0s autopkgtest [09:30:46]: starting date and time: 2024-11-13 09:30:46+0000 0s autopkgtest [09:30:46]: git checkout: 6f3be7a8 Fix armhf LXD image generation for plucky 0s autopkgtest [09:30:46]: host juju-7f2275-prod-proposed-migration-environment-20; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.p71vrhpa/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:python3-defaults,src:python3-stdlib-extensions --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=python3-defaults/3.12.7-1 python3-stdlib-extensions/3.12.7-1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-20@bos03-arm64-3.secgroup --name adt-plucky-arm64-libedlib-20241113-093046-juju-7f2275-prod-proposed-migration-environment-20-9d5e176e-4bde-400d-95e8-c8cf5748dc0c --image adt/ubuntu-plucky-arm64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-20 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 102s autopkgtest [09:32:28]: testbed dpkg architecture: arm64 102s autopkgtest [09:32:28]: testbed apt version: 2.9.8 102s autopkgtest [09:32:28]: @@@@@@@@@@@@@@@@@@@@ test bed setup 103s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease [73.9 kB] 103s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/universe Sources [849 kB] 103s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse Sources [15.3 kB] 103s Get:4 http://ftpmaster.internal/ubuntu plucky-proposed/main Sources [76.4 kB] 103s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/restricted Sources [7016 B] 103s Get:6 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 Packages [104 kB] 103s Get:7 http://ftpmaster.internal/ubuntu plucky-proposed/restricted arm64 Packages [50.3 kB] 103s Get:8 http://ftpmaster.internal/ubuntu plucky-proposed/universe arm64 Packages [601 kB] 103s Get:9 http://ftpmaster.internal/ubuntu plucky-proposed/multiverse arm64 Packages [17.1 kB] 104s Fetched 1793 kB in 1s (2184 kB/s) 104s Reading package lists... 107s Reading package lists... 108s Building dependency tree... 108s Reading state information... 108s Calculating upgrade... 109s The following NEW packages will be installed: 109s python3.13-gdbm 109s The following packages will be upgraded: 109s libpython3-stdlib python3 python3-gdbm python3-minimal 109s 4 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 109s Need to get 101 kB of archives. 109s After this operation, 141 kB of additional disk space will be used. 109s Get:1 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 python3-minimal arm64 3.12.7-1 [27.4 kB] 109s Get:2 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 python3 arm64 3.12.7-1 [24.0 kB] 109s Get:3 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 libpython3-stdlib arm64 3.12.7-1 [10.0 kB] 109s Get:4 http://ftpmaster.internal/ubuntu plucky/main arm64 python3.13-gdbm arm64 3.13.0-2 [30.7 kB] 109s Get:5 http://ftpmaster.internal/ubuntu plucky-proposed/main arm64 python3-gdbm arm64 3.12.7-1 [8642 B] 110s Fetched 101 kB in 0s (284 kB/s) 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 79924 files and directories currently installed.) 110s Preparing to unpack .../python3-minimal_3.12.7-1_arm64.deb ... 110s Unpacking python3-minimal (3.12.7-1) over (3.12.6-0ubuntu1) ... 110s Setting up python3-minimal (3.12.7-1) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 79924 files and directories currently installed.) 110s Preparing to unpack .../python3_3.12.7-1_arm64.deb ... 111s Unpacking python3 (3.12.7-1) over (3.12.6-0ubuntu1) ... 111s Preparing to unpack .../libpython3-stdlib_3.12.7-1_arm64.deb ... 111s Unpacking libpython3-stdlib:arm64 (3.12.7-1) over (3.12.6-0ubuntu1) ... 111s Selecting previously unselected package python3.13-gdbm. 111s Preparing to unpack .../python3.13-gdbm_3.13.0-2_arm64.deb ... 111s Unpacking python3.13-gdbm (3.13.0-2) ... 111s Preparing to unpack .../python3-gdbm_3.12.7-1_arm64.deb ... 111s Unpacking python3-gdbm:arm64 (3.12.7-1) over (3.12.6-1ubuntu1) ... 111s Setting up python3.13-gdbm (3.13.0-2) ... 111s Setting up libpython3-stdlib:arm64 (3.12.7-1) ... 111s Setting up python3 (3.12.7-1) ... 111s Setting up python3-gdbm:arm64 (3.12.7-1) ... 111s Processing triggers for man-db (2.12.1-3) ... 112s Reading package lists... 113s Building dependency tree... 113s Reading state information... 113s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 114s Hit:1 http://ftpmaster.internal/ubuntu plucky-proposed InRelease 114s Hit:2 http://ftpmaster.internal/ubuntu plucky InRelease 114s Hit:3 http://ftpmaster.internal/ubuntu plucky-updates InRelease 114s Hit:4 http://ftpmaster.internal/ubuntu plucky-security InRelease 115s Reading package lists... 115s Reading package lists... 115s Building dependency tree... 115s Reading state information... 116s Calculating upgrade... 116s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 117s Reading package lists... 117s Building dependency tree... 117s Reading state information... 118s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 121s autopkgtest [09:32:47]: testbed running kernel: Linux 6.11.0-8-generic #8-Ubuntu SMP PREEMPT_DYNAMIC Mon Sep 16 14:19:41 UTC 2024 121s autopkgtest [09:32:47]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 124s Get:1 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (dsc) [2389 B] 124s Get:2 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (tar) [4319 kB] 124s Get:3 http://ftpmaster.internal/ubuntu plucky/universe libedlib 1.2.7-6 (diff) [7604 B] 125s gpgv: Signature made Sat Jul 13 18:52:01 2024 UTC 125s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 125s gpgv: issuer "emollier@debian.org" 125s gpgv: Can't check signature: No public key 125s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-6.dsc: no acceptable signature found 125s autopkgtest [09:32:51]: testing package libedlib version 1.2.7-6 125s autopkgtest [09:32:51]: build not needed 127s autopkgtest [09:32:52]: test run-unit-test: preparing testbed 128s Reading package lists... 129s Building dependency tree... 129s Reading state information... 129s Starting pkgProblemResolver with broken count: 0 129s Starting 2 pkgProblemResolver with broken count: 0 129s Done 130s The following additional packages will be installed: 130s edlib-aligner libedlib-dev libedlib1 python3-edlib 130s The following NEW packages will be installed: 130s autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib 130s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 130s Need to get 127 kB/128 kB of archives. 130s After this operation, 466 kB of additional disk space will be used. 130s Get:1 /tmp/autopkgtest.utfb2Q/1-autopkgtest-satdep.deb autopkgtest-satdep arm64 0 [724 B] 130s Get:2 http://ftpmaster.internal/ubuntu plucky/universe arm64 libedlib1 arm64 1.2.7-6 [17.9 kB] 130s Get:3 http://ftpmaster.internal/ubuntu plucky/universe arm64 edlib-aligner arm64 1.2.7-6 [23.5 kB] 130s Get:4 http://ftpmaster.internal/ubuntu plucky/universe arm64 libedlib-dev arm64 1.2.7-6 [22.2 kB] 130s Get:5 http://ftpmaster.internal/ubuntu plucky/universe arm64 python3-edlib arm64 1.2.7-6 [63.6 kB] 131s Fetched 127 kB in 0s (299 kB/s) 131s Selecting previously unselected package libedlib1:arm64. 131s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 79931 files and directories currently installed.) 131s Preparing to unpack .../libedlib1_1.2.7-6_arm64.deb ... 131s Unpacking libedlib1:arm64 (1.2.7-6) ... 131s Selecting previously unselected package edlib-aligner. 131s Preparing to unpack .../edlib-aligner_1.2.7-6_arm64.deb ... 131s Unpacking edlib-aligner (1.2.7-6) ... 131s Selecting previously unselected package libedlib-dev:arm64. 131s Preparing to unpack .../libedlib-dev_1.2.7-6_arm64.deb ... 131s Unpacking libedlib-dev:arm64 (1.2.7-6) ... 131s Selecting previously unselected package python3-edlib:arm64. 131s Preparing to unpack .../python3-edlib_1.2.7-6_arm64.deb ... 131s Unpacking python3-edlib:arm64 (1.2.7-6) ... 131s Selecting previously unselected package autopkgtest-satdep. 132s Preparing to unpack .../1-autopkgtest-satdep.deb ... 132s Unpacking autopkgtest-satdep (0) ... 132s Setting up libedlib1:arm64 (1.2.7-6) ... 132s Setting up python3-edlib:arm64 (1.2.7-6) ... 132s Setting up edlib-aligner (1.2.7-6) ... 132s Setting up libedlib-dev:arm64 (1.2.7-6) ... 132s Setting up autopkgtest-satdep (0) ... 132s Processing triggers for man-db (2.12.1-3) ... 132s Processing triggers for libc-bin (2.40-1ubuntu3) ... 135s (Reading database ... 79967 files and directories currently installed.) 135s Removing autopkgtest-satdep (0) ... 136s autopkgtest [09:33:02]: test run-unit-test: [----------------------- 136s Using NW alignment mode. 136s Reading queries... 136s Read 1 queries, 110 residues total. 136s Reading target fasta file... 136s Read target, 109 residues. 136s 136s Comparing queries to target... 136s 136s Query #0 (110 residues): score = 17 136s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 136s ||||||| | |||||||||| ||||||||||||||||||||||||||| 136s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 136s 136s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 136s | |||||||||||| || |||||||||| ||||||||| |||||| | 136s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 136s 136s T: AESIKSKKKKKE-STTB (93 - 108) 136s ||||||||||| ||| 136s Q: -ESIKSKKKKKENSTT- (94 - 109) 136s 136s 136s Cpu time of searching: 0.000050 136s autopkgtest [09:33:02]: test run-unit-test: -----------------------] 137s autopkgtest [09:33:03]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 137s run-unit-test PASS 137s autopkgtest [09:33:03]: @@@@@@@@@@@@@@@@@@@@ summary 137s run-unit-test PASS 154s nova [W] Skipping flock in bos03-arm64 154s Creating nova instance adt-plucky-arm64-libedlib-20241113-093046-juju-7f2275-prod-proposed-migration-environment-20-9d5e176e-4bde-400d-95e8-c8cf5748dc0c from image adt/ubuntu-plucky-arm64-server-20241113.img (UUID 2d7760e6-2439-4200-89d6-5ed33e5c6330)...