0s autopkgtest [17:07:57]: starting date and time: 2025-03-15 17:07:57+0000 0s autopkgtest [17:07:57]: git checkout: 325255d2 Merge branch 'pin-any-arch' into 'ubuntu/production' 0s autopkgtest [17:07:57]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.6bfl_rw3/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:glibc --apt-upgrade tm-align --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=glibc/2.41-1ubuntu2 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos03-arm64-9.secgroup --name adt-plucky-arm64-tm-align-20250315-170757-juju-7f2275-prod-proposed-migration-environment-2-1f774bfb-5dac-456a-ae50-c532796f46c7 --image adt/ubuntu-plucky-arm64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com,radosgw.ps5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 177s autopkgtest [17:10:54]: testbed dpkg architecture: arm64 177s autopkgtest [17:10:54]: testbed apt version: 2.9.33 177s autopkgtest [17:10:54]: @@@@@@@@@@@@@@@@@@@@ test bed setup 178s autopkgtest [17:10:55]: testbed release detected to be: None 178s autopkgtest [17:10:55]: updating testbed package index (apt update) 179s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [126 kB] 179s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 179s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 179s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 179s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [15.8 kB] 179s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [99.7 kB] 179s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [379 kB] 180s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 Packages [111 kB] 180s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 c-n-f Metadata [1856 B] 180s Get:10 http://ftpmaster.internal/ubuntu plucky-proposed/restricted arm64 c-n-f Metadata [116 B] 180s Get:11 http://ftpmaster.internal/ubuntu plucky-proposed/universe arm64 Packages [324 kB] 180s Get:12 http://ftpmaster.internal/ubuntu plucky-proposed/universe arm64 c-n-f Metadata [14.7 kB] 180s Get:13 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse arm64 Packages [4948 B] 180s Get:14 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse arm64 c-n-f Metadata [268 B] 181s Fetched 1078 kB in 2s (626 kB/s) 181s Reading package lists... 182s Reading package lists... 182s Building dependency tree... 182s Reading state information... 183s Calculating upgrade... 183s Calculating upgrade... 183s The following packages will be upgraded: 183s pinentry-curses python3-jinja2 strace 184s 3 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 184s Need to get 647 kB of archives. 184s After this operation, 11.3 kB of additional disk space will be used. 184s Get:1 http://ftpmaster.internal/ubuntu plucky/main arm64 strace arm64 6.13+ds-1ubuntu1 [499 kB] 184s Get:2 http://ftpmaster.internal/ubuntu plucky/main arm64 pinentry-curses arm64 1.3.1-2ubuntu3 [39.2 kB] 184s Get:3 http://ftpmaster.internal/ubuntu plucky/main arm64 python3-jinja2 all 3.1.5-2ubuntu1 [109 kB] 185s Fetched 647 kB in 1s (573 kB/s) 185s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 117701 files and directories currently installed.) 185s Preparing to unpack .../strace_6.13+ds-1ubuntu1_arm64.deb ... 185s Unpacking strace (6.13+ds-1ubuntu1) over (6.11-0ubuntu1) ... 185s Preparing to unpack .../pinentry-curses_1.3.1-2ubuntu3_arm64.deb ... 185s Unpacking pinentry-curses (1.3.1-2ubuntu3) over (1.3.1-2ubuntu2) ... 185s Preparing to unpack .../python3-jinja2_3.1.5-2ubuntu1_all.deb ... 186s Unpacking python3-jinja2 (3.1.5-2ubuntu1) over (3.1.5-2) ... 186s Setting up pinentry-curses (1.3.1-2ubuntu3) ... 186s Setting up python3-jinja2 (3.1.5-2ubuntu1) ... 186s Setting up strace (6.13+ds-1ubuntu1) ... 186s Processing triggers for man-db (2.13.0-1) ... 187s Reading package lists... 187s Building dependency tree... 187s Reading state information... 187s Solving dependencies... 188s The following packages will be REMOVED: 188s libnsl2* libpython3.12-minimal* libpython3.12-stdlib* libpython3.12t64* 188s libunwind8* linux-headers-6.11.0-8* linux-headers-6.11.0-8-generic* 188s linux-image-6.11.0-8-generic* linux-modules-6.11.0-8-generic* 188s linux-tools-6.11.0-8* linux-tools-6.11.0-8-generic* 188s 0 upgraded, 0 newly installed, 11 to remove and 5 not upgraded. 188s After this operation, 267 MB disk space will be freed. 188s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 117701 files and directories currently installed.) 188s Removing linux-tools-6.11.0-8-generic (6.11.0-8.8) ... 188s Removing linux-tools-6.11.0-8 (6.11.0-8.8) ... 188s Removing libpython3.12t64:arm64 (3.12.9-1) ... 188s Removing libpython3.12-stdlib:arm64 (3.12.9-1) ... 188s Removing libnsl2:arm64 (1.3.0-3build3) ... 188s Removing libpython3.12-minimal:arm64 (3.12.9-1) ... 188s Removing libunwind8:arm64 (1.6.2-3.1) ... 188s Removing linux-headers-6.11.0-8-generic (6.11.0-8.8) ... 189s Removing linux-headers-6.11.0-8 (6.11.0-8.8) ... 190s Removing linux-image-6.11.0-8-generic (6.11.0-8.8) ... 191s I: /boot/vmlinuz.old is now a symlink to vmlinuz-6.14.0-10-generic 191s I: /boot/initrd.img.old is now a symlink to initrd.img-6.14.0-10-generic 191s /etc/kernel/postrm.d/initramfs-tools: 191s update-initramfs: Deleting /boot/initrd.img-6.11.0-8-generic 191s /etc/kernel/postrm.d/zz-flash-kernel: 191s flash-kernel: Kernel 6.11.0-8-generic has been removed. 191s flash-kernel: A higher version (6.14.0-10-generic) is still installed, no reflashing required. 191s /etc/kernel/postrm.d/zz-update-grub: 191s Sourcing file `/etc/default/grub' 191s Sourcing file `/etc/default/grub.d/50-cloudimg-settings.cfg' 191s Generating grub configuration file ... 191s Found linux image: /boot/vmlinuz-6.14.0-10-generic 191s Found initrd image: /boot/initrd.img-6.14.0-10-generic 192s Warning: os-prober will not be executed to detect other bootable partitions. 192s Systems on them will not be added to the GRUB boot configuration. 192s Check GRUB_DISABLE_OS_PROBER documentation entry. 192s Adding boot menu entry for UEFI Firmware Settings ... 192s done 192s Removing linux-modules-6.11.0-8-generic (6.11.0-8.8) ... 192s Processing triggers for libc-bin (2.41-1ubuntu1) ... 192s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81650 files and directories currently installed.) 192s Purging configuration files for linux-image-6.11.0-8-generic (6.11.0-8.8) ... 192s Purging configuration files for libpython3.12-minimal:arm64 (3.12.9-1) ... 192s Purging configuration files for linux-modules-6.11.0-8-generic (6.11.0-8.8) ... 192s autopkgtest [17:11:09]: upgrading testbed (apt dist-upgrade and autopurge) 193s Reading package lists... 193s Building dependency tree... 193s Reading state information... 193s Calculating upgrade...Starting pkgProblemResolver with broken count: 0 193s Starting 2 pkgProblemResolver with broken count: 0 193s Done 194s Entering ResolveByKeep 194s 195s Calculating upgrade... 195s The following packages will be upgraded: 195s libc-bin libc-dev-bin libc6 libc6-dev locales 195s 5 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 195s Need to get 9530 kB of archives. 195s After this operation, 0 B of additional disk space will be used. 195s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 libc6-dev arm64 2.41-1ubuntu2 [1750 kB] 198s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 libc-dev-bin arm64 2.41-1ubuntu2 [24.0 kB] 198s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 libc6 arm64 2.41-1ubuntu2 [2910 kB] 201s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 libc-bin arm64 2.41-1ubuntu2 [600 kB] 202s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 locales all 2.41-1ubuntu2 [4246 kB] 207s Preconfiguring packages ... 207s Fetched 9530 kB in 12s (816 kB/s) 207s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81647 files and directories currently installed.) 207s Preparing to unpack .../libc6-dev_2.41-1ubuntu2_arm64.deb ... 207s Unpacking libc6-dev:arm64 (2.41-1ubuntu2) over (2.41-1ubuntu1) ... 207s Preparing to unpack .../libc-dev-bin_2.41-1ubuntu2_arm64.deb ... 207s Unpacking libc-dev-bin (2.41-1ubuntu2) over (2.41-1ubuntu1) ... 207s Preparing to unpack .../libc6_2.41-1ubuntu2_arm64.deb ... 208s Unpacking libc6:arm64 (2.41-1ubuntu2) over (2.41-1ubuntu1) ... 208s Setting up libc6:arm64 (2.41-1ubuntu2) ... 208s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81647 files and directories currently installed.) 208s Preparing to unpack .../libc-bin_2.41-1ubuntu2_arm64.deb ... 208s Unpacking libc-bin (2.41-1ubuntu2) over (2.41-1ubuntu1) ... 208s Setting up libc-bin (2.41-1ubuntu2) ... 208s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81647 files and directories currently installed.) 208s Preparing to unpack .../locales_2.41-1ubuntu2_all.deb ... 208s Unpacking locales (2.41-1ubuntu2) over (2.41-1ubuntu1) ... 208s Setting up locales (2.41-1ubuntu2) ... 209s Generating locales (this might take a while)... 211s en_US.UTF-8... done 211s Generation complete. 211s Setting up libc-dev-bin (2.41-1ubuntu2) ... 211s Setting up libc6-dev:arm64 (2.41-1ubuntu2) ... 211s Processing triggers for man-db (2.13.0-1) ... 212s Processing triggers for systemd (257.3-1ubuntu3) ... 213s Reading package lists... 213s Building dependency tree... 213s Reading state information... 214s Starting pkgProblemResolver with broken count: 0 214s Starting 2 pkgProblemResolver with broken count: 0 214s Done 214s Solving dependencies... 215s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 215s autopkgtest [17:11:32]: rebooting testbed after setup commands that affected boot 238s autopkgtest [17:11:55]: testbed running kernel: Linux 6.14.0-10-generic #10-Ubuntu SMP PREEMPT_DYNAMIC Wed Mar 12 15:45:31 UTC 2025 241s autopkgtest [17:11:58]: @@@@@@@@@@@@@@@@@@@@ apt-source tm-align 244s Get:1 http://ftpmaster.internal/ubuntu plucky/universe tm-align 20190822+dfsg-2build1 (dsc) [2131 B] 244s Get:2 http://ftpmaster.internal/ubuntu plucky/universe tm-align 20190822+dfsg-2build1 (tar) [52.8 kB] 244s Get:3 http://ftpmaster.internal/ubuntu plucky/universe tm-align 20190822+dfsg-2build1 (diff) [818 kB] 244s gpgv: Signature made Sun Mar 22 16:27:16 2020 UTC 244s gpgv: using RSA key D56571B88A8BBAF140BF63D6BD7EAA60778FA6F5 244s gpgv: issuer "doko@ubuntu.com" 244s gpgv: Can't check signature: No public key 244s dpkg-source: warning: cannot verify inline signature for ./tm-align_20190822+dfsg-2build1.dsc: no acceptable signature found 244s autopkgtest [17:12:01]: testing package tm-align version 20190822+dfsg-2build1 245s autopkgtest [17:12:02]: build not needed 245s autopkgtest [17:12:02]: test run-unit-test: preparing testbed 245s Reading package lists... 246s Building dependency tree... 246s Reading state information... 246s Starting pkgProblemResolver with broken count: 0 246s Starting 2 pkgProblemResolver with broken count: 0 246s Done 247s The following NEW packages will be installed: 247s libgfortran5 tm-align 247s 0 upgraded, 2 newly installed, 0 to remove and 0 not upgraded. 247s Need to get 1308 kB of archives. 247s After this operation, 3270 kB of additional disk space will be used. 247s Get:1 http://ftpmaster.internal/ubuntu plucky/main arm64 libgfortran5 arm64 15-20250222-0ubuntu1 [444 kB] 248s Get:2 http://ftpmaster.internal/ubuntu plucky/universe arm64 tm-align arm64 20190822+dfsg-2build1 [864 kB] 249s Fetched 1308 kB in 2s (671 kB/s) 249s Selecting previously unselected package libgfortran5:arm64. 249s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81647 files and directories currently installed.) 249s Preparing to unpack .../libgfortran5_15-20250222-0ubuntu1_arm64.deb ... 249s Unpacking libgfortran5:arm64 (15-20250222-0ubuntu1) ... 249s Selecting previously unselected package tm-align. 249s Preparing to unpack .../tm-align_20190822+dfsg-2build1_arm64.deb ... 249s Unpacking tm-align (20190822+dfsg-2build1) ... 250s Setting up libgfortran5:arm64 (15-20250222-0ubuntu1) ... 250s Setting up tm-align (20190822+dfsg-2build1) ... 250s Processing triggers for libc-bin (2.41-1ubuntu2) ... 250s Processing triggers for man-db (2.13.0-1) ... 251s autopkgtest [17:12:08]: test run-unit-test: [----------------------- 252s Run TMalign... 252s 252s ************************************************************************** 252s * TM-align (Version 20190822) * 252s * An algorithm for protein structure alignment and comparison * 252s * Based on statistics: * 252s * 0.0 < TM-score < 0.30, random structural similarity * 252s * 0.5 < TM-score < 1.00, in about the same fold * 252s * Reference: Y Zhang and J Skolnick, Nucl Acids Res 33, 2302-9 (2005) * 252s * Please email your comments and suggestions to: zhng@umich.edu * 252s ************************************************************************** 252s 252s Name of Chain_1: 1ni7.pdb 252s Name of Chain_2: 5eep.pdb 252s Length of Chain_1: 149 residues 252s Length of Chain_2: 140 residues 252s 252s Aligned length= 140, RMSD= 1.60, Seq_ID=n_identical/n_aligned= 0.986 252s TM-score= 0.85044 (if normalized by length of Chain_1) 252s TM-score= 0.90009 (if normalized by length of Chain_2) 252s (You should use TM-score normalized by length of the reference protein) 252s 252s (":" denotes aligned residue pairs of d < 5.0 A, "." denotes other aligned residues) 252s MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE 252s : ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 252s ------G-HPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV-- 252s 252s Run TMscore... 252s 252s ***************************************************************************** 252s * TM-SCORE * 252s * A scoring function to assess the similarity of protein structures * 252s * Based on statistics: * 252s * 0.0 < TM-score < 0.17, random structural similarity * 252s * 0.5 < TM-score < 1.00, in about the same fold * 252s * Reference: Yang Zhang and Jeffrey Skolnick, Proteins 2004 57: 702-710 * 252s * For comments, please email to: zhng@umich.edu * 252s ***************************************************************************** 252s 252s Structure1: 1ni7.pdb Length= 149 252s Structure2: 5eep.pdb Length= 140 (by which all scores are normalized) 252s Number of residues in common= 140 252s RMSD of the common residues= 1.616 252s 252s TM-score = 0.8987 (d0= 4.40) 252s MaxSub-score= 0.8459 (d0= 3.50) 252s GDT-TS-score= 0.8321 %(d<1)=0.4786 %(d<2)=0.8571 %(d<4)=0.9929 %(d<8)=1.0000 252s GDT-HA-score= 0.6214 %(d<0.5)=0.1571 %(d<1)=0.4786 %(d<2)=0.8571 %(d<4)=0.9929 252s 252s -------- rotation matrix to rotate Chain-1 to Chain-2 ------ 252s i t(i) u(i,1) u(i,2) u(i,3) 252s 1 0.9977278941 -0.2584957318 -0.9156232244 -0.3079189302 252s 2 13.5083713477 -0.8848339137 0.0965207762 0.4557989522 252s 3 45.5856492856 -0.3876195322 0.3902791958 -0.8351246898 252s 252s Superposition in the TM-score: Length(d<5.0)=140 RMSD= 1.62 252s (":" denotes the residue pairs of distance < 5.0 Angstrom) 252s MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE 252s :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 252s -------GHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV-- 252s 12345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789 252s 252s autopkgtest [17:12:09]: test run-unit-test: -----------------------] 252s autopkgtest [17:12:09]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 252s run-unit-test PASS 253s autopkgtest [17:12:10]: @@@@@@@@@@@@@@@@@@@@ summary 253s run-unit-test PASS 272s nova [W] Using flock in prodstack6-arm64 272s Creating nova instance adt-plucky-arm64-tm-align-20250315-170757-juju-7f2275-prod-proposed-migration-environment-2-1f774bfb-5dac-456a-ae50-c532796f46c7 from image adt/ubuntu-plucky-arm64-server-20250315.img (UUID bd6e766c-b51f-4b53-86d6-23aa4d18f524)... 272s nova [W] Timed out waiting for 4632857a-64af-444c-8e2d-88f3d4ccc6f4 to get deleted.