armhf bind9-host armhf 1:9.20.4-3ubuntu1 [46.4 kB] 144s Get:204 http://ftpmaster.internal/ubuntu plucky/main armhf bind9-libs armhf 1:9.20.4-3ubuntu1 [1186 kB] 145s Get:205 http://ftpmaster.internal/ubuntu plucky/main armhf libedit2 armhf 3.1-20250104-1 [79.3 kB] 145s Get:206 http://ftpmaster.internal/ubuntu plucky/main armhf busybox-static armhf 1:1.37.0-4ubuntu1 [857 kB] 145s Get:207 http://ftpmaster.internal/ubuntu plucky/main armhf cron-daemon-common all 3.0pl1-192ubuntu1 [14.5 kB] 145s Get:208 http://ftpmaster.internal/ubuntu plucky/main armhf dmsetup armhf 2:1.02.201-1ubuntu1 [80.4 kB] 145s Get:209 http://ftpmaster.internal/ubuntu plucky/main armhf ed armhf 1.21-1 [52.8 kB] 145s Get:210 http://ftpmaster.internal/ubuntu plucky/main armhf gettext-base armhf 0.23.1-1 [43.3 kB] 145s Get:211 http://ftpmaster.internal/ubuntu plucky/main armhf groff-base armhf 1.23.0-7 [949 kB] 145s Get:212 http://ftpmaster.internal/ubuntu plucky/main armhf libibverbs1 armhf 55.0-1ubuntu1 [58.5 kB] 145s Get:213 http://ftpmaster.internal/ubuntu plucky/main armhf ibverbs-providers armhf 55.0-1ubuntu1 [27.6 kB] 145s Get:214 http://ftpmaster.internal/ubuntu plucky/main armhf inetutils-telnet armhf 2:2.5-6ubuntu1 [94.7 kB] 145s Get:215 http://ftpmaster.internal/ubuntu plucky/main armhf iputils-tracepath armhf 3:20240905-1ubuntu1 [13.3 kB] 145s Get:216 http://ftpmaster.internal/ubuntu plucky/main armhf libcbor0.10 armhf 0.10.2-2ubuntu1 [22.0 kB] 145s Get:217 http://ftpmaster.internal/ubuntu plucky/main armhf nftables armhf 1.1.1-1build1 [70.8 kB] 145s Get:218 http://ftpmaster.internal/ubuntu plucky/main armhf libnftables1 armhf 1.1.1-1build1 [321 kB] 145s Get:219 http://ftpmaster.internal/ubuntu plucky/main armhf libpcap0.8t64 armhf 1.10.5-2ubuntu1 [140 kB] 145s Get:220 http://ftpmaster.internal/ubuntu plucky/main armhf libpng16-16t64 armhf 1.6.46-4 [171 kB] 145s Get:221 http://ftpmaster.internal/ubuntu plucky/main armhf libxkbcommon0 armhf 1.7.0-2 [113 kB] 145s Get:222 http://ftpmaster.internal/ubuntu plucky/main armhf libplymouth5 armhf 24.004.60-2ubuntu5 [142 kB] 145s Get:223 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1-plugin armhf 1:1.8.4-2 [19.0 kB] 145s Get:224 http://ftpmaster.internal/ubuntu plucky/main armhf libtraceevent1 armhf 1:1.8.4-2 [53.8 kB] 145s Get:225 http://ftpmaster.internal/ubuntu plucky/main armhf libusb-1.0-0 armhf 2:1.0.27-2 [49.5 kB] 145s Get:226 http://ftpmaster.internal/ubuntu plucky/main armhf libxdmcp6 armhf 1:1.1.5-1 [9060 B] 145s Get:227 http://ftpmaster.internal/ubuntu plucky/main armhf lshw armhf 02.19.git.2021.06.19.996aaad9c7-2.1ubuntu1 [311 kB] 145s Get:228 http://ftpmaster.internal/ubuntu plucky/main armhf lsof armhf 4.99.4+dfsg-2 [239 kB] 145s Get:229 http://ftpmaster.internal/ubuntu plucky/main armhf liblsof0 armhf 4.99.4+dfsg-2 [60.8 kB] 145s Get:230 http://ftpmaster.internal/ubuntu plucky/main armhf nano armhf 8.3-1 [277 kB] 145s Get:231 http://ftpmaster.internal/ubuntu plucky/main armhf pci.ids all 0.0~2025.02.12-1 [284 kB] 145s Get:232 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-2ubuntu5 [9914 B] 145s Get:233 http://ftpmaster.internal/ubuntu plucky/main armhf libpackagekit-glib2-18 armhf 1.3.0-3build1 [109 kB] 145s Get:234 http://ftpmaster.internal/ubuntu plucky/main armhf packagekit-tools armhf 1.3.0-3build1 [28.0 kB] 145s Get:235 http://ftpmaster.internal/ubuntu plucky/main armhf polkitd armhf 126-2 [92.5 kB] 145s Get:236 http://ftpmaster.internal/ubuntu plucky/main armhf libpolkit-agent-1-0 armhf 126-2 [15.1 kB] 145s Get:237 http://ftpmaster.internal/ubuntu plucky/main armhf libpolkit-gobject-1-0 armhf 126-2 [45.0 kB] 145s Get:238 http://ftpmaster.internal/ubuntu plucky/main armhf libcurl3t64-gnutls armhf 8.12.0+git20250209.89ed161+ds-1ubuntu1 [330 kB] 145s Get:239 http://ftpmaster.internal/ubuntu plucky/main armhf libappstream5 armhf 1.0.4-1 [211 kB] 145s Get:240 http://ftpmaster.internal/ubuntu plucky/main armhf libgstreamer1.0-0 armhf 1.25.50-1 [1164 kB] 145s Get:241 http://ftpmaster.internal/ubuntu plucky/main armhf packagekit armhf 1.3.0-3build1 [431 kB] 145s Get:242 http://ftpmaster.internal/ubuntu plucky/main armhf plymouth armhf 24.004.60-2ubuntu5 [143 kB] 145s Get:243 http://ftpmaster.internal/ubuntu plucky/main armhf powermgmt-base all 1.38 [7378 B] 145s Get:244 http://ftpmaster.internal/ubuntu plucky/main armhf psmisc armhf 23.7-2 [177 kB] 145s Get:245 http://ftpmaster.internal/ubuntu plucky/main armhf publicsuffix all 20250108.1153-0.1 [134 kB] 145s Get:246 http://ftpmaster.internal/ubuntu plucky/main armhf python3-distro-info all 1.13 [7798 B] 145s Get:247 http://ftpmaster.internal/ubuntu plucky/main armhf python3.13-gdbm armhf 3.13.2-1 [30.2 kB] 145s Get:248 http://ftpmaster.internal/ubuntu plucky/main armhf python3.12-gdbm armhf 3.12.9-1 [29.3 kB] 145s Get:249 http://ftpmaster.internal/ubuntu plucky/main armhf python3-gdbm armhf 3.13.1-1 [8668 B] 145s Get:250 http://ftpmaster.internal/ubuntu plucky/main armhf telnet all 0.17+2.5-6ubuntu1 [3694 B] 145s Get:251 http://ftpmaster.internal/ubuntu plucky/main armhf ubuntu-standard armhf 1.547 [11.4 kB] 145s Get:252 http://ftpmaster.internal/ubuntu plucky/main armhf ufw all 0.36.2-9 [170 kB] 145s Get:253 http://ftpmaster.internal/ubuntu plucky/main armhf usb.ids all 2025.01.14-1 [223 kB] 145s Get:254 http://ftpmaster.internal/ubuntu plucky/main armhf xauth armhf 1:1.1.2-1.1 [23.0 kB] 145s Get:255 http://ftpmaster.internal/ubuntu plucky/main armhf appstream armhf 1.0.4-1 [67.3 kB] 145s Get:256 http://ftpmaster.internal/ubuntu plucky/main armhf libctf0 armhf 2.44-2ubuntu1 [74.3 kB] 145s Get:257 http://ftpmaster.internal/ubuntu plucky/main armhf libctf-nobfd0 armhf 2.44-2ubuntu1 [77.6 kB] 145s Get:258 http://ftpmaster.internal/ubuntu plucky/main armhf binutils-arm-linux-gnueabihf armhf 2.44-2ubuntu1 [995 kB] 145s Get:259 http://ftpmaster.internal/ubuntu plucky/main armhf libbinutils armhf 2.44-2ubuntu1 [405 kB] 146s Get:260 http://ftpmaster.internal/ubuntu plucky/main armhf binutils armhf 2.44-2ubuntu1 [3234 B] 146s Get:261 http://ftpmaster.internal/ubuntu plucky/main armhf binutils-common armhf 2.44-2ubuntu1 [215 kB] 146s Get:262 http://ftpmaster.internal/ubuntu plucky/main armhf libsframe1 armhf 2.44-2ubuntu1 [12.4 kB] 146s Get:263 http://ftpmaster.internal/ubuntu plucky/main armhf btrfs-progs armhf 6.12-1build1 [884 kB] 146s Get:264 http://ftpmaster.internal/ubuntu plucky/main armhf python3-certifi all 2025.1.31+ds-1 [9816 B] 146s Get:265 http://ftpmaster.internal/ubuntu plucky/main armhf python3-chardet all 5.2.0+dfsg-2 [116 kB] 146s Get:266 http://ftpmaster.internal/ubuntu plucky/main armhf python3-idna all 3.10-1 [47.4 kB] 146s Get:267 http://ftpmaster.internal/ubuntu plucky/main armhf python3-urllib3 all 2.3.0-1 [94.0 kB] 146s Get:268 http://ftpmaster.internal/ubuntu plucky/main armhf python3-requests all 2.32.3+dfsg-4ubuntu1 [52.9 kB] 146s Get:269 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jinja2 all 3.1.5-2 [109 kB] 146s Get:270 http://ftpmaster.internal/ubuntu plucky/main armhf python3-json-pointer all 2.4-3 [8444 B] 146s Get:271 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jsonpatch all 1.32-5 [12.3 kB] 146s Get:272 http://ftpmaster.internal/ubuntu plucky/main armhf python3-attr all 25.1.0-1 [50.4 kB] 146s Get:273 http://ftpmaster.internal/ubuntu plucky/main armhf python3-referencing all 0.35.1-2ubuntu1 [21.9 kB] 146s Get:274 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jsonschema all 4.19.2-6ubuntu1 [65.5 kB] 146s Get:275 http://ftpmaster.internal/ubuntu plucky/main armhf python3-jwt all 2.10.1-2 [21.0 kB] 146s Get:276 http://ftpmaster.internal/ubuntu plucky/main armhf python3-oauthlib all 3.2.2-3 [89.9 kB] 146s Get:277 http://ftpmaster.internal/ubuntu plucky/main armhf cloud-init-base all 25.1-0ubuntu1 [616 kB] 146s Get:278 http://ftpmaster.internal/ubuntu plucky/main armhf cryptsetup-bin armhf 2:2.7.5-1ubuntu2 [220 kB] 146s Get:279 http://ftpmaster.internal/ubuntu plucky/main armhf curl armhf 8.12.0+git20250209.89ed161+ds-1ubuntu1 [247 kB] 146s Get:280 http://ftpmaster.internal/ubuntu plucky/main armhf libcurl4t64 armhf 8.12.0+git20250209.89ed161+ds-1ubuntu1 [335 kB] 146s Get:281 http://ftpmaster.internal/ubuntu plucky/main armhf dpkg-dev all 1.22.11ubuntu4 [1088 kB] 146s Get:282 http://ftpmaster.internal/ubuntu plucky/main armhf libdpkg-perl all 1.22.11ubuntu4 [279 kB] 146s Get:283 http://ftpmaster.internal/ubuntu plucky/main armhf make armhf 4.4.1-1 [180 kB] 146s Get:284 http://ftpmaster.internal/ubuntu plucky/main armhf lto-disabled-list all 56 [12.4 kB] 146s Get:285 http://ftpmaster.internal/ubuntu plucky/main armhf libarchive13t64 armhf 3.7.7-0ubuntu1 [335 kB] 146s Get:286 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-common all 1.10.6+ds-1 [5636 B] 146s Get:287 http://ftpmaster.internal/ubuntu plucky/main armhf libjson-glib-1.0-0 armhf 1.10.6+ds-1 [59.5 kB] 146s Get:288 http://ftpmaster.internal/ubuntu plucky/main armhf fwupd armhf 2.0.6-3 [5155 kB] 146s Get:289 http://ftpmaster.internal/ubuntu plucky/main armhf libfwupd3 armhf 2.0.6-3 [125 kB] 146s Get:290 http://ftpmaster.internal/ubuntu plucky/main armhf libprotobuf-c1 armhf 1.5.1-1ubuntu1 [18.1 kB] 146s Get:291 http://ftpmaster.internal/ubuntu plucky/main armhf libqmi-proxy armhf 1.35.6-1 [5878 B] 146s Get:292 http://ftpmaster.internal/ubuntu plucky/main armhf libqmi-glib5 armhf 1.35.6-1 [928 kB] 146s Get:293 http://ftpmaster.internal/ubuntu plucky/main armhf gir1.2-packagekitglib-1.0 armhf 1.3.0-3build1 [25.5 kB] 146s Get:294 http://ftpmaster.internal/ubuntu plucky/main armhf gnupg-l10n all 2.4.4-2ubuntu22 [66.4 kB] 146s Get:295 http://ftpmaster.internal/ubuntu plucky/main armhf htop armhf 3.3.0-5 [140 kB] 146s Get:296 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-utils3 armhf 3.3.0-1 [17.5 kB] 146s Get:297 http://ftpmaster.internal/ubuntu plucky/main armhf libnspr4 armhf 2:4.36-1ubuntu1 [94.5 kB] 146s Get:298 http://ftpmaster.internal/ubuntu plucky/main armhf libnss3 armhf 2:3.108-1ubuntu1 [1317 kB] 146s Get:299 http://ftpmaster.internal/ubuntu plucky/main armhf libgpgme11t64 armhf 1.24.2-1ubuntu1 [125 kB] 146s Get:300 http://ftpmaster.internal/ubuntu plucky/main armhf libvolume-key1 armhf 0.3.12-9 [39.1 kB] 146s Get:301 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-crypto3 armhf 3.3.0-1 [22.4 kB] 146s Get:302 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-fs3 armhf 3.3.0-1 [34.5 kB] 146s Get:303 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-loop3 armhf 3.3.0-1 [6594 B] 146s Get:304 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-mdraid3 armhf 3.3.0-1 [13.4 kB] 147s Get:305 http://ftpmaster.internal/ubuntu plucky/main armhf libnvme1t64 armhf 1.11.1-2 [73.6 kB] 147s Get:306 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-nvme3 armhf 3.3.0-1 [17.7 kB] 147s Get:307 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-part3 armhf 3.3.0-1 [16.6 kB] 147s Get:308 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev-swap3 armhf 3.3.0-1 [9010 B] 147s Get:309 http://ftpmaster.internal/ubuntu plucky/main armhf libblockdev3 armhf 3.3.0-1 [44.4 kB] 147s Get:310 http://ftpmaster.internal/ubuntu plucky/main armhf libftdi1-2 armhf 1.5-8 [26.3 kB] 147s Get:311 http://ftpmaster.internal/ubuntu plucky/main armhf libgudev-1.0-0 armhf 1:238-6 [13.7 kB] 147s Get:312 http://ftpmaster.internal/ubuntu plucky/main armhf libicu76 armhf 76.1-1ubuntu2 [10.8 MB] 147s Get:313 http://ftpmaster.internal/ubuntu plucky/main armhf libsasl2-modules armhf 2.1.28+dfsg1-8build1 [62.7 kB] 147s Get:314 http://ftpmaster.internal/ubuntu plucky/main armhf udisks2 armhf 2.10.1-11ubuntu2 [278 kB] 147s Get:315 http://ftpmaster.internal/ubuntu plucky/main armhf libudisks2-0 armhf 2.10.1-11ubuntu2 [142 kB] 147s Get:316 http://ftpmaster.internal/ubuntu plucky/main armhf libwrap0 armhf 7.6.q-35 [45.6 kB] 147s Get:317 http://ftpmaster.internal/ubuntu plucky/main armhf linux-headers-6.12.0-15 all 6.12.0-15.15 [14.1 MB] 148s Get:318 http://ftpmaster.internal/ubuntu plucky/main armhf linux-headers-6.12.0-15-generic armhf 6.12.0-15.15 [1414 kB] 148s Get:319 http://ftpmaster.internal/ubuntu plucky/main armhf linux-headers-generic armhf 6.12.0-15.15+1 [10.8 kB] 148s Get:320 http://ftpmaster.internal/ubuntu plucky/main armhf pollinate all 4.33-4ubuntu2 [12.4 kB] 148s Get:321 http://ftpmaster.internal/ubuntu plucky/main armhf python3-babel all 2.17.0-1 [101 kB] 148s Get:322 http://ftpmaster.internal/ubuntu plucky/main armhf python-babel-localedata all 2.17.0-1 [6678 kB] 148s Get:323 http://ftpmaster.internal/ubuntu plucky/main armhf python3-more-itertools all 10.6.0-1 [57.7 kB] 148s Get:324 http://ftpmaster.internal/ubuntu plucky/main armhf python3-openssl all 25.0.0-1 [46.1 kB] 148s Get:325 http://ftpmaster.internal/ubuntu plucky/main armhf python3-pkg-resources all 75.6.0-1 [144 kB] 148s Get:326 http://ftpmaster.internal/ubuntu plucky/main armhf python3-setuptools all 75.6.0-1 [645 kB] 148s Get:327 http://ftpmaster.internal/ubuntu plucky/main armhf software-properties-common all 0.109 [16.5 kB] 148s Get:328 http://ftpmaster.internal/ubuntu plucky/main armhf python3-software-properties all 0.109 [31.0 kB] 148s Get:329 http://ftpmaster.internal/ubuntu plucky/main armhf python3-wadllib all 2.0.0-2 [36.2 kB] 148s Get:330 http://ftpmaster.internal/ubuntu plucky/main armhf tmux armhf 3.5a-3 [406 kB] 148s Get:331 http://ftpmaster.internal/ubuntu plucky/main armhf unattended-upgrades all 2.12ubuntu4 [58.5 kB] 148s Get:332 http://ftpmaster.internal/ubuntu plucky/main armhf xfsprogs armhf 6.12.0-1ubuntu1 [958 kB] 149s Get:333 http://ftpmaster.internal/ubuntu plucky/main armhf zstd armhf 1.5.6+dfsg-2 [690 kB] 149s Get:334 http://ftpmaster.internal/ubuntu plucky/main armhf cloud-init all 25.1-0ubuntu1 [2088 B] 149s Get:335 http://ftpmaster.internal/ubuntu plucky/main armhf kpartx armhf 0.9.9-1ubuntu4 [35.0 kB] 149s Get:336 http://ftpmaster.internal/ubuntu plucky/main armhf multipath-tools armhf 0.9.9-1ubuntu4 [294 kB] 150s Preconfiguring packages ... 152s Fetched 148 MB in 38s (3924 kB/s) 152s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59970 files and directories currently installed.) 152s Preparing to unpack .../motd-news-config_13.6ubuntu1_all.deb ... 152s Unpacking motd-news-config (13.6ubuntu1) over (13.5ubuntu3) ... 152s Selecting previously unselected package gcc-15-base:armhf. 152s Preparing to unpack .../gcc-15-base_15-20250213-1ubuntu1_armhf.deb ... 152s Unpacking gcc-15-base:armhf (15-20250213-1ubuntu1) ... 153s Setting up gcc-15-base:armhf (15-20250213-1ubuntu1) ... 153s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 153s Preparing to unpack .../libgcc-s1_15-20250213-1ubuntu1_armhf.deb ... 153s Unpacking libgcc-s1:armhf (15-20250213-1ubuntu1) over (14.2.0-8ubuntu1) ... 153s Setting up libgcc-s1:armhf (15-20250213-1ubuntu1) ... 153s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 153s Preparing to unpack .../libc6_2.40-4ubuntu1_armhf.deb ... 153s Unpacking libc6:armhf (2.40-4ubuntu1) over (2.40-1ubuntu3) ... 153s Setting up libc6:armhf (2.40-4ubuntu1) ... 153s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 153s Preparing to unpack .../libcrypt1_1%3a4.4.38-1_armhf.deb ... 153s Unpacking libcrypt1:armhf (1:4.4.38-1) over (1:4.4.36-5) ... 154s Setting up libcrypt1:armhf (1:4.4.38-1) ... 154s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 154s Preparing to unpack .../base-files_13.6ubuntu1_armhf.deb ... 154s Unpacking base-files (13.6ubuntu1) over (13.5ubuntu3) ... 154s Setting up base-files (13.6ubuntu1) ... 154s Updating /root/.profile to current default. 155s motd-news.service is a disabled or a static unit not running, not starting it. 155s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 155s Preparing to unpack .../bash_5.2.37-1ubuntu1_armhf.deb ... 155s Unpacking bash (5.2.37-1ubuntu1) over (5.2.32-1ubuntu2) ... 155s Setting up bash (5.2.37-1ubuntu1) ... 155s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 155s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 155s Preparing to unpack .../bsdutils_1%3a2.40.2-14ubuntu1_armhf.deb ... 155s Unpacking bsdutils (1:2.40.2-14ubuntu1) over (1:2.40.2-1ubuntu1) ... 155s Setting up bsdutils (1:2.40.2-14ubuntu1) ... 155s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 155s Preparing to unpack .../coreutils_9.5-1ubuntu1_armhf.deb ... 155s Unpacking coreutils (9.5-1ubuntu1) over (9.4-3.1ubuntu1) ... 155s Setting up coreutils (9.5-1ubuntu1) ... 155s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 155s Preparing to unpack .../dash_0.5.12-12ubuntu1_armhf.deb ... 155s Unpacking dash (0.5.12-12ubuntu1) over (0.5.12-9ubuntu1) ... 155s Setting up dash (0.5.12-12ubuntu1) ... 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 156s Preparing to unpack .../diffutils_1%3a3.10-2_armhf.deb ... 156s Unpacking diffutils (1:3.10-2) over (1:3.10-1build1) ... 156s Setting up diffutils (1:3.10-2) ... 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 156s Preparing to unpack .../libxxhash0_0.8.3-2_armhf.deb ... 156s Unpacking libxxhash0:armhf (0.8.3-2) over (0.8.2-2build1) ... 156s Setting up libxxhash0:armhf (0.8.3-2) ... 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 156s Preparing to unpack .../liblz4-1_1.10.0-3_armhf.deb ... 156s Unpacking liblz4-1:armhf (1.10.0-3) over (1.9.4-3) ... 156s Setting up liblz4-1:armhf (1.10.0-3) ... 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59975 files and directories currently installed.) 156s Preparing to unpack .../libssl3t64_3.4.1-1ubuntu1_armhf.deb ... 156s Unpacking libssl3t64:armhf (3.4.1-1ubuntu1) over (3.3.1-2ubuntu2) ... 156s Selecting previously unselected package openssl-provider-legacy. 156s Preparing to unpack .../openssl-provider-legacy_3.4.1-1ubuntu1_armhf.deb ... 156s Unpacking openssl-provider-legacy (3.4.1-1ubuntu1) ... 156s Setting up libssl3t64:armhf (3.4.1-1ubuntu1) ... 156s Setting up openssl-provider-legacy (3.4.1-1ubuntu1) ... 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59977 files and directories currently installed.) 156s Preparing to unpack .../libzstd1_1.5.6+dfsg-2_armhf.deb ... 156s Unpacking libzstd1:armhf (1.5.6+dfsg-2) over (1.5.6+dfsg-1) ... 156s Setting up libzstd1:armhf (1.5.6+dfsg-2) ... 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59977 files and directories currently installed.) 156s Preparing to unpack .../libstdc++6_15-20250213-1ubuntu1_armhf.deb ... 156s Unpacking libstdc++6:armhf (15-20250213-1ubuntu1) over (14.2.0-8ubuntu1) ... 156s Setting up libstdc++6:armhf (15-20250213-1ubuntu1) ... 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59977 files and directories currently installed.) 157s Preparing to unpack .../0-systemd-timesyncd_257.2-3ubuntu1_armhf.deb ... 157s Unpacking systemd-timesyncd (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 157s Preparing to unpack .../1-dbus-session-bus-common_1.16.0-1ubuntu1_all.deb ... 157s Unpacking dbus-session-bus-common (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 157s Preparing to unpack .../2-systemd-sysv_257.2-3ubuntu1_armhf.deb ... 157s Unpacking systemd-sysv (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 157s Preparing to unpack .../3-libpam-systemd_257.2-3ubuntu1_armhf.deb ... 157s Unpacking libpam-systemd:armhf (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 157s Preparing to unpack .../4-dbus-user-session_1.16.0-1ubuntu1_armhf.deb ... 157s Unpacking dbus-user-session (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 157s Preparing to unpack .../5-libapparmor1_4.1.0~beta5-0ubuntu5_armhf.deb ... 157s Unpacking libapparmor1:armhf (4.1.0~beta5-0ubuntu5) over (4.1.0~beta1-0ubuntu4) ... 157s Preparing to unpack .../6-libcap-ng0_0.8.5-4_armhf.deb ... 157s Unpacking libcap-ng0:armhf (0.8.5-4) over (0.8.5-3build1) ... 157s Setting up libcap-ng0:armhf (0.8.5-4) ... 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59978 files and directories currently installed.) 157s Preparing to unpack .../libselinux1_3.7-3ubuntu2_armhf.deb ... 157s Unpacking libselinux1:armhf (3.7-3ubuntu2) over (3.7-3ubuntu1) ... 157s Setting up libselinux1:armhf (3.7-3ubuntu2) ... 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59978 files and directories currently installed.) 157s Preparing to unpack .../0-dbus-system-bus-common_1.16.0-1ubuntu1_all.deb ... 157s Unpacking dbus-system-bus-common (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 157s Preparing to unpack .../1-dbus-bin_1.16.0-1ubuntu1_armhf.deb ... 157s Unpacking dbus-bin (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 157s Preparing to unpack .../2-dbus_1.16.0-1ubuntu1_armhf.deb ... 157s Unpacking dbus (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 157s Preparing to unpack .../3-dbus-daemon_1.16.0-1ubuntu1_armhf.deb ... 157s Unpacking dbus-daemon (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 158s Preparing to unpack .../4-libdbus-1-3_1.16.0-1ubuntu1_armhf.deb ... 158s Unpacking libdbus-1-3:armhf (1.16.0-1ubuntu1) over (1.14.10-4ubuntu5) ... 158s Preparing to unpack .../5-systemd-resolved_257.2-3ubuntu1_armhf.deb ... 158s Unpacking systemd-resolved (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 158s Preparing to unpack .../6-libncurses6_6.5+20250125-2_armhf.deb ... 158s Unpacking libncurses6:armhf (6.5+20250125-2) over (6.5-2) ... 158s Preparing to unpack .../7-libncursesw6_6.5+20250125-2_armhf.deb ... 158s Unpacking libncursesw6:armhf (6.5+20250125-2) over (6.5-2) ... 158s Preparing to unpack .../8-libtinfo6_6.5+20250125-2_armhf.deb ... 158s Unpacking libtinfo6:armhf (6.5+20250125-2) over (6.5-2) ... 158s Setting up libtinfo6:armhf (6.5+20250125-2) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59978 files and directories currently installed.) 158s Preparing to unpack .../bsdextrautils_2.40.2-14ubuntu1_armhf.deb ... 158s Unpacking bsdextrautils (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 158s Preparing to unpack .../eject_2.40.2-14ubuntu1_armhf.deb ... 158s Unpacking eject (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 158s Preparing to unpack .../fdisk_2.40.2-14ubuntu1_armhf.deb ... 158s Unpacking fdisk (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 158s Preparing to unpack .../libblkid1_2.40.2-14ubuntu1_armhf.deb ... 158s Unpacking libblkid1:armhf (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 158s Setting up libblkid1:armhf (2.40.2-14ubuntu1) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59974 files and directories currently installed.) 158s Preparing to unpack .../libmount1_2.40.2-14ubuntu1_armhf.deb ... 158s Unpacking libmount1:armhf (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 158s Setting up libmount1:armhf (2.40.2-14ubuntu1) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59974 files and directories currently installed.) 158s Preparing to unpack .../libsmartcols1_2.40.2-14ubuntu1_armhf.deb ... 158s Unpacking libsmartcols1:armhf (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 159s Setting up libsmartcols1:armhf (2.40.2-14ubuntu1) ... 159s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59974 files and directories currently installed.) 159s Preparing to unpack .../libuuid1_2.40.2-14ubuntu1_armhf.deb ... 159s Unpacking libuuid1:armhf (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 159s Setting up libuuid1:armhf (2.40.2-14ubuntu1) ... 159s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59974 files and directories currently installed.) 159s Preparing to unpack .../util-linux_2.40.2-14ubuntu1_armhf.deb ... 159s Unpacking util-linux (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 159s Setting up util-linux (2.40.2-14ubuntu1) ... 160s fstrim.service is a disabled or a static unit not running, not starting it. 160s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59967 files and directories currently installed.) 160s Preparing to unpack .../0-uuid-runtime_2.40.2-14ubuntu1_armhf.deb ... 160s Unpacking uuid-runtime (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 160s Preparing to unpack .../1-libfdisk1_2.40.2-14ubuntu1_armhf.deb ... 160s Unpacking libfdisk1:armhf (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 160s Preparing to unpack .../2-mount_2.40.2-14ubuntu1_armhf.deb ... 160s Unpacking mount (2.40.2-14ubuntu1) over (2.40.2-1ubuntu1) ... 160s Preparing to unpack .../3-readline-common_8.2-6_all.deb ... 160s Unpacking readline-common (8.2-6) over (8.2-5) ... 160s Preparing to unpack .../4-libreadline8t64_8.2-6_armhf.deb ... 160s Leaving 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64' 160s Leaving 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64' 160s Leaving 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64' 160s Leaving 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64' 160s Unpacking libreadline8t64:armhf (8.2-6) over (8.2-5) ... 160s Preparing to unpack .../5-systemd-cryptsetup_257.2-3ubuntu1_armhf.deb ... 160s Unpacking systemd-cryptsetup (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 160s Preparing to unpack .../6-libsystemd-shared_257.2-3ubuntu1_armhf.deb ... 160s Unpacking libsystemd-shared:armhf (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 160s Preparing to unpack .../7-libnss-systemd_257.2-3ubuntu1_armhf.deb ... 160s Unpacking libnss-systemd:armhf (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 160s Setting up libsystemd-shared:armhf (257.2-3ubuntu1) ... 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59967 files and directories currently installed.) 161s Preparing to unpack .../systemd_257.2-3ubuntu1_armhf.deb ... 161s Unpacking systemd (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 161s Preparing to unpack .../udev_257.2-3ubuntu1_armhf.deb ... 161s Unpacking udev (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 161s Preparing to unpack .../libudev1_257.2-3ubuntu1_armhf.deb ... 161s Unpacking libudev1:armhf (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 161s Setting up libudev1:armhf (257.2-3ubuntu1) ... 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 161s Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.201-1ubuntu1_armhf.deb ... 161s Unpacking libdevmapper1.02.1:armhf (2:1.02.201-1ubuntu1) over (2:1.02.196-1ubuntu2) ... 161s Preparing to unpack .../libcryptsetup12_2%3a2.7.5-1ubuntu2_armhf.deb ... 161s Unpacking libcryptsetup12:armhf (2:2.7.5-1ubuntu2) over (2:2.7.2-2ubuntu1) ... 161s Preparing to unpack .../libsystemd0_257.2-3ubuntu1_armhf.deb ... 161s Unpacking libsystemd0:armhf (257.2-3ubuntu1) over (256.5-2ubuntu4) ... 162s Setting up libsystemd0:armhf (257.2-3ubuntu1) ... 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 162s Preparing to unpack .../libapt-pkg6.0t64_2.9.29_armhf.deb ... 162s Unpacking libapt-pkg6.0t64:armhf (2.9.29) over (2.9.14ubuntu1) ... 162s Setting up libapt-pkg6.0t64:armhf (2.9.29) ... 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 162s Preparing to unpack .../tar_1.35+dfsg-3.1_armhf.deb ... 162s Unpacking tar (1.35+dfsg-3.1) over (1.35+dfsg-3build1) ... 162s Setting up tar (1.35+dfsg-3.1) ... 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 162s Preparing to unpack .../dpkg_1.22.11ubuntu4_armhf.deb ... 162s Unpacking dpkg (1.22.11ubuntu4) over (1.22.11ubuntu3) ... 162s Setting up dpkg (1.22.11ubuntu4) ... 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 163s Preparing to unpack .../gzip_1.13-1ubuntu2_armhf.deb ... 163s Unpacking gzip (1.13-1ubuntu2) over (1.12-1.1ubuntu1) ... 163s Setting up gzip (1.13-1ubuntu2) ... 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 163s Preparing to unpack .../ncurses-bin_6.5+20250125-2_armhf.deb ... 163s Unpacking ncurses-bin (6.5+20250125-2) over (6.5-2) ... 163s Setting up ncurses-bin (6.5+20250125-2) ... 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 163s Preparing to unpack .../perl_5.40.1-2_armhf.deb ... 163s Unpacking perl (5.40.1-2) over (5.40.0-8) ... 163s Preparing to unpack .../perl-modules-5.40_5.40.1-2_all.deb ... 163s Unpacking perl-modules-5.40 (5.40.1-2) over (5.40.0-8) ... 164s Preparing to unpack .../libperl5.40_5.40.1-2_armhf.deb ... 164s Unpacking libperl5.40:armhf (5.40.1-2) over (5.40.0-8) ... 164s Preparing to unpack .../perl-base_5.40.1-2_armhf.deb ... 164s Unpacking perl-base (5.40.1-2) over (5.40.0-8) ... 165s Setting up perl-base (5.40.1-2) ... 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 165s Preparing to unpack .../libdebconfclient0_0.274ubuntu1_armhf.deb ... 165s Unpacking libdebconfclient0:armhf (0.274ubuntu1) over (0.272ubuntu1) ... 165s Setting up libdebconfclient0:armhf (0.274ubuntu1) ... 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 165s Preparing to unpack .../base-passwd_3.6.6_armhf.deb ... 165s Unpacking base-passwd (3.6.6) over (3.6.5) ... 165s Setting up base-passwd (3.6.6) ... 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 165s Preparing to unpack .../init-system-helpers_1.68_all.deb ... 165s Unpacking init-system-helpers (1.68) over (1.67ubuntu1) ... 165s Setting up init-system-helpers (1.68) ... 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 165s Preparing to unpack .../libc-bin_2.40-4ubuntu1_armhf.deb ... 165s Unpacking libc-bin (2.40-4ubuntu1) over (2.40-1ubuntu3) ... 165s Setting up libc-bin (2.40-4ubuntu1) ... 166s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 166s Preparing to unpack .../ncurses-base_6.5+20250125-2_all.deb ... 166s Unpacking ncurses-base (6.5+20250125-2) over (6.5-2) ... 166s Setting up ncurses-base (6.5+20250125-2) ... 166s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59961 files and directories currently installed.) 166s Preparing to unpack .../0-ncurses-term_6.5+20250125-2_all.deb ... 166s Unpacking ncurses-term (6.5+20250125-2) over (6.5-2) ... 166s Preparing to unpack .../1-kbd_2.7.1-2ubuntu1_armhf.deb ... 166s Unpacking kbd (2.7.1-2ubuntu1) over (2.6.4-2ubuntu3) ... 167s Preparing to unpack .../2-console-setup-linux_1.226ubuntu3_all.deb ... 167s Unpacking console-setup-linux (1.226ubuntu3) over (1.226ubuntu2) ... 167s Preparing to unpack .../3-console-setup_1.226ubuntu3_all.deb ... 167s Unpacking console-setup (1.226ubuntu3) over (1.226ubuntu2) ... 167s Preparing to unpack .../4-keyboard-configuration_1.226ubuntu3_all.deb ... 167s Unpacking keyboard-configuration (1.226ubuntu3) over (1.226ubuntu2) ... 167s Preparing to unpack .../5-sysvinit-utils_3.14-1ubuntu1_armhf.deb ... 167s Unpacking sysvinit-utils (3.14-1ubuntu1) over (3.08-6ubuntu3) ... 167s Setting up sysvinit-utils (3.14-1ubuntu1) ... 167s Selecting previously unselected package libapt-pkg7.0:armhf. 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 59966 files and directories currently installed.) 167s Preparing to unpack .../libapt-pkg7.0_2.9.30ubuntu1_armhf.deb ... 167s Unpacking libapt-pkg7.0:armhf (2.9.30ubuntu1) ... 167s Setting up libapt-pkg7.0:armhf (2.9.30ubuntu1) ... 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60015 files and directories currently installed.) 167s Preparing to unpack .../apt_2.9.30ubuntu1_armhf.deb ... 167s Unpacking apt (2.9.30ubuntu1) over (2.9.14ubuntu1) ... 167s Setting up apt (2.9.30ubuntu1) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 168s Preparing to unpack .../apt-utils_2.9.30ubuntu1_armhf.deb ... 168s Unpacking apt-utils (2.9.30ubuntu1) over (2.9.14ubuntu1) ... 168s Preparing to unpack .../libgpg-error-l10n_1.51-3_all.deb ... 168s Unpacking libgpg-error-l10n (1.51-3) over (1.50-4) ... 169s Preparing to unpack .../libgpg-error0_1.51-3_armhf.deb ... 169s Unpacking libgpg-error0:armhf (1.51-3) over (1.50-4) ... 169s Setting up libgpg-error0:armhf (1.51-3) ... 169s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 169s Preparing to unpack .../libnpth0t64_1.8-2_armhf.deb ... 169s Unpacking libnpth0t64:armhf (1.8-2) over (1.6-3.1build1) ... 169s Setting up libnpth0t64:armhf (1.8-2) ... 169s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 169s Preparing to unpack .../00-gpg-wks-client_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking gpg-wks-client (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../01-dirmngr_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking dirmngr (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../02-gpgsm_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking gpgsm (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../03-gnupg-utils_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking gnupg-utils (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../04-gpg-agent_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking gpg-agent (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../05-gpg_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking gpg (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../06-gpgconf_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking gpgconf (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../07-gnupg_2.4.4-2ubuntu22_all.deb ... 169s Unpacking gnupg (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../08-keyboxd_2.4.4-2ubuntu22_armhf.deb ... 169s Unpacking keyboxd (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 169s Preparing to unpack .../09-pinentry-curses_1.3.1-2ubuntu2_armhf.deb ... 169s Unpacking pinentry-curses (1.3.1-2ubuntu2) over (1.3.1-0ubuntu2) ... 169s Preparing to unpack .../10-libnettle8t64_3.10.1-1_armhf.deb ... 169s Unpacking libnettle8t64:armhf (3.10.1-1) over (3.10-1) ... 170s Setting up libnettle8t64:armhf (3.10.1-1) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libhogweed6t64_3.10.1-1_armhf.deb ... 170s Unpacking libhogweed6t64:armhf (3.10.1-1) over (3.10-1) ... 170s Setting up libhogweed6t64:armhf (3.10.1-1) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libffi8_3.4.7-1_armhf.deb ... 170s Unpacking libffi8:armhf (3.4.7-1) over (3.4.6-1build1) ... 170s Setting up libffi8:armhf (3.4.7-1) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libp11-kit0_0.25.5-2ubuntu3_armhf.deb ... 170s Unpacking libp11-kit0:armhf (0.25.5-2ubuntu3) over (0.25.5-2ubuntu1) ... 170s Setting up libp11-kit0:armhf (0.25.5-2ubuntu3) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libtasn1-6_4.20.0-2_armhf.deb ... 170s Unpacking libtasn1-6:armhf (4.20.0-2) over (4.19.0-3build1) ... 170s Setting up libtasn1-6:armhf (4.20.0-2) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libunistring5_1.3-1_armhf.deb ... 170s Unpacking libunistring5:armhf (1.3-1) over (1.2-1) ... 170s Setting up libunistring5:armhf (1.3-1) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libgnutls30t64_3.8.9-2ubuntu2_armhf.deb ... 170s Unpacking libgnutls30t64:armhf (3.8.9-2ubuntu2) over (3.8.8-2ubuntu1) ... 170s Setting up libgnutls30t64:armhf (3.8.9-2ubuntu2) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60017 files and directories currently installed.) 170s Preparing to unpack .../libsasl2-modules-db_2.1.28+dfsg1-8build1_armhf.deb ... 170s Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-8build1) over (2.1.28+dfsg1-8) ... 171s Preparing to unpack .../libsasl2-2_2.1.28+dfsg1-8build1_armhf.deb ... 171s Unpacking libsasl2-2:armhf (2.1.28+dfsg1-8build1) over (2.1.28+dfsg1-8) ... 171s Preparing to unpack .../libldap-common_2.6.9+dfsg-1~exp2ubuntu1_all.deb ... 171s Unpacking libldap-common (2.6.9+dfsg-1~exp2ubuntu1) over (2.6.8+dfsg-1~exp4ubuntu3) ... 171s Preparing to unpack .../libldap2_2.6.9+dfsg-1~exp2ubuntu1_armhf.deb ... 171s Unpacking libldap2:armhf (2.6.9+dfsg-1~exp2ubuntu1) over (2.6.8+dfsg-1~exp4ubuntu3) ... 171s Preparing to unpack .../gpgv_2.4.4-2ubuntu22_armhf.deb ... 171s Unpacking gpgv (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 171s Setting up gpgv (2.4.4-2ubuntu22) ... 171s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60016 files and directories currently installed.) 171s Preparing to unpack .../0-e2fsprogs-l10n_1.47.2-1ubuntu1_all.deb ... 171s Unpacking e2fsprogs-l10n (1.47.2-1ubuntu1) over (1.47.1-1ubuntu1) ... 171s Preparing to unpack .../1-logsave_1.47.2-1ubuntu1_armhf.deb ... 171s Unpacking logsave (1.47.2-1ubuntu1) over (1.47.1-1ubuntu1) ... 171s Preparing to unpack .../2-ubuntu-minimal_1.547_armhf.deb ... 171s Unpacking ubuntu-minimal (1.547) over (1.544) ... 171s Preparing to unpack .../3-initramfs-tools_0.145ubuntu2_all.deb ... 171s Unpacking initramfs-tools (0.145ubuntu2) over (0.142ubuntu35) ... 171s Preparing to unpack .../4-initramfs-tools-core_0.145ubuntu2_all.deb ... 171s Unpacking initramfs-tools-core (0.145ubuntu2) over (0.142ubuntu35) ... 171s Preparing to unpack .../5-libext2fs2t64_1.47.2-1ubuntu1_armhf.deb ... 171s Leaving 'diversion of /lib/arm-linux-gnueabihf/libe2p.so.2 to /lib/arm-linux-gnueabihf/libe2p.so.2.usr-is-merged by libext2fs2t64' 171s Leaving 'diversion of /lib/arm-linux-gnueabihf/libe2p.so.2.3 to /lib/arm-linux-gnueabihf/libe2p.so.2.3.usr-is-merged by libext2fs2t64' 171s Leaving 'diversion of /lib/arm-linux-gnueabihf/libext2fs.so.2 to /lib/arm-linux-gnueabihf/libext2fs.so.2.usr-is-merged by libext2fs2t64' 171s Leaving 'diversion of /lib/arm-linux-gnueabihf/libext2fs.so.2.4 to /lib/arm-linux-gnueabihf/libext2fs.so.2.4.usr-is-merged by libext2fs2t64' 171s Unpacking libext2fs2t64:armhf (1.47.2-1ubuntu1) over (1.47.1-1ubuntu1) ... 171s Setting up libext2fs2t64:armhf (1.47.2-1ubuntu1) ... 171s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60016 files and directories currently installed.) 171s Preparing to unpack .../e2fsprogs_1.47.2-1ubuntu1_armhf.deb ... 171s Unpacking e2fsprogs (1.47.2-1ubuntu1) over (1.47.1-1ubuntu1) ... 172s Preparing to unpack .../dhcpcd-base_1%3a10.1.0-7_armhf.deb ... 172s Unpacking dhcpcd-base (1:10.1.0-7) over (1:10.1.0-2) ... 172s Setting up libapparmor1:armhf (4.1.0~beta5-0ubuntu5) ... 172s Setting up mount (2.40.2-14ubuntu1) ... 172s Setting up systemd (257.2-3ubuntu1) ... 172s Installing new version of config file /etc/systemd/logind.conf ... 172s Installing new version of config file /etc/systemd/sleep.conf ... 172s /usr/lib/tmpfiles.d/legacy.conf:14: Duplicate line for path "/run/lock", ignoring. 172s Created symlink '/run/systemd/system/tmp.mount' → '/dev/null'. 172s /usr/lib/tmpfiles.d/legacy.conf:14: Duplicate line for path "/run/lock", ignoring. 173s Setting up systemd-sysv (257.2-3ubuntu1) ... 173s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60015 files and directories currently installed.) 173s Preparing to unpack .../00-init_1.68_armhf.deb ... 173s Unpacking init (1.68) over (1.67ubuntu1) ... 173s Preparing to unpack .../01-libbpf1_1%3a1.5.0-2_armhf.deb ... 173s Unpacking libbpf1:armhf (1:1.5.0-2) over (1:1.5.0-1) ... 173s Preparing to unpack .../02-iptables_1.8.11-2ubuntu1_armhf.deb ... 173s Unpacking iptables (1.8.11-2ubuntu1) over (1.8.10-3ubuntu2) ... 173s Preparing to unpack .../03-libip4tc2_1.8.11-2ubuntu1_armhf.deb ... 173s Unpacking libip4tc2:armhf (1.8.11-2ubuntu1) over (1.8.10-3ubuntu2) ... 173s Preparing to unpack .../04-libip6tc2_1.8.11-2ubuntu1_armhf.deb ... 173s Unpacking libip6tc2:armhf (1.8.11-2ubuntu1) over (1.8.10-3ubuntu2) ... 173s Preparing to unpack .../05-libnftnl11_1.2.8-1_armhf.deb ... 173s Unpacking libnftnl11:armhf (1.2.8-1) over (1.2.7-1) ... 173s Preparing to unpack .../06-libxtables12_1.8.11-2ubuntu1_armhf.deb ... 173s Unpacking libxtables12:armhf (1.8.11-2ubuntu1) over (1.8.10-3ubuntu2) ... 173s Preparing to unpack .../07-iproute2_6.13.0-1ubuntu1_armhf.deb ... 173s Unpacking iproute2 (6.13.0-1ubuntu1) over (6.10.0-2ubuntu1) ... 174s Preparing to unpack .../08-iputils-ping_3%3a20240905-1ubuntu1_armhf.deb ... 174s Unpacking iputils-ping (3:20240905-1ubuntu1) over (3:20240117-1build1) ... 174s Preparing to unpack .../09-locales_2.40-4ubuntu1_all.deb ... 174s Unpacking locales (2.40-4ubuntu1) over (2.40-1ubuntu3) ... 174s Selecting previously unselected package login.defs. 174s Preparing to unpack .../10-login.defs_1%3a4.16.0-7ubuntu1_all.deb ... 174s Unpacking login.defs (1:4.16.0-7ubuntu1) ... 174s Replacing files in old package login (1:4.15.3-3ubuntu2) ... 174s Setting up login.defs (1:4.16.0-7ubuntu1) ... 174s Installing new version of config file /etc/login.defs ... 174s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60022 files and directories currently installed.) 174s Preparing to unpack .../0-login_1%3a4.16.0-2+really2.40.2-14ubuntu1_armhf.deb ... 174s Unpacking login (1:4.16.0-2+really2.40.2-14ubuntu1) over (1:4.15.3-3ubuntu2) ... 174s Preparing to unpack .../1-mawk_1.3.4.20250131-1_armhf.deb ... 174s Unpacking mawk (1.3.4.20250131-1) over (1.3.4.20240905-1) ... 174s Preparing to unpack .../2-netcat-openbsd_1.228-1_armhf.deb ... 174s Unpacking netcat-openbsd (1.228-1) over (1.226-1.1) ... 175s Selecting previously unselected package libpython3.13-minimal:armhf. 175s Preparing to unpack .../3-libpython3.13-minimal_3.13.2-1_armhf.deb ... 175s Unpacking libpython3.13-minimal:armhf (3.13.2-1) ... 175s Selecting previously unselected package python3.13-minimal. 175s Preparing to unpack .../4-python3.13-minimal_3.13.2-1_armhf.deb ... 175s Unpacking python3.13-minimal (3.13.2-1) ... 175s Preparing to unpack .../5-python3-cryptography_43.0.0-1_armhf.deb ... 175s Unpacking python3-cryptography (43.0.0-1) over (42.0.5-2build1) ... 175s Setting up libpython3.13-minimal:armhf (3.13.2-1) ... 175s Setting up python3.13-minimal (3.13.2-1) ... 176s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60304 files and directories currently installed.) 176s Preparing to unpack .../python3-minimal_3.13.1-1~exp2_armhf.deb ... 176s Unpacking python3-minimal (3.13.1-1~exp2) over (3.12.6-0ubuntu1) ... 176s Setting up python3-minimal (3.13.1-1~exp2) ... 177s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60304 files and directories currently installed.) 177s Preparing to unpack .../00-python3_3.13.1-1~exp2_armhf.deb ... 177s Unpacking python3 (3.13.1-1~exp2) over (3.12.6-0ubuntu1) ... 177s Selecting previously unselected package python3-bcrypt. 177s Preparing to unpack .../01-python3-bcrypt_4.2.0-2.1_armhf.deb ... 177s Unpacking python3-bcrypt (4.2.0-2.1) ... 177s Preparing to unpack .../02-tzdata_2025a-2ubuntu1_all.deb ... 177s Unpacking tzdata (2025a-2ubuntu1) over (2024b-1ubuntu2) ... 177s Selecting previously unselected package libpython3.13-stdlib:armhf. 177s Preparing to unpack .../03-libpython3.13-stdlib_3.13.2-1_armhf.deb ... 177s Unpacking libpython3.13-stdlib:armhf (3.13.2-1) ... 177s Selecting previously unselected package python3.13. 177s Preparing to unpack .../04-python3.13_3.13.2-1_armhf.deb ... 177s Unpacking python3.13 (3.13.2-1) ... 177s Preparing to unpack .../05-libpython3-stdlib_3.13.1-1~exp2_armhf.deb ... 177s Unpacking libpython3-stdlib:armhf (3.13.1-1~exp2) over (3.12.6-0ubuntu1) ... 177s Preparing to unpack .../06-gir1.2-girepository-2.0_1.82.0-4_armhf.deb ... 177s Unpacking gir1.2-girepository-2.0:armhf (1.82.0-4) over (1.82.0-2) ... 177s Preparing to unpack .../07-gir1.2-glib-2.0_2.83.4-1_armhf.deb ... 177s Unpacking gir1.2-glib-2.0:armhf (2.83.4-1) over (2.82.2-3) ... 177s Preparing to unpack .../08-libgirepository-1.0-1_1.82.0-4_armhf.deb ... 177s Unpacking libgirepository-1.0-1:armhf (1.82.0-4) over (1.82.0-2) ... 177s Preparing to unpack .../09-libglib2.0-data_2.83.4-1_all.deb ... 177s Unpacking libglib2.0-data (2.83.4-1) over (2.82.2-3) ... 177s Preparing to unpack .../10-libglib2.0-bin_2.83.4-1_armhf.deb ... 177s Unpacking libglib2.0-bin (2.83.4-1) over (2.82.2-3) ... 177s Preparing to unpack .../11-libatomic1_15-20250213-1ubuntu1_armhf.deb ... 177s Unpacking libatomic1:armhf (15-20250213-1ubuntu1) over (14.2.0-8ubuntu1) ... 178s Preparing to unpack .../12-libglib2.0-0t64_2.83.4-1_armhf.deb ... 178s Unpacking libglib2.0-0t64:armhf (2.83.4-1) over (2.82.2-3) ... 178s Preparing to unpack .../13-netplan-generator_1.1.2-2ubuntu1_armhf.deb ... 178s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 178s Unpacking netplan-generator (1.1.2-2ubuntu1) over (1.1.1-1) ... 178s Preparing to unpack .../14-libyaml-0-2_0.2.5-2_armhf.deb ... 178s Unpacking libyaml-0-2:armhf (0.2.5-2) over (0.2.5-1build1) ... 178s Preparing to unpack .../15-python3-netplan_1.1.2-2ubuntu1_armhf.deb ... 178s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 178s for fn in glob1(directory, "%s.*" % fname): 178s Unpacking python3-netplan (1.1.2-2ubuntu1) over (1.1.1-1) ... 178s Preparing to unpack .../16-netplan.io_1.1.2-2ubuntu1_armhf.deb ... 178s Unpacking netplan.io (1.1.2-2ubuntu1) over (1.1.1-1) ... 178s Preparing to unpack .../17-libnetplan1_1.1.2-2ubuntu1_armhf.deb ... 178s Unpacking libnetplan1:armhf (1.1.2-2ubuntu1) over (1.1.1-1) ... 178s Preparing to unpack .../18-ethtool_1%3a6.11-1_armhf.deb ... 178s Unpacking ethtool (1:6.11-1) over (1:6.10-1) ... 178s Preparing to unpack .../19-libsemanage-common_3.7-2.1_all.deb ... 178s Unpacking libsemanage-common (3.7-2.1) over (3.7-2build1) ... 178s Setting up libsemanage-common (3.7-2.1) ... 178s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60727 files and directories currently installed.) 178s Preparing to unpack .../libsemanage2_3.7-2.1_armhf.deb ... 178s Unpacking libsemanage2:armhf (3.7-2.1) over (3.7-2build1) ... 178s Setting up libsemanage2:armhf (3.7-2.1) ... 178s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60727 files and directories currently installed.) 178s Preparing to unpack .../passwd_1%3a4.16.0-7ubuntu1_armhf.deb ... 178s Unpacking passwd (1:4.16.0-7ubuntu1) over (1:4.15.3-3ubuntu2) ... 179s Setting up passwd (1:4.16.0-7ubuntu1) ... 179s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60762 files and directories currently installed.) 179s Preparing to unpack .../000-ubuntu-pro-client-l10n_34.1.3_armhf.deb ... 179s Unpacking ubuntu-pro-client-l10n (34.1.3) over (34.1.2) ... 179s Preparing to unpack .../001-python-apt-common_2.9.9_all.deb ... 179s Unpacking python-apt-common (2.9.9) over (2.9.0ubuntu2) ... 179s Preparing to unpack .../002-python3-apt_2.9.9_armhf.deb ... 179s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 179s for fn in glob1(directory, "%s.*" % fname): 179s Unpacking python3-apt (2.9.9) over (2.9.0ubuntu2) ... 179s Preparing to unpack .../003-distro-info_1.13_armhf.deb ... 179s Unpacking distro-info (1.13) over (1.12) ... 179s Preparing to unpack .../004-ubuntu-pro-client_34.1.3_armhf.deb ... 179s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 179s for fn in glob1(directory, "%s.*" % fname): 179s Unpacking ubuntu-pro-client (34.1.3) over (34.1.2) ... 180s Preparing to unpack .../005-vim-tiny_2%3a9.1.0967-1ubuntu2_armhf.deb ... 180s Unpacking vim-tiny (2:9.1.0967-1ubuntu2) over (2:9.1.0861-1ubuntu1) ... 180s Preparing to unpack .../006-vim-common_2%3a9.1.0967-1ubuntu2_all.deb ... 180s Unpacking vim-common (2:9.1.0967-1ubuntu2) over (2:9.1.0861-1ubuntu1) ... 180s Preparing to unpack .../007-python3-newt_0.52.24-4ubuntu1_armhf.deb ... 180s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 180s for fn in glob1(directory, "%s.*" % fname): 180s Unpacking python3-newt:armhf (0.52.24-4ubuntu1) over (0.52.24-2ubuntu4) ... 180s Preparing to unpack .../008-libnewt0.52_0.52.24-4ubuntu1_armhf.deb ... 180s Unpacking libnewt0.52:armhf (0.52.24-4ubuntu1) over (0.52.24-2ubuntu4) ... 180s Preparing to unpack .../009-whiptail_0.52.24-4ubuntu1_armhf.deb ... 180s Unpacking whiptail (0.52.24-4ubuntu1) over (0.52.24-2ubuntu4) ... 180s Preparing to unpack .../010-dracut-install_106-2ubuntu1_armhf.deb ... 180s Unpacking dracut-install (106-2ubuntu1) over (105-2ubuntu3) ... 180s Preparing to unpack .../011-initramfs-tools-bin_0.145ubuntu2_armhf.deb ... 180s Unpacking initramfs-tools-bin (0.145ubuntu2) over (0.142ubuntu35) ... 180s Preparing to unpack .../012-busybox-initramfs_1%3a1.37.0-4ubuntu1_armhf.deb ... 180s Unpacking busybox-initramfs (1:1.37.0-4ubuntu1) over (1:1.36.1-9ubuntu1) ... 180s Preparing to unpack .../013-python3.12_3.12.9-1_armhf.deb ... 180s Unpacking python3.12 (3.12.9-1) over (3.12.7-3) ... 180s Preparing to unpack .../014-libpython3.12-stdlib_3.12.9-1_armhf.deb ... 180s Unpacking libpython3.12-stdlib:armhf (3.12.9-1) over (3.12.7-3) ... 181s Preparing to unpack .../015-python3.12-minimal_3.12.9-1_armhf.deb ... 181s Unpacking python3.12-minimal (3.12.9-1) over (3.12.7-3) ... 181s Preparing to unpack .../016-libpython3.12-minimal_3.12.9-1_armhf.deb ... 181s Unpacking libpython3.12-minimal:armhf (3.12.9-1) over (3.12.7-3) ... 181s Preparing to unpack .../017-cron_3.0pl1-192ubuntu1_armhf.deb ... 181s Unpacking cron (3.0pl1-192ubuntu1) over (3.0pl1-189ubuntu1) ... 181s Preparing to unpack .../018-rsync_3.4.1-0syncable1_armhf.deb ... 181s Unpacking rsync (3.4.1-0syncable1) over (3.3.0-1) ... 181s Preparing to unpack .../019-python3-lazr.uri_1.0.6-5_all.deb ... 181s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 181s for fn in glob1(directory, "%s.*" % fname): 181s Unpacking python3-lazr.uri (1.0.6-5) over (1.0.6-4) ... 181s Preparing to unpack .../020-python3-launchpadlib_2.1.0-1_all.deb ... 181s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 181s for fn in glob1(directory, "%s.*" % fname): 181s Unpacking python3-launchpadlib (2.1.0-1) over (2.0.0-1) ... 182s Preparing to unpack .../021-python3-problem-report_2.31.0+git20250220-0ubuntu1_all.deb ... 182s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 182s for fn in glob1(directory, "%s.*" % fname): 182s Unpacking python3-problem-report (2.31.0+git20250220-0ubuntu1) over (2.30.0-0ubuntu5) ... 182s Preparing to unpack .../022-python3-apport_2.31.0+git20250220-0ubuntu1_all.deb ... 182s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 182s for fn in glob1(directory, "%s.*" % fname): 182s Unpacking python3-apport (2.31.0+git20250220-0ubuntu1) over (2.30.0-0ubuntu5) ... 182s Preparing to unpack .../023-python3-gi_3.50.0-4_armhf.deb ... 182s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 182s for fn in glob1(directory, "%s.*" % fname): 182s Unpacking python3-gi (3.50.0-4) over (3.50.0-3build1) ... 182s Preparing to unpack .../024-apport-core-dump-handler_2.31.0+git20250220-0ubuntu1_all.deb ... 182s Unpacking apport-core-dump-handler (2.31.0+git20250220-0ubuntu1) over (2.30.0-0ubuntu5) ... 182s Preparing to unpack .../025-apport_2.31.0+git20250220-0ubuntu1_all.deb ... 182s Unpacking apport (2.31.0+git20250220-0ubuntu1) over (2.30.0-0ubuntu5) ... 182s Preparing to unpack .../026-gcc-14-base_14.2.0-17ubuntu3_armhf.deb ... 182s Unpacking gcc-14-base:armhf (14.2.0-17ubuntu3) over (14.2.0-8ubuntu1) ... 182s Preparing to unpack .../027-libcom-err2_1.47.2-1ubuntu1_armhf.deb ... 182s Unpacking libcom-err2:armhf (1.47.2-1ubuntu1) over (1.47.1-1ubuntu1) ... 182s Preparing to unpack .../028-libss2_1.47.2-1ubuntu1_armhf.deb ... 182s Unpacking libss2:armhf (1.47.2-1ubuntu1) over (1.47.1-1ubuntu1) ... 182s Preparing to unpack .../029-openssl_3.4.1-1ubuntu1_armhf.deb ... 182s Unpacking openssl (3.4.1-1ubuntu1) over (3.3.1-2ubuntu2) ... 182s Preparing to unpack .../030-ca-certificates_20241223_all.deb ... 182s Unpacking ca-certificates (20241223) over (20240203) ... 183s Preparing to unpack .../031-krb5-locales_1.21.3-4ubuntu1_all.deb ... 183s Unpacking krb5-locales (1.21.3-4ubuntu1) over (1.21.3-3) ... 183s Preparing to unpack .../032-libfribidi0_1.0.16-1_armhf.deb ... 183s Unpacking libfribidi0:armhf (1.0.16-1) over (1.0.15-1) ... 183s Preparing to unpack .../033-libgssapi-krb5-2_1.21.3-4ubuntu1_armhf.deb ... 183s Unpacking libgssapi-krb5-2:armhf (1.21.3-4ubuntu1) over (1.21.3-3) ... 183s Preparing to unpack .../034-libkrb5-3_1.21.3-4ubuntu1_armhf.deb ... 183s Unpacking libkrb5-3:armhf (1.21.3-4ubuntu1) over (1.21.3-3) ... 183s Preparing to unpack .../035-libkrb5support0_1.21.3-4ubuntu1_armhf.deb ... 183s Unpacking libkrb5support0:armhf (1.21.3-4ubuntu1) over (1.21.3-3) ... 183s Preparing to unpack .../036-libk5crypto3_1.21.3-4ubuntu1_armhf.deb ... 183s Unpacking libk5crypto3:armhf (1.21.3-4ubuntu1) over (1.21.3-3) ... 183s Preparing to unpack .../037-libicu74_74.2-1ubuntu6_armhf.deb ... 183s Unpacking libicu74:armhf (74.2-1ubuntu6) over (74.2-1ubuntu4) ... 183s Preparing to unpack .../038-libxml2_2.12.7+dfsg+really2.9.14-0.2ubuntu3_armhf.deb ... 183s Unpacking libxml2:armhf (2.12.7+dfsg+really2.9.14-0.2ubuntu3) over (2.12.7+dfsg-3) ... 183s Preparing to unpack .../039-python3-pygments_2.18.0+dfsg-2_all.deb ... 183s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 183s for fn in glob1(directory, "%s.*" % fname): 183s Unpacking python3-pygments (2.18.0+dfsg-2) over (2.18.0+dfsg-1ubuntu1) ... 184s Preparing to unpack .../040-python3-rich_13.9.4-1_all.deb ... 184s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 184s for fn in glob1(directory, "%s.*" % fname): 184s Unpacking python3-rich (13.9.4-1) over (13.7.1-1) ... 184s Preparing to unpack .../041-ucf_3.0050_all.deb ... 184s Unpacking ucf (3.0050) over (3.0043+nmu1) ... 184s Preparing to unpack .../042-rsyslog_8.2412.0-2ubuntu1_armhf.deb ... 184s Unpacking rsyslog (8.2412.0-2ubuntu1) over (8.2406.0-1ubuntu2) ... 184s Preparing to unpack .../043-xxd_2%3a9.1.0967-1ubuntu2_armhf.deb ... 184s Unpacking xxd (2:9.1.0967-1ubuntu2) over (2:9.1.0861-1ubuntu1) ... 184s Preparing to unpack .../044-apparmor_4.1.0~beta5-0ubuntu5_armhf.deb ... 185s Unpacking apparmor (4.1.0~beta5-0ubuntu5) over (4.1.0~beta1-0ubuntu4) ... 186s dpkg: warning: unable to delete old directory '/lib/apparmor': Directory not empty 186s Preparing to unpack .../045-bash-completion_1%3a2.16.0-7_all.deb ... 186s Unpacking bash-completion (1:2.16.0-7) over (1:2.14.0-2) ... 186s Selecting previously unselected package libjemalloc2:armhf. 186s Preparing to unpack .../046-libjemalloc2_5.3.0-2build1_armhf.deb ... 186s Unpacking libjemalloc2:armhf (5.3.0-2build1) ... 186s Preparing to unpack .../047-libmaxminddb0_1.12.2-1_armhf.deb ... 186s Unpacking libmaxminddb0:armhf (1.12.2-1) over (1.11.0-1) ... 186s Preparing to unpack .../048-liburcu8t64_0.15.1-1_armhf.deb ... 186s Unpacking liburcu8t64:armhf (0.15.1-1) over (0.14.1-1) ... 187s Preparing to unpack .../049-bind9-dnsutils_1%3a9.20.4-3ubuntu1_armhf.deb ... 187s Unpacking bind9-dnsutils (1:9.20.4-3ubuntu1) over (1:9.20.0-2ubuntu3) ... 187s Preparing to unpack .../050-bind9-host_1%3a9.20.4-3ubuntu1_armhf.deb ... 187s Unpacking bind9-host (1:9.20.4-3ubuntu1) over (1:9.20.0-2ubuntu3) ... 187s Preparing to unpack .../051-bind9-libs_1%3a9.20.4-3ubuntu1_armhf.deb ... 187s Unpacking bind9-libs:armhf (1:9.20.4-3ubuntu1) over (1:9.20.0-2ubuntu3) ... 187s Preparing to unpack .../052-libedit2_3.1-20250104-1_armhf.deb ... 187s Unpacking libedit2:armhf (3.1-20250104-1) over (3.1-20240808-1) ... 187s Preparing to unpack .../053-busybox-static_1%3a1.37.0-4ubuntu1_armhf.deb ... 187s Unpacking busybox-static (1:1.37.0-4ubuntu1) over (1:1.36.1-9ubuntu1) ... 187s Preparing to unpack .../054-cron-daemon-common_3.0pl1-192ubuntu1_all.deb ... 187s Unpacking cron-daemon-common (3.0pl1-192ubuntu1) over (3.0pl1-189ubuntu1) ... 187s Preparing to unpack .../055-dmsetup_2%3a1.02.201-1ubuntu1_armhf.deb ... 187s Unpacking dmsetup (2:1.02.201-1ubuntu1) over (2:1.02.196-1ubuntu2) ... 187s Preparing to unpack .../056-ed_1.21-1_armhf.deb ... 187s Unpacking ed (1.21-1) over (1.20.2-2) ... 187s Preparing to unpack .../057-gettext-base_0.23.1-1_armhf.deb ... 187s Unpacking gettext-base (0.23.1-1) over (0.22.5-2) ... 187s Preparing to unpack .../058-groff-base_1.23.0-7_armhf.deb ... 187s Unpacking groff-base (1.23.0-7) over (1.23.0-5) ... 187s Preparing to unpack .../059-libibverbs1_55.0-1ubuntu1_armhf.deb ... 187s Unpacking libibverbs1:armhf (55.0-1ubuntu1) over (52.0-2ubuntu1) ... 187s Preparing to unpack .../060-ibverbs-providers_55.0-1ubuntu1_armhf.deb ... 187s Unpacking ibverbs-providers:armhf (55.0-1ubuntu1) over (52.0-2ubuntu1) ... 187s Preparing to unpack .../061-inetutils-telnet_2%3a2.5-6ubuntu1_armhf.deb ... 187s Unpacking inetutils-telnet (2:2.5-6ubuntu1) over (2:2.5-5ubuntu1) ... 187s Preparing to unpack .../062-iputils-tracepath_3%3a20240905-1ubuntu1_armhf.deb ... 187s Unpacking iputils-tracepath (3:20240905-1ubuntu1) over (3:20240117-1build1) ... 187s Preparing to unpack .../063-libcbor0.10_0.10.2-2ubuntu1_armhf.deb ... 187s Unpacking libcbor0.10:armhf (0.10.2-2ubuntu1) over (0.10.2-1.2ubuntu2) ... 188s Preparing to unpack .../064-nftables_1.1.1-1build1_armhf.deb ... 188s Unpacking nftables (1.1.1-1build1) over (1.1.0-2) ... 188s Preparing to unpack .../065-libnftables1_1.1.1-1build1_armhf.deb ... 188s Unpacking libnftables1:armhf (1.1.1-1build1) over (1.1.0-2) ... 188s Preparing to unpack .../066-libpcap0.8t64_1.10.5-2ubuntu1_armhf.deb ... 188s Unpacking libpcap0.8t64:armhf (1.10.5-2ubuntu1) over (1.10.5-1ubuntu1) ... 188s Preparing to unpack .../067-libpng16-16t64_1.6.46-4_armhf.deb ... 188s Unpacking libpng16-16t64:armhf (1.6.46-4) over (1.6.44-2) ... 188s Preparing to unpack .../068-libxkbcommon0_1.7.0-2_armhf.deb ... 188s Unpacking libxkbcommon0:armhf (1.7.0-2) over (1.7.0-1) ... 188s Preparing to unpack .../069-libplymouth5_24.004.60-2ubuntu5_armhf.deb ... 188s Unpacking libplymouth5:armhf (24.004.60-2ubuntu5) over (24.004.60-2ubuntu4) ... 188s Preparing to unpack .../070-libtraceevent1-plugin_1%3a1.8.4-2_armhf.deb ... 188s Unpacking libtraceevent1-plugin:armhf (1:1.8.4-2) over (1:1.8.4-1) ... 188s Preparing to unpack .../071-libtraceevent1_1%3a1.8.4-2_armhf.deb ... 188s Unpacking libtraceevent1:armhf (1:1.8.4-2) over (1:1.8.4-1) ... 188s Preparing to unpack .../072-libusb-1.0-0_2%3a1.0.27-2_armhf.deb ... 188s Unpacking libusb-1.0-0:armhf (2:1.0.27-2) over (2:1.0.27-1) ... 188s Preparing to unpack .../073-libxdmcp6_1%3a1.1.5-1_armhf.deb ... 188s Unpacking libxdmcp6:armhf (1:1.1.5-1) over (1:1.1.3-0ubuntu6) ... 188s Preparing to unpack .../074-lshw_02.19.git.2021.06.19.996aaad9c7-2.1ubuntu1_armhf.deb ... 188s Unpacking lshw (02.19.git.2021.06.19.996aaad9c7-2.1ubuntu1) over (02.19.git.2021.06.19.996aaad9c7-2ubuntu2) ... 188s Preparing to unpack .../075-lsof_4.99.4+dfsg-2_armhf.deb ... 188s Unpacking lsof (4.99.4+dfsg-2) over (4.99.3+dfsg-2) ... 188s Preparing to unpack .../076-liblsof0_4.99.4+dfsg-2_armhf.deb ... 188s Unpacking liblsof0 (4.99.4+dfsg-2) over (4.99.3+dfsg-2) ... 188s Preparing to unpack .../077-nano_8.3-1_armhf.deb ... 188s Unpacking nano (8.3-1) over (8.2-1) ... 188s Preparing to unpack .../078-pci.ids_0.0~2025.02.12-1_all.deb ... 188s Unpacking pci.ids (0.0~2025.02.12-1) over (0.0~2024.10.24-1) ... 188s Preparing to unpack .../079-plymouth-theme-ubuntu-text_24.004.60-2ubuntu5_armhf.deb ... 188s Unpacking plymouth-theme-ubuntu-text (24.004.60-2ubuntu5) over (24.004.60-2ubuntu4) ... 189s Preparing to unpack .../080-libpackagekit-glib2-18_1.3.0-3build1_armhf.deb ... 189s Unpacking libpackagekit-glib2-18:armhf (1.3.0-3build1) over (1.3.0-2) ... 189s Preparing to unpack .../081-packagekit-tools_1.3.0-3build1_armhf.deb ... 189s Unpacking packagekit-tools (1.3.0-3build1) over (1.3.0-2) ... 189s Preparing to unpack .../082-polkitd_126-2_armhf.deb ... 189s Unpacking polkitd (126-2) over (125-2ubuntu1) ... 189s Preparing to unpack .../083-libpolkit-agent-1-0_126-2_armhf.deb ... 189s Unpacking libpolkit-agent-1-0:armhf (126-2) over (125-2ubuntu1) ... 189s Preparing to unpack .../084-libpolkit-gobject-1-0_126-2_armhf.deb ... 189s Unpacking libpolkit-gobject-1-0:armhf (126-2) over (125-2ubuntu1) ... 189s Preparing to unpack .../085-libcurl3t64-gnutls_8.12.0+git20250209.89ed161+ds-1ubuntu1_armhf.deb ... 189s Unpacking libcurl3t64-gnutls:armhf (8.12.0+git20250209.89ed161+ds-1ubuntu1) over (8.11.0-1ubuntu2) ... 189s Preparing to unpack .../086-libappstream5_1.0.4-1_armhf.deb ... 189s Unpacking libappstream5:armhf (1.0.4-1) over (1.0.3-1) ... 189s Preparing to unpack .../087-libgstreamer1.0-0_1.25.50-1_armhf.deb ... 189s Unpacking libgstreamer1.0-0:armhf (1.25.50-1) over (1.24.9-1) ... 189s Preparing to unpack .../088-packagekit_1.3.0-3build1_armhf.deb ... 189s Unpacking packagekit (1.3.0-3build1) over (1.3.0-2) ... 189s Preparing to unpack .../089-plymouth_24.004.60-2ubuntu5_armhf.deb ... 190s Unpacking plymouth (24.004.60-2ubuntu5) over (24.004.60-2ubuntu4) ... 190s Preparing to unpack .../090-powermgmt-base_1.38_all.deb ... 190s Unpacking powermgmt-base (1.38) over (1.37+nmu1ubuntu1) ... 190s Preparing to unpack .../091-psmisc_23.7-2_armhf.deb ... 190s Unpacking psmisc (23.7-2) over (23.7-1build1) ... 190s Preparing to unpack .../092-publicsuffix_20250108.1153-0.1_all.deb ... 190s Unpacking publicsuffix (20250108.1153-0.1) over (20231001.0357-0.1) ... 190s Preparing to unpack .../093-python3-distro-info_1.13_all.deb ... 190s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 190s for fn in glob1(directory, "%s.*" % fname): 190s Unpacking python3-distro-info (1.13) over (1.12) ... 190s Preparing to unpack .../094-python3.13-gdbm_3.13.2-1_armhf.deb ... 190s Unpacking python3.13-gdbm (3.13.2-1) over (3.13.0-2) ... 190s Preparing to unpack .../095-python3.12-gdbm_3.12.9-1_armhf.deb ... 190s Unpacking python3.12-gdbm (3.12.9-1) over (3.12.7-3) ... 190s Preparing to unpack .../096-python3-gdbm_3.13.1-1_armhf.deb ... 190s Unpacking python3-gdbm:armhf (3.13.1-1) over (3.12.7-1) ... 190s Preparing to unpack .../097-telnet_0.17+2.5-6ubuntu1_all.deb ... 190s Unpacking telnet (0.17+2.5-6ubuntu1) over (0.17+2.5-5ubuntu1) ... 190s Preparing to unpack .../098-ubuntu-standard_1.547_armhf.deb ... 190s Unpacking ubuntu-standard (1.547) over (1.544) ... 190s Preparing to unpack .../099-ufw_0.36.2-9_all.deb ... 190s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 190s for fn in glob1(directory, "%s.*" % fname): 190s Unpacking ufw (0.36.2-9) over (0.36.2-8) ... 190s Preparing to unpack .../100-usb.ids_2025.01.14-1_all.deb ... 190s Unpacking usb.ids (2025.01.14-1) over (2024.07.04-1) ... 190s Preparing to unpack .../101-xauth_1%3a1.1.2-1.1_armhf.deb ... 190s Unpacking xauth (1:1.1.2-1.1) over (1:1.1.2-1build1) ... 191s Preparing to unpack .../102-appstream_1.0.4-1_armhf.deb ... 191s Unpacking appstream (1.0.4-1) over (1.0.3-1) ... 191s Preparing to unpack .../103-libctf0_2.44-2ubuntu1_armhf.deb ... 191s Unpacking libctf0:armhf (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../104-libctf-nobfd0_2.44-2ubuntu1_armhf.deb ... 191s Unpacking libctf-nobfd0:armhf (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../105-binutils-arm-linux-gnueabihf_2.44-2ubuntu1_armhf.deb ... 191s Unpacking binutils-arm-linux-gnueabihf (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../106-libbinutils_2.44-2ubuntu1_armhf.deb ... 191s Unpacking libbinutils:armhf (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../107-binutils_2.44-2ubuntu1_armhf.deb ... 191s Unpacking binutils (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../108-binutils-common_2.44-2ubuntu1_armhf.deb ... 191s Unpacking binutils-common:armhf (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../109-libsframe1_2.44-2ubuntu1_armhf.deb ... 191s Unpacking libsframe1:armhf (2.44-2ubuntu1) over (2.43.1-4ubuntu1) ... 191s Preparing to unpack .../110-btrfs-progs_6.12-1build1_armhf.deb ... 191s Unpacking btrfs-progs (6.12-1build1) over (6.6.3-1.2) ... 191s Preparing to unpack .../111-python3-certifi_2025.1.31+ds-1_all.deb ... 191s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 191s for fn in glob1(directory, "%s.*" % fname): 191s Unpacking python3-certifi (2025.1.31+ds-1) over (2024.8.30+dfsg-1) ... 191s Preparing to unpack .../112-python3-chardet_5.2.0+dfsg-2_all.deb ... 191s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 191s for fn in glob1(directory, "%s.*" % fname): 191s Unpacking python3-chardet (5.2.0+dfsg-2) over (5.2.0+dfsg-1) ... 192s Preparing to unpack .../113-python3-idna_3.10-1_all.deb ... 192s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 192s for fn in glob1(directory, "%s.*" % fname): 192s Unpacking python3-idna (3.10-1) over (3.8-2) ... 192s Preparing to unpack .../114-python3-urllib3_2.3.0-1_all.deb ... 192s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 192s for fn in glob1(directory, "%s.*" % fname): 192s Unpacking python3-urllib3 (2.3.0-1) over (2.0.7-2ubuntu0.1) ... 192s Preparing to unpack .../115-python3-requests_2.32.3+dfsg-4ubuntu1_all.deb ... 192s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 192s for fn in glob1(directory, "%s.*" % fname): 192s Unpacking python3-requests (2.32.3+dfsg-4ubuntu1) over (2.32.3+dfsg-1ubuntu1) ... 192s Preparing to unpack .../116-python3-jinja2_3.1.5-2_all.deb ... 192s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 192s for fn in glob1(directory, "%s.*" % fname): 192s Unpacking python3-jinja2 (3.1.5-2) over (3.1.3-1ubuntu1) ... 192s Preparing to unpack .../117-python3-json-pointer_2.4-3_all.deb ... 192s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 192s for fn in glob1(directory, "%s.*" % fname): 192s Unpacking python3-json-pointer (2.4-3) over (2.4-2) ... 192s Preparing to unpack .../118-python3-jsonpatch_1.32-5_all.deb ... 192s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 192s for fn in glob1(directory, "%s.*" % fname): 192s Unpacking python3-jsonpatch (1.32-5) over (1.32-4) ... 192s Preparing to unpack .../119-python3-attr_25.1.0-1_all.deb ... 193s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 193s for fn in glob1(directory, "%s.*" % fname): 193s Unpacking python3-attr (25.1.0-1) over (23.2.0-2) ... 193s Preparing to unpack .../120-python3-referencing_0.35.1-2ubuntu1_all.deb ... 193s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 193s for fn in glob1(directory, "%s.*" % fname): 193s Unpacking python3-referencing (0.35.1-2ubuntu1) over (0.35.1-1ubuntu1) ... 193s Preparing to unpack .../121-python3-jsonschema_4.19.2-6ubuntu1_all.deb ... 193s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 193s for fn in glob1(directory, "%s.*" % fname): 193s Unpacking python3-jsonschema (4.19.2-6ubuntu1) over (4.19.2-3ubuntu1) ... 193s Preparing to unpack .../122-python3-jwt_2.10.1-2_all.deb ... 193s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 193s for fn in glob1(directory, "%s.*" % fname): 193s Unpacking python3-jwt (2.10.1-2) over (2.7.0-1) ... 193s Preparing to unpack .../123-python3-oauthlib_3.2.2-3_all.deb ... 193s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 193s for fn in glob1(directory, "%s.*" % fname): 193s Unpacking python3-oauthlib (3.2.2-3) over (3.2.2-2) ... 193s Preparing to unpack .../124-cloud-init-base_25.1-0ubuntu1_all.deb ... 193s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 193s for fn in glob1(directory, "%s.*" % fname): 194s Unpacking cloud-init-base (25.1-0ubuntu1) over (24.4-0ubuntu1) ... 194s dpkg: warning: unable to delete old directory '/lib/systemd/system/sshd-keygen@.service.d': Directory not empty 194s Preparing to unpack .../125-cryptsetup-bin_2%3a2.7.5-1ubuntu2_armhf.deb ... 194s Unpacking cryptsetup-bin (2:2.7.5-1ubuntu2) over (2:2.7.2-2ubuntu1) ... 194s Preparing to unpack .../126-curl_8.12.0+git20250209.89ed161+ds-1ubuntu1_armhf.deb ... 194s Unpacking curl (8.12.0+git20250209.89ed161+ds-1ubuntu1) over (8.11.0-1ubuntu2) ... 194s Preparing to unpack .../127-libcurl4t64_8.12.0+git20250209.89ed161+ds-1ubuntu1_armhf.deb ... 194s Unpacking libcurl4t64:armhf (8.12.0+git20250209.89ed161+ds-1ubuntu1) over (8.11.0-1ubuntu2) ... 194s Preparing to unpack .../128-dpkg-dev_1.22.11ubuntu4_all.deb ... 194s Unpacking dpkg-dev (1.22.11ubuntu4) over (1.22.11ubuntu3) ... 194s Preparing to unpack .../129-libdpkg-perl_1.22.11ubuntu4_all.deb ... 194s Unpacking libdpkg-perl (1.22.11ubuntu4) over (1.22.11ubuntu3) ... 194s Preparing to unpack .../130-make_4.4.1-1_armhf.deb ... 194s Unpacking make (4.4.1-1) over (4.3-4.1build2) ... 194s Preparing to unpack .../131-lto-disabled-list_56_all.deb ... 194s Unpacking lto-disabled-list (56) over (54) ... 194s Preparing to unpack .../132-libarchive13t64_3.7.7-0ubuntu1_armhf.deb ... 194s Unpacking libarchive13t64:armhf (3.7.7-0ubuntu1) over (3.7.4-1.1) ... 195s Preparing to unpack .../133-libjson-glib-1.0-common_1.10.6+ds-1_all.deb ... 195s Unpacking libjson-glib-1.0-common (1.10.6+ds-1) over (1.10.0+ds-3) ... 195s Preparing to unpack .../134-libjson-glib-1.0-0_1.10.6+ds-1_armhf.deb ... 195s Unpacking libjson-glib-1.0-0:armhf (1.10.6+ds-1) over (1.10.0+ds-3) ... 195s Preparing to unpack .../135-fwupd_2.0.6-3_armhf.deb ... 195s Unpacking fwupd (2.0.6-3) over (2.0.2-1) ... 195s Preparing to unpack .../136-libfwupd3_2.0.6-3_armhf.deb ... 195s Unpacking libfwupd3:armhf (2.0.6-3) over (2.0.2-1) ... 195s Preparing to unpack .../137-libprotobuf-c1_1.5.1-1ubuntu1_armhf.deb ... 195s Unpacking libprotobuf-c1:armhf (1.5.1-1ubuntu1) over (1.4.1-1ubuntu4) ... 195s Preparing to unpack .../138-libqmi-proxy_1.35.6-1_armhf.deb ... 195s Unpacking libqmi-proxy (1.35.6-1) over (1.35.2-0ubuntu2) ... 195s Preparing to unpack .../139-libqmi-glib5_1.35.6-1_armhf.deb ... 195s Unpacking libqmi-glib5:armhf (1.35.6-1) over (1.35.2-0ubuntu2) ... 195s Preparing to unpack .../140-gir1.2-packagekitglib-1.0_1.3.0-3build1_armhf.deb ... 195s Unpacking gir1.2-packagekitglib-1.0 (1.3.0-3build1) over (1.3.0-2) ... 195s Preparing to unpack .../141-gnupg-l10n_2.4.4-2ubuntu22_all.deb ... 195s Unpacking gnupg-l10n (2.4.4-2ubuntu22) over (2.4.4-2ubuntu18) ... 195s Preparing to unpack .../142-htop_3.3.0-5_armhf.deb ... 195s Unpacking htop (3.3.0-5) over (3.3.0-4build1) ... 195s Preparing to unpack .../143-libblockdev-utils3_3.3.0-1_armhf.deb ... 195s Unpacking libblockdev-utils3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../144-libnspr4_2%3a4.36-1ubuntu1_armhf.deb ... 196s Unpacking libnspr4:armhf (2:4.36-1ubuntu1) over (2:4.35-1.1ubuntu2) ... 196s Preparing to unpack .../145-libnss3_2%3a3.108-1ubuntu1_armhf.deb ... 196s Unpacking libnss3:armhf (2:3.108-1ubuntu1) over (2:3.103-1) ... 196s Preparing to unpack .../146-libgpgme11t64_1.24.2-1ubuntu1_armhf.deb ... 196s Unpacking libgpgme11t64:armhf (1.24.2-1ubuntu1) over (1.24.0-2ubuntu1) ... 196s Preparing to unpack .../147-libvolume-key1_0.3.12-9_armhf.deb ... 196s Unpacking libvolume-key1:armhf (0.3.12-9) over (0.3.12-8) ... 196s Preparing to unpack .../148-libblockdev-crypto3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-crypto3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../149-libblockdev-fs3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-fs3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../150-libblockdev-loop3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-loop3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../151-libblockdev-mdraid3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-mdraid3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../152-libnvme1t64_1.11.1-2_armhf.deb ... 196s Unpacking libnvme1t64 (1.11.1-2) over (1.11.1-1) ... 196s Preparing to unpack .../153-libblockdev-nvme3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-nvme3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../154-libblockdev-part3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-part3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../155-libblockdev-swap3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev-swap3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../156-libblockdev3_3.3.0-1_armhf.deb ... 196s Unpacking libblockdev3:armhf (3.3.0-1) over (3.2.1-1) ... 196s Preparing to unpack .../157-libftdi1-2_1.5-8_armhf.deb ... 196s Unpacking libftdi1-2:armhf (1.5-8) over (1.5-7build1) ... 196s Preparing to unpack .../158-libgudev-1.0-0_1%3a238-6_armhf.deb ... 196s Unpacking libgudev-1.0-0:armhf (1:238-6) over (1:238-5ubuntu1) ... 196s Selecting previously unselected package libicu76:armhf. 196s Preparing to unpack .../159-libicu76_76.1-1ubuntu2_armhf.deb ... 196s Unpacking libicu76:armhf (76.1-1ubuntu2) ... 197s Preparing to unpack .../160-libsasl2-modules_2.1.28+dfsg1-8build1_armhf.deb ... 197s Unpacking libsasl2-modules:armhf (2.1.28+dfsg1-8build1) over (2.1.28+dfsg1-8) ... 197s Preparing to unpack .../161-udisks2_2.10.1-11ubuntu2_armhf.deb ... 197s Unpacking udisks2 (2.10.1-11ubuntu2) over (2.10.1-11ubuntu1) ... 197s Preparing to unpack .../162-libudisks2-0_2.10.1-11ubuntu2_armhf.deb ... 197s Unpacking libudisks2-0:armhf (2.10.1-11ubuntu2) over (2.10.1-11ubuntu1) ... 197s Preparing to unpack .../163-libwrap0_7.6.q-35_armhf.deb ... 197s Unpacking libwrap0:armhf (7.6.q-35) over (7.6.q-33) ... 197s Selecting previously unselected package linux-headers-6.12.0-15. 197s Preparing to unpack .../164-linux-headers-6.12.0-15_6.12.0-15.15_all.deb ... 197s Unpacking linux-headers-6.12.0-15 (6.12.0-15.15) ... 201s Selecting previously unselected package linux-headers-6.12.0-15-generic. 201s Preparing to unpack .../165-linux-headers-6.12.0-15-generic_6.12.0-15.15_armhf.deb ... 201s Unpacking linux-headers-6.12.0-15-generic (6.12.0-15.15) ... 202s Preparing to unpack .../166-linux-headers-generic_6.12.0-15.15+1_armhf.deb ... 202s Unpacking linux-headers-generic (6.12.0-15.15+1) over (6.11.0-8.8) ... 202s Preparing to unpack .../167-pollinate_4.33-4ubuntu2_all.deb ... 202s Unpacking pollinate (4.33-4ubuntu2) over (4.33-4ubuntu1) ... 202s Preparing to unpack .../168-python3-babel_2.17.0-1_all.deb ... 202s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 202s for fn in glob1(directory, "%s.*" % fname): 202s Unpacking python3-babel (2.17.0-1) over (2.16.0-1) ... 203s Preparing to unpack .../169-python-babel-localedata_2.17.0-1_all.deb ... 203s Unpacking python-babel-localedata (2.17.0-1) over (2.16.0-1) ... 203s Preparing to unpack .../170-python3-more-itertools_10.6.0-1_all.deb ... 203s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 203s for fn in glob1(directory, "%s.*" % fname): 203s Unpacking python3-more-itertools (10.6.0-1) over (10.5.0-1) ... 203s Preparing to unpack .../171-python3-openssl_25.0.0-1_all.deb ... 203s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 203s for fn in glob1(directory, "%s.*" % fname): 203s Unpacking python3-openssl (25.0.0-1) over (24.2.1-1) ... 203s Preparing to unpack .../172-python3-pkg-resources_75.6.0-1_all.deb ... 203s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 203s for fn in glob1(directory, "%s.*" % fname): 204s Unpacking python3-pkg-resources (75.6.0-1) over (75.2.0-1) ... 204s Preparing to unpack .../173-python3-setuptools_75.6.0-1_all.deb ... 204s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 204s for fn in glob1(directory, "%s.*" % fname): 204s Unpacking python3-setuptools (75.6.0-1) over (75.2.0-1) ... 204s Preparing to unpack .../174-software-properties-common_0.109_all.deb ... 204s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 204s for fn in glob1(directory, "%s.*" % fname): 204s Unpacking software-properties-common (0.109) over (0.105) ... 204s Preparing to unpack .../175-python3-software-properties_0.109_all.deb ... 204s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 204s for fn in glob1(directory, "%s.*" % fname): 204s Unpacking python3-software-properties (0.109) over (0.105) ... 204s Preparing to unpack .../176-python3-wadllib_2.0.0-2_all.deb ... 204s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 204s for fn in glob1(directory, "%s.*" % fname): 204s Unpacking python3-wadllib (2.0.0-2) over (2.0.0-1) ... 204s Preparing to unpack .../177-tmux_3.5a-3_armhf.deb ... 204s Unpacking tmux (3.5a-3) over (3.4-7) ... 205s Preparing to unpack .../178-unattended-upgrades_2.12ubuntu4_all.deb ... 205s Unpacking unattended-upgrades (2.12ubuntu4) over (2.9.1+nmu4ubuntu1) ... 205s dpkg: warning: unable to delete old directory '/lib/systemd/system-sleep': Directory not empty 205s Preparing to unpack .../179-xfsprogs_6.12.0-1ubuntu1_armhf.deb ... 205s Unpacking xfsprogs (6.12.0-1ubuntu1) over (6.8.0-2.2ubuntu2) ... 205s Preparing to unpack .../180-zstd_1.5.6+dfsg-2_armhf.deb ... 205s Unpacking zstd (1.5.6+dfsg-2) over (1.5.6+dfsg-1) ... 205s Preparing to unpack .../181-cloud-init_25.1-0ubuntu1_all.deb ... 205s Unpacking cloud-init (25.1-0ubuntu1) over (24.4-0ubuntu1) ... 205s Preparing to unpack .../182-kpartx_0.9.9-1ubuntu4_armhf.deb ... 205s Unpacking kpartx (0.9.9-1ubuntu4) over (0.9.9-1ubuntu3) ... 205s Preparing to unpack .../183-multipath-tools_0.9.9-1ubuntu4_armhf.deb ... 205s Unpacking multipath-tools (0.9.9-1ubuntu4) over (0.9.9-1ubuntu3) ... 205s Setting up libip4tc2:armhf (1.8.11-2ubuntu1) ... 205s Setting up powermgmt-base (1.38) ... 205s Setting up motd-news-config (13.6ubuntu1) ... 205s Setting up distro-info (1.13) ... 205s Setting up liburcu8t64:armhf (0.15.1-1) ... 205s Setting up libibverbs1:armhf (55.0-1ubuntu1) ... 205s Setting up libxdmcp6:armhf (1:1.1.5-1) ... 205s Setting up lto-disabled-list (56) ... 205s Setting up pci.ids (0.0~2025.02.12-1) ... 205s Setting up libnewt0.52:armhf (0.52.24-4ubuntu1) ... 205s Setting up apt-utils (2.9.30ubuntu1) ... 205s Setting up bsdextrautils (2.40.2-14ubuntu1) ... 205s Setting up init (1.68) ... 205s Setting up ibverbs-providers:armhf (55.0-1ubuntu1) ... 205s Setting up gcc-14-base:armhf (14.2.0-17ubuntu3) ... 205s Setting up psmisc (23.7-2) ... 205s Setting up libcbor0.10:armhf (0.10.2-2ubuntu1) ... 205s Setting up libyaml-0-2:armhf (0.2.5-2) ... 205s Setting up libip6tc2:armhf (1.8.11-2ubuntu1) ... 205s Setting up liblsof0 (4.99.4+dfsg-2) ... 205s Setting up libmaxminddb0:armhf (1.12.2-1) ... 205s Setting up python3.12-gdbm (3.12.9-1) ... 205s Setting up libedit2:armhf (3.1-20250104-1) ... 205s Setting up libsasl2-modules:armhf (2.1.28+dfsg1-8build1) ... 205s Setting up netcat-openbsd (1.228-1) ... 205s Setting up libpython3.12-minimal:armhf (3.12.9-1) ... 205s Setting up binutils-common:armhf (2.44-2ubuntu1) ... 205s Setting up libctf-nobfd0:armhf (2.44-2ubuntu1) ... 205s Setting up gettext-base (0.23.1-1) ... 205s Setting up libnss-systemd:armhf (257.2-3ubuntu1) ... 205s Setting up libnftnl11:armhf (1.2.8-1) ... 205s Setting up krb5-locales (1.21.3-4ubuntu1) ... 205s Setting up libcom-err2:armhf (1.47.2-1ubuntu1) ... 205s Setting up libjemalloc2:armhf (5.3.0-2build1) ... 205s Setting up lshw (02.19.git.2021.06.19.996aaad9c7-2.1ubuntu1) ... 205s Setting up locales (2.40-4ubuntu1) ... 207s Generating locales (this might take a while)... 209s en_US.UTF-8... done 209s Generation complete. 209s Setting up libldap-common (2.6.9+dfsg-1~exp2ubuntu1) ... 209s Installing new version of config file /etc/ldap/ldap.conf ... 209s Setting up libprotobuf-c1:armhf (1.5.1-1ubuntu1) ... 209s Setting up xxd (2:9.1.0967-1ubuntu2) ... 209s Setting up libsframe1:armhf (2.44-2ubuntu1) ... 209s Setting up python-babel-localedata (2.17.0-1) ... 209s Setting up libkrb5support0:armhf (1.21.3-4ubuntu1) ... 209s Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-8build1) ... 209s Setting up tzdata (2025a-2ubuntu1) ... 209s 209s Current default time zone: 'Etc/UTC' 209s Local time is now: Sat Feb 22 04:47:50 UTC 2025. 209s Universal Time is now: Sat Feb 22 04:47:50 UTC 2025. 209s Run 'dpkg-reconfigure tzdata' if you wish to change it. 209s 209s Setting up eject (2.40.2-14ubuntu1) ... 209s Setting up apparmor (4.1.0~beta5-0ubuntu5) ... 209s Installing new version of config file /etc/apparmor.d/abstractions/dconf ... 209s Installing new version of config file /etc/apparmor.d/abstractions/mesa ... 209s Installing new version of config file /etc/apparmor.d/abstractions/nameservice ... 209s Installing new version of config file /etc/apparmor.d/abstractions/php ... 209s Installing new version of config file /etc/apparmor.d/abstractions/python ... 209s Installing new version of config file /etc/apparmor.d/sbuild ... 209s Installing new version of config file /etc/apparmor.d/sbuild-abort ... 209s Installing new version of config file /etc/apparmor.d/sbuild-adduser ... 209s Installing new version of config file /etc/apparmor.d/sbuild-apt ... 209s Installing new version of config file /etc/apparmor.d/sbuild-checkpackages ... 209s Installing new version of config file /etc/apparmor.d/sbuild-clean ... 209s Installing new version of config file /etc/apparmor.d/sbuild-createchroot ... 209s Installing new version of config file /etc/apparmor.d/sbuild-destroychroot ... 209s Installing new version of config file /etc/apparmor.d/sbuild-distupgrade ... 209s Installing new version of config file /etc/apparmor.d/sbuild-hold ... 209s Installing new version of config file /etc/apparmor.d/sbuild-shell ... 209s Installing new version of config file /etc/apparmor.d/sbuild-unhold ... 209s Installing new version of config file /etc/apparmor.d/sbuild-update ... 209s Installing new version of config file /etc/apparmor.d/sbuild-upgrade ... 209s Installing new version of config file /etc/apparmor.d/slirp4netns ... 209s Installing new version of config file /etc/apparmor.d/toybox ... 209s Installing new version of config file /etc/apparmor.d/transmission ... 209s Installing new version of config file /etc/apparmor.d/tunables/global ... 209s apparmor_parser: Unable to replace "lsb_release". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 209s 209s apparmor_parser: Unable to replace "kmod". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 209s 209s apparmor_parser: Unable to replace "nvidia_modprobe". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 209s 211s Reloading AppArmor profiles 211s /sbin/apparmor_parser: Unable to replace "1password". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "Discord". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "MongoDB Compass". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "QtWebEngineProcess". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "balena-etcher". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "brave". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "buildah". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "busybox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "cam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ch-checkns". /sbin/apparmor_parser: Unable to replace "babeld". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "bfdd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ch-run". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "chrome". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "chromium". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "bwrap". /sbin/apparmor_parser: Unable to replace "alsamixer". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "vscode". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "crun". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "devhelp". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "element-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "bgpd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "epiphany". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "evolution". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "firefox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "flatpak". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "foliate". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "dnstracer". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "geary". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "eigrpd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "goldendict". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ipa_verify". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "github-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "fabricd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "kchmviewer". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "keybase". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lc-compliance". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "fusermount3". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "libcamerify". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "linux-sandbox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "loupe". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "Xorg". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "isisd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lxc-attach". /sbin/apparmor_parser: Unable to replace "lxc-create". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "iotop-c". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lxc-destroy". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lxc-execute". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lxc-stop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lxc-unshare". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ldpd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lxc-usernsexec". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lsblk". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lsusb". /sbin/apparmor_parser: Unable to replace "mmdebstrap". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "msedge". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "nautilus". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "notepadqq". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "lsb_release". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "opam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "obsidian". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "mbsync". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "opera". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "mosquitto". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "irssi". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "pageedit". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "nhrpd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ospf6d". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "kmod". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "nvidia_modprobe". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "nc.openbsd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "pathd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "pbrd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "polypane". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "privacybrowser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "podman". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ospfd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "QtWebEngineProcess". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "plasmashell". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "qcam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "qmapshack". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "qutebrowser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "pim6d". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "rootlesskit". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ip". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "openvpn". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "rpm". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "rssguard". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "pimd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "runc". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-apt". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-abort". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-adduser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-checkpackages". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ripd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-clean". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-destroychroot". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-distupgrade". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-createchroot". /sbin/apparmor_parser: Unable to replace "ripngd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-hold". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-shell". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-unhold". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "scide". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "sbuild-update". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "signal-desktop". /sbin/apparmor_parser: Unable to replace "sbuild-upgrade". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "slack". /sbin/apparmor_parser: Unable to replace "slirp4netns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "steam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "stress-ng". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "surfshark". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "thunderbird". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "systemd-coredump". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "toybox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "trinity". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "tinyproxy". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "tup". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "tuxedo-control-center". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "staticd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "mx-extract". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "rygel". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "unprivileged_userns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "unix-chkpwd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "unpriv_unshare". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "userbindmount". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "cmds". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "tnftp". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "dumpcap". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "tshark". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "uwsgi-core". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "vdens". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "virtiofsd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "vivaldi-bin". /sbin/apparmor_parser: Unable to replace "rsyslogd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "/usr/bin/man". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "vpnns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ubuntu_pro_apt_news". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "remmina". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "wike". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "wpcom". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "wg". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "vrrpd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ip". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "wg-quick". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "tcpdump". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "znc". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "apt_methods". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "ubuntu_pro_esm_cache". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s /sbin/apparmor_parser: Unable to replace "transmission-cli". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 211s 211s Error: At least one profile failed to load 211s Setting up libglib2.0-data (2.83.4-1) ... 211s Setting up vim-common (2:9.1.0967-1ubuntu2) ... 211s Setting up busybox-static (1:1.37.0-4ubuntu1) ... 211s Setting up libwrap0:armhf (7.6.q-35) ... 211s Setting up libnvme1t64 (1.11.1-2) ... 211s Setting up make (4.4.1-1) ... 211s Setting up libnspr4:armhf (2:4.36-1ubuntu1) ... 211s Setting up gnupg-l10n (2.4.4-2ubuntu22) ... 211s Setting up ed (1.21-1) ... 211s Setting up bash-completion (1:2.16.0-7) ... 211s Setting up libncurses6:armhf (6.5+20250125-2) ... 211s Setting up libdbus-1-3:armhf (1.16.0-1ubuntu1) ... 211s Setting up libfribidi0:armhf (1.0.16-1) ... 211s Setting up libpng16-16t64:armhf (1.6.46-4) ... 211s Setting up systemd-timesyncd (257.2-3ubuntu1) ... 212s systemd-time-wait-sync.service is a disabled or a static unit not running, not starting it. 212s Setting up libatomic1:armhf (15-20250213-1ubuntu1) ... 212s Setting up udev (257.2-3ubuntu1) ... 213s Setting up libss2:armhf (1.47.2-1ubuntu1) ... 213s Setting up usb.ids (2025.01.14-1) ... 213s Setting up dhcpcd-base (1:10.1.0-7) ... 213s Installing new version of config file /etc/dhcpcd.conf ... 213s Setting up ucf (3.0050) ... 213s Installing new version of config file /etc/ucf.conf ... 213s Setting up libncursesw6:armhf (6.5+20250125-2) ... 213s Setting up libk5crypto3:armhf (1.21.3-4ubuntu1) ... 213s Setting up busybox-initramfs (1:1.37.0-4ubuntu1) ... 213s Setting up libxtables12:armhf (1.8.11-2ubuntu1) ... 213s Setting up logsave (1.47.2-1ubuntu1) ... 213s Setting up libsasl2-2:armhf (2.1.28+dfsg1-8build1) ... 213s Setting up lsof (4.99.4+dfsg-2) ... 213s Setting up libfdisk1:armhf (2.40.2-14ubuntu1) ... 213s Setting up libicu74:armhf (74.2-1ubuntu6) ... 213s Setting up nano (8.3-1) ... 213s Installing new version of config file /etc/nanorc ... 213s Setting up libdevmapper1.02.1:armhf (2:1.02.201-1ubuntu1) ... 213s Setting up whiptail (0.52.24-4ubuntu1) ... 213s Setting up python-apt-common (2.9.9) ... 213s Setting up dracut-install (106-2ubuntu1) ... 213s Setting up perl-modules-5.40 (5.40.1-2) ... 213s Setting up dmsetup (2:1.02.201-1ubuntu1) ... 213s Setting up uuid-runtime (2.40.2-14ubuntu1) ... 214s uuidd.service is a disabled or a static unit not running, not starting it. 214s Setting up xauth (1:1.1.2-1.1) ... 214s Setting up groff-base (1.23.0-7) ... 214s Setting up libtraceevent1:armhf (1:1.8.4-2) ... 214s Setting up dbus-session-bus-common (1.16.0-1ubuntu1) ... 214s Setting up kpartx (0.9.9-1ubuntu4) ... 214s Setting up libpcap0.8t64:armhf (1.10.5-2ubuntu1) ... 214s Setting up libcryptsetup12:armhf (2:2.7.5-1ubuntu2) ... 214s Setting up libjson-glib-1.0-common (1.10.6+ds-1) ... 214s Setting up mawk (1.3.4.20250131-1) ... 214s Setting up libkrb5-3:armhf (1.21.3-4ubuntu1) ... 214s Setting up libusb-1.0-0:armhf (2:1.0.27-2) ... 214s Setting up libicu76:armhf (76.1-1ubuntu2) ... 214s Setting up linux-headers-6.12.0-15 (6.12.0-15.15) ... 214s Setting up keyboard-configuration (1.226ubuntu3) ... 215s Your console font configuration will be updated the next time your system 215s boots. If you want to update it now, run 'setupcon' from a virtual console. 215s update-initramfs: deferring update (trigger activated) 215s Setting up libbinutils:armhf (2.44-2ubuntu1) ... 215s Setting up dbus-system-bus-common (1.16.0-1ubuntu1) ... 215s Setting up openssl (3.4.1-1ubuntu1) ... 215s Installing new version of config file /etc/ssl/openssl.cnf ... 215s Setting up libgpg-error-l10n (1.51-3) ... 215s Setting up iputils-ping (3:20240905-1ubuntu1) ... 215s Setting up readline-common (8.2-6) ... 215s Setting up publicsuffix (20250108.1153-0.1) ... 215s Setting up libxml2:armhf (2.12.7+dfsg+really2.9.14-0.2ubuntu3) ... 215s Setting up tmux (3.5a-3) ... 215s Setting up zstd (1.5.6+dfsg-2) ... 215s Setting up libldap2:armhf (2.6.9+dfsg-1~exp2ubuntu1) ... 215s Setting up dbus-bin (1.16.0-1ubuntu1) ... 215s Setting up libbpf1:armhf (1:1.5.0-2) ... 215s Setting up iputils-tracepath (3:20240905-1ubuntu1) ... 215s Setting up rsync (3.4.1-0syncable1) ... 216s rsync.service is a disabled or a static unit not running, not starting it. 216s Setting up python3.13-gdbm (3.13.2-1) ... 216s Setting up ethtool (1:6.11-1) ... 216s Setting up gnupg-utils (2.4.4-2ubuntu22) ... 216s Setting up initramfs-tools-bin (0.145ubuntu2) ... 216s Setting up ncurses-term (6.5+20250125-2) ... 216s Setting up login (1:4.16.0-2+really2.40.2-14ubuntu1) ... 216s Setting up cron-daemon-common (3.0pl1-192ubuntu1) ... 216s Setting up libxkbcommon0:armhf (1.7.0-2) ... 216s Setting up libctf0:armhf (2.44-2ubuntu1) ... 216s Setting up cryptsetup-bin (2:2.7.5-1ubuntu2) ... 216s Setting up pinentry-curses (1.3.1-2ubuntu2) ... 216s Setting up python3.12-minimal (3.12.9-1) ... 217s Setting up libnftables1:armhf (1.1.1-1build1) ... 217s Setting up nftables (1.1.1-1build1) ... 218s Setting up iptables (1.8.11-2ubuntu1) ... 218s Setting up htop (3.3.0-5) ... 218s Setting up iproute2 (6.13.0-1ubuntu1) ... 218s Setting up btrfs-progs (6.12-1build1) ... 218s Setting up cron (3.0pl1-192ubuntu1) ... 219s Setting up rsyslog (8.2412.0-2ubuntu1) ... 219s Installing new version of config file /etc/apparmor.d/usr.sbin.rsyslogd ... 219s info: The user `syslog' is already a member of `adm'. 219s apparmor_parser: Unable to replace "rsyslogd". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 219s 220s Setting up inetutils-telnet (2:2.5-6ubuntu1) ... 220s Setting up e2fsprogs (1.47.2-1ubuntu1) ... 220s update-initramfs: deferring update (trigger activated) 221s Setting up libnss3:armhf (2:3.108-1ubuntu1) ... 221s Setting up dbus-daemon (1.16.0-1ubuntu1) ... 221s Setting up vim-tiny (2:9.1.0967-1ubuntu2) ... 221s Setting up multipath-tools (0.9.9-1ubuntu4) ... 221s Setting up libperl5.40:armhf (5.40.1-2) ... 221s Setting up libftdi1-2:armhf (1.5-8) ... 221s Setting up ca-certificates (20241223) ... 225s Updating certificates in /etc/ssl/certs... 227s rehash: warning: skipping ca-certificates.crt, it does not contain exactly one certificate or CRL 227s 7 added, 1 removed; done. 227s Setting up perl (5.40.1-2) ... 227s Setting up libglib2.0-0t64:armhf (2.83.4-1) ... 227s No schema files found: doing nothing. 227s Setting up systemd-cryptsetup (257.2-3ubuntu1) ... 227s Setting up dbus (1.16.0-1ubuntu1) ... 227s A reboot is required to replace the running dbus-daemon. 227s Please reboot the system when convenient. 227s Setting up libblockdev-utils3:armhf (3.3.0-1) ... 227s Setting up linux-headers-6.12.0-15-generic (6.12.0-15.15) ... 227s Setting up libgssapi-krb5-2:armhf (1.21.3-4ubuntu1) ... 227s Setting up gir1.2-glib-2.0:armhf (2.83.4-1) ... 227s Setting up libdpkg-perl (1.22.11ubuntu4) ... 227s Setting up libreadline8t64:armhf (8.2-6) ... 227s Setting up libblockdev-nvme3:armhf (3.3.0-1) ... 227s Setting up libblockdev-fs3:armhf (3.3.0-1) ... 227s Setting up libtraceevent1-plugin:armhf (1:1.8.4-2) ... 227s Setting up libplymouth5:armhf (24.004.60-2ubuntu5) ... 227s Setting up gpgconf (2.4.4-2ubuntu22) ... 227s Setting up libpam-systemd:armhf (257.2-3ubuntu1) ... 228s Setting up libgirepository-1.0-1:armhf (1.82.0-4) ... 228s Setting up initramfs-tools-core (0.145ubuntu2) ... 228s Setting up binutils-arm-linux-gnueabihf (2.44-2ubuntu1) ... 228s Setting up libarchive13t64:armhf (3.7.7-0ubuntu1) ... 228s Setting up libpython3.13-stdlib:armhf (3.13.2-1) ... 228s Setting up gpg (2.4.4-2ubuntu22) ... 228s Setting up libgudev-1.0-0:armhf (1:238-6) ... 228s Setting up libpolkit-gobject-1-0:armhf (126-2) ... 228s Setting up libgstreamer1.0-0:armhf (1.25.50-1) ... 228s Setcap worked! gst-ptp-helper is not suid! 228s Setting up libudisks2-0:armhf (2.10.1-11ubuntu2) ... 228s Setting up libpython3-stdlib:armhf (3.13.1-1~exp2) ... 228s Setting up systemd-resolved (257.2-3ubuntu1) ... 228s Setting up gpg-agent (2.4.4-2ubuntu22) ... 229s Setting up telnet (0.17+2.5-6ubuntu1) ... 229s Setting up libpython3.12-stdlib:armhf (3.12.9-1) ... 229s Setting up initramfs-tools (0.145ubuntu2) ... 229s update-initramfs: deferring update (trigger activated) 229s Setting up libblockdev-mdraid3:armhf (3.3.0-1) ... 229s Setting up libcurl4t64:armhf (8.12.0+git20250209.89ed161+ds-1ubuntu1) ... 229s Setting up bind9-libs:armhf (1:9.20.4-3ubuntu1) ... 229s Setting up e2fsprogs-l10n (1.47.2-1ubuntu1) ... 229s Setting up python3.13 (3.13.2-1) ... 230s Setting up libblockdev-swap3:armhf (3.3.0-1) ... 230s Setting up plymouth (24.004.60-2ubuntu5) ... 230s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 230s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 231s Setting up python3.12 (3.12.9-1) ... 232s Setting up libblockdev-loop3:armhf (3.3.0-1) ... 232s Setting up gpgsm (2.4.4-2ubuntu22) ... 232s Setting up libcurl3t64-gnutls:armhf (8.12.0+git20250209.89ed161+ds-1ubuntu1) ... 232s Setting up libglib2.0-bin (2.83.4-1) ... 232s Setting up libpackagekit-glib2-18:armhf (1.3.0-3build1) ... 232s Setting up libappstream5:armhf (1.0.4-1) ... 232s Setting up libqmi-glib5:armhf (1.35.6-1) ... 232s Setting up python3 (3.13.1-1~exp2) ... 232s /usr/bin/py3clean:101: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 232s for fn in glob1(directory, "%s.*" % fname): 232s Setting up linux-headers-generic (6.12.0-15.15+1) ... 232s Setting up binutils (2.44-2ubuntu1) ... 232s Setting up libnetplan1:armhf (1.1.2-2ubuntu1) ... 232s Setting up python3-newt:armhf (0.52.24-4ubuntu1) ... 232s Setting up libblockdev3:armhf (3.3.0-1) ... 232s Setting up fdisk (2.40.2-14ubuntu1) ... 232s Setting up dpkg-dev (1.22.11ubuntu4) ... 232s Setting up libjson-glib-1.0-0:armhf (1.10.6+ds-1) ... 232s Setting up libblockdev-part3:armhf (3.3.0-1) ... 232s Setting up dirmngr (2.4.4-2ubuntu22) ... 233s Setting up gir1.2-packagekitglib-1.0 (1.3.0-3build1) ... 233s Setting up dbus-user-session (1.16.0-1ubuntu1) ... 233s Setting up python3-jinja2 (3.1.5-2) ... 233s Setting up python3-pygments (2.18.0+dfsg-2) ... 235s Setting up python3-chardet (5.2.0+dfsg-2) ... 236s Setting up appstream (1.0.4-1) ... 238s ✔ Metadata cache was updated successfully. 238s Setting up python3-certifi (2025.1.31+ds-1) ... 238s Setting up gir1.2-girepository-2.0:armhf (1.82.0-4) ... 238s Setting up python3-gi (3.50.0-4) ... 238s Setting up python3-idna (3.10-1) ... 239s Setting up xfsprogs (6.12.0-1ubuntu1) ... 239s update-initramfs: deferring update (trigger activated) 239s Setting up keyboxd (2.4.4-2ubuntu22) ... 240s Setting up python3-urllib3 (2.3.0-1) ... 240s Setting up python3-json-pointer (2.4-3) ... 240s Setting up gnupg (2.4.4-2ubuntu22) ... 240s Setting up python3-netplan (1.1.2-2ubuntu1) ... 240s Setting up libpolkit-agent-1-0:armhf (126-2) ... 240s Setting up libgpgme11t64:armhf (1.24.2-1ubuntu1) ... 240s Setting up curl (8.12.0+git20250209.89ed161+ds-1ubuntu1) ... 240s Setting up libvolume-key1:armhf (0.3.12-9) ... 240s Setting up netplan-generator (1.1.2-2ubuntu1) ... 240s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 241s Setting up bind9-host (1:9.20.4-3ubuntu1) ... 241s Setting up python3-distro-info (1.13) ... 241s Setting up polkitd (126-2) ... 241s Setting up python3-more-itertools (10.6.0-1) ... 242s Setting up python3-attr (25.1.0-1) ... 242s Setting up gpg-wks-client (2.4.4-2ubuntu22) ... 242s Setting up libblockdev-crypto3:armhf (3.3.0-1) ... 242s Setting up python3-jwt (2.10.1-2) ... 242s Setting up python3-babel (2.17.0-1) ... 243s Setting up python3-rich (13.9.4-1) ... 243s Setting up python3-gdbm:armhf (3.13.1-1) ... 243s Setting up python3-problem-report (2.31.0+git20250220-0ubuntu1) ... 243s Setting up python3-apt (2.9.9) ... 244s Setting up python3-jsonpatch (1.32-5) ... 244s Setting up python3-bcrypt (4.2.0-2.1) ... 244s Setting up libqmi-proxy (1.35.6-1) ... 244s Setting up libfwupd3:armhf (2.0.6-3) ... 244s Setting up ufw (0.36.2-9) ... 246s Setting up python3-lazr.uri (1.0.6-5) ... 246s Setting up netplan.io (1.1.2-2ubuntu1) ... 246s Setting up unattended-upgrades (2.12ubuntu4) ... 246s Replacing config file /etc/apt/apt.conf.d/50unattended-upgrades with new version 247s Setting up pollinate (4.33-4ubuntu2) ... 247s Setting up python3-cryptography (43.0.0-1) ... 248s Setting up python3-wadllib (2.0.0-2) ... 248s Setting up python3-requests (2.32.3+dfsg-4ubuntu1) ... 248s Setting up bind9-dnsutils (1:9.20.4-3ubuntu1) ... 248s Setting up ubuntu-pro-client (34.1.3) ... 248s apparmor_parser: Unable to replace "ubuntu_pro_apt_news". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 248s 249s apparmor_parser: Unable to replace "apt_methods". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 249s 249s apparmor_parser: Unable to replace "ubuntu_pro_esm_cache". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 249s 250s Setting up fwupd (2.0.6-3) ... 251s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 251s fwupd.service is a disabled or a static unit not running, not starting it. 251s Setting up python3-referencing (0.35.1-2ubuntu1) ... 252s Setting up python3-pkg-resources (75.6.0-1) ... 252s Setting up ubuntu-pro-client-l10n (34.1.3) ... 252s Setting up udisks2 (2.10.1-11ubuntu2) ... 252s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 252s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 252s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 252s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 252s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 252s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 252s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 252s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 252s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 252s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 252s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 252s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 252s loop8: Failed to write 'change' to '/sys/devices/virtual/block/loop8/uevent': Permission denied 253s Setting up python3-setuptools (75.6.0-1) ... 254s Setting up python3-openssl (25.0.0-1) ... 255s Setting up python3-launchpadlib (2.1.0-1) ... 255s Setting up ubuntu-standard (1.547) ... 255s Setting up python3-apport (2.31.0+git20250220-0ubuntu1) ... 256s Setting up python3-oauthlib (3.2.2-3) ... 256s Setting up python3-software-properties (0.109) ... 256s Setting up python3-jsonschema (4.19.2-6ubuntu1) ... 257s Setting up cloud-init-base (25.1-0ubuntu1) ... 257s Installing new version of config file /etc/cloud/templates/sources.list.debian.deb822.tmpl ... 257s Installing new version of config file /etc/cloud/templates/sources.list.ubuntu.deb822.tmpl ... 259s Setting up cloud-init (25.1-0ubuntu1) ... 259s Setting up apport-core-dump-handler (2.31.0+git20250220-0ubuntu1) ... 260s Setting up apport (2.31.0+git20250220-0ubuntu1) ... 261s apport-autoreport.service is a disabled or a static unit not running, not starting it. 261s Setting up kbd (2.7.1-2ubuntu1) ... 261s Setting up console-setup-linux (1.226ubuntu3) ... 262s Setting up console-setup (1.226ubuntu3) ... 263s update-initramfs: deferring update (trigger activated) 263s Setting up ubuntu-minimal (1.547) ... 263s Processing triggers for libc-bin (2.40-4ubuntu1) ... 263s Processing triggers for systemd (257.2-3ubuntu1) ... 263s Processing triggers for man-db (2.13.0-1) ... 263s Processing triggers for shared-mime-info (2.4-5) ... 263s Warning: program compiled against libxml 212 using older 209 264s Processing triggers for sgml-base (1.31) ... 264s Processing triggers for debianutils (5.21) ... 264s Processing triggers for install-info (7.1.1-1) ... 264s Setting up packagekit (1.3.0-3build1) ... 264s Setting up packagekit-tools (1.3.0-3build1) ... 264s Setting up software-properties-common (0.109) ... 264s Processing triggers for initramfs-tools (0.145ubuntu2) ... 264s Setting up plymouth-theme-ubuntu-text (24.004.60-2ubuntu5) ... 264s Processing triggers for ca-certificates (20241223) ... 264s Updating certificates in /etc/ssl/certs... 266s 0 added, 0 removed; done. 266s Running hooks in /etc/ca-certificates/update.d... 266s done. 266s Processing triggers for initramfs-tools (0.145ubuntu2) ... 269s Reading package lists... 269s Building dependency tree... 269s Reading state information... 270s Starting pkgProblemResolver with broken count: 0 270s Starting 2 pkgProblemResolver with broken count: 0 270s Done 270s Solving dependencies... 271s The following packages will be REMOVED: 271s libapt-pkg6.0t64* libassuan0* libicu74* libnsl2* libpython3.12-minimal* 271s libpython3.12-stdlib* libunwind8* linux-headers-6.11.0-8* 271s linux-headers-6.11.0-8-generic* python3.12* python3.12-minimal* 272s 0 upgraded, 0 newly installed, 11 to remove and 0 not upgraded. 272s After this operation, 154 MB disk space will be freed. 272s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 92815 files and directories currently installed.) 272s Removing libapt-pkg6.0t64:armhf (2.9.29) ... 272s Removing libassuan0:armhf (2.5.6-1build1) ... 272s Removing libicu74:armhf (74.2-1ubuntu6) ... 272s Removing python3.12 (3.12.9-1) ... 272s Removing libpython3.12-stdlib:armhf (3.12.9-1) ... 272s Removing libnsl2:armhf (1.3.0-3build3) ... 272s Removing python3.12-minimal (3.12.9-1) ... 272s /usr/bin/py3clean:125: DeprecationWarning: glob.glob1 is deprecated and will be removed in Python 3.15. Use glob.glob and pass a directory to its root_dir argument instead. 272s for fn in glob1(directory, "%s.%s.py[co]" % (fname, magic_tag)): 273s Removing libpython3.12-minimal:armhf (3.12.9-1) ... 273s Removing libunwind8:armhf (1.6.2-3.1) ... 273s Removing linux-headers-6.11.0-8-generic (6.11.0-8.8) ... 274s Removing linux-headers-6.11.0-8 (6.11.0-8.8) ... 275s Processing triggers for systemd (257.2-3ubuntu1) ... 275s Processing triggers for man-db (2.13.0-1) ... 275s Processing triggers for libc-bin (2.40-4ubuntu1) ... 275s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60309 files and directories currently installed.) 275s Purging configuration files for python3.12-minimal (3.12.9-1) ... 275s Purging configuration files for libpython3.12-minimal:armhf (3.12.9-1) ... 277s autopkgtest [04:48:58]: rebooting testbed after setup commands that affected boot 329s autopkgtest [04:49:50]: testbed running kernel: Linux 6.8.0-52-generic #53~22.04.1-Ubuntu SMP PREEMPT_DYNAMIC Wed Jan 15 18:10:51 UTC 2 362s autopkgtest [04:50:23]: @@@@@@@@@@@@@@@@@@@@ apt-source exonerate 375s Get:1 http://ftpmaster.internal/ubuntu plucky/universe exonerate 2.4.0-5build2 (dsc) [2187 B] 375s Get:2 http://ftpmaster.internal/ubuntu plucky/universe exonerate 2.4.0-5build2 (tar) [521 kB] 375s Get:3 http://ftpmaster.internal/ubuntu plucky/universe exonerate 2.4.0-5build2 (diff) [9364 B] 375s gpgv: Signature made Mon Apr 1 05:47:10 2024 UTC 375s gpgv: using RSA key A089FB36AAFBDAD5ACC1325069F790171A210984 375s gpgv: Can't check signature: No public key 375s dpkg-source: warning: cannot verify inline signature for ./exonerate_2.4.0-5build2.dsc: no acceptable signature found 375s autopkgtest [04:50:36]: testing package exonerate version 2.4.0-5build2 377s autopkgtest [04:50:38]: build not needed 380s autopkgtest [04:50:41]: test run-unit-test: preparing testbed 382s Reading package lists... 383s Building dependency tree... 383s Reading state information... 383s Starting pkgProblemResolver with broken count: 0 383s Starting 2 pkgProblemResolver with broken count: 0 383s Done 384s The following NEW packages will be installed: 384s exonerate 384s 0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 384s Need to get 1893 kB of archives. 384s After this operation, 6546 kB of additional disk space will be used. 384s Get:1 http://ftpmaster.internal/ubuntu plucky/universe armhf exonerate armhf 2.4.0-5build2 [1893 kB] 385s Fetched 1893 kB in 1s (3082 kB/s) 385s Selecting previously unselected package exonerate. 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 60307 files and directories currently installed.) 385s Preparing to unpack .../exonerate_2.4.0-5build2_armhf.deb ... 385s Unpacking exonerate (2.4.0-5build2) ... 385s Setting up exonerate (2.4.0-5build2) ... 385s Processing triggers for man-db (2.13.0-1) ... 395s autopkgtest [04:50:56]: test run-unit-test: [----------------------- 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/exonerate/exonerate.simple.test.sh 397s Exonerate simple test OK 397s Score as expected: 10875 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/ipcress/ipcress.simple.test.sh 397s Ipcress run successfully 397s Found 1 product, as expected 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastaclean.test.sh 397s >CALM_HUMAN:filter(clean) 397s MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 397s TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 397s EFVQMMTAK 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastaclip.test.sh 397s ** Message: 04:50:58.181: Loaded [1] experiments 397s Clipped OK 397s >test:subseq(0,4) 397s ACGT 397s Clipped input correctly 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastacomposition.test.sh 397s Calmodulin cDNA composition correct 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastadiff.test.sh 397s fastadiff: id mismatch: CALM_HUMAN P53_HUMAN 397s Different seqs recognised as different 397s Identity test OK 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastaexpode.test.sh 397s Made input file for fastaexplode 397s Make output directory for fastaexplode 397s Successfully ran fastaexplode on: fastaexplode.test.fasta 397s Expected number of seqs in output: 4 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastaindex.fastafetch.test.sh 397s Made index fastafetch.test.idx 397s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx CALM_HUMAN 397s expect 0 397s >CALM_HUMAN 397s MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 397s TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 397s EFVQMMTAK 397s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx P53_HUMAN 397s expect 0 397s ** FATAL ERROR **: Could not find identifier [A_MISSING_FROM_START] (missing -F ?) 397s exiting ... 397s >P53_HUMAN 397s MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA 397s PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT 397s CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN 397s TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGR 397s DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL 397s KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD 397s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx A_MISSING_FROM_START 397s expect 1 397s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx M_MISSING_FROM_MIDDLE 397s expect 1 397s ** FATAL ERROR **: Could not find identifier [M_MISSING_FROM_MIDDLE] (missing -F ?) 397s exiting ... 397s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx z_MISSING_FROM_END 397s expect 1 397s ** FATAL ERROR **: Could not find identifier [z_MISSING_FROM_END] (missing -F ?) 397s exiting ... 397s fastaindex fastafetch test OK 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastalength.test.sh 397s 149 CALM_HUMAN 397s Calmodulin length OK 397s Calmodulin identifier OK 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastanrdb.test.sh 397s Made input file for fastanrdb 397s Successfully ran fastanrdb on: fastanrdb.input.test.fasta 397s Expected number of seqs in output: 4 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastaoverlap.test.sh 397s /usr/bin/fastaoverlap working OK 397s Generated 15 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastarefomat.test.sh 397s Reformatted OK 397s >test 397s ACGTAACCGGTTAAACCCGGGTTTAAAACCCCGGGGTTTT 397s Reformatted length consistent 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastaremove.test.sh 397s Have calmodulin in input 397s ** FATAL ERROR **: Could not open list for removal [CALM_HUMAN] 397s exiting ... 397s Calmodulin successfully removed 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastarevcomp.test.sh 397s Reverse complement created : ./data/cdna/calm.human.dna.fasta 397s Reverse complement created : fastarevcomp.rc.test.fasta 397s RC length is the same 397s RC length is the same 397s 2nd reverse complement same as original 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastasoftmask.fastahardmask.test.sh 397s Softmasked OK 397s >test 397s ACGNAACCGGNNAAACCCGGGNNNAAAACCCCGGGGNNNN 397s Hardmasked OK 397s Hardmasked file is same as original masked file 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastasort.test.sh 397s Sorted CALM_HUMAN 149 397s Sorted P53_HUMAN 393 397s Sorted TUBE_DROME 462 397s Sorted AF01595 1132 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastasplit.test.sh 397s Split fastasplit.test.fasta OK 397s Split into two files as expected 397s Input len 2136 397s Output len 2136 397s Input and output lengths match 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastasubseq.test.sh 397s Generated correct subseq 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastatranslate.test.sh 397s Extraced CDS for translation 397s Tranlated sequence 397s Tranlsated sequence correct 397s 397s /tmp/autopkgtest.VqRcO1/autopkgtest_tmp/util/fastavalidcds.test.sh 397s 397s ** (process:1006): WARNING **: 04:50:58.520: odd_length length (7) not divisible by 3 397s 397s ** (process:1006): WARNING **: 04:50:58.520: too_short length (4) not divisible by 3 397s 397s ** (process:1006): WARNING **: 04:50:58.520: no_start missing start codon (has:AAA) 397s 397s ** (process:1006): WARNING **: 04:50:58.520: no_end missing stop codon (has:TTT) 397s 397s ** (process:1006): WARNING **: 04:50:58.520: in_frame_stop contains in-frame stop codon (pos:9, codon:TAG) 397s 397s ** (process:1006): WARNING **: 04:50:58.520: non_acgt_base contains non-ACGT base: [pos: 5 base: N] 397s Validiated CDS sequences OK 397s >valid_seq 397s ATGAAACCCGGGTTTTAA 397s Validated correctly a single seq from input 397s PASS 397s autopkgtest [04:50:58]: test run-unit-test: -----------------------] 402s run-unit-test PASS 402s autopkgtest [04:51:03]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 406s autopkgtest [04:51:07]: @@@@@@@@@@@@@@@@@@@@ summary 406s run-unit-test PASS