0s autopkgtest [22:34:25]: starting date and time: 2024-07-12 22:34:25+0000 0s autopkgtest [22:34:25]: git checkout: fd3bed09 nova: allow more retries for quota issues 0s autopkgtest [22:34:25]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.71apy4ve/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:glibc --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=glibc/2.39-3.1ubuntu3 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest-s390x --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos03-s390x-1.secgroup --name adt-oracular-s390x-libedlib-20240712-223425-juju-7f2275-prod-proposed-migration-environment-2-66b72aae-0f12-4640-b49d-587b7df8d310 --image adt/ubuntu-oracular-s390x-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration-s390x -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 60s autopkgtest [22:35:25]: testbed dpkg architecture: s390x 60s autopkgtest [22:35:25]: testbed apt version: 2.9.6 60s autopkgtest [22:35:25]: @@@@@@@@@@@@@@@@@@@@ test bed setup 61s Get:1 http://ftpmaster.internal/ubuntu oracular-proposed InRelease [126 kB] 61s Get:2 http://ftpmaster.internal/ubuntu oracular-proposed/universe Sources [360 kB] 61s Get:3 http://ftpmaster.internal/ubuntu oracular-proposed/restricted Sources [8548 B] 61s Get:4 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse Sources [3288 B] 61s Get:5 http://ftpmaster.internal/ubuntu oracular-proposed/main Sources [46.5 kB] 61s Get:6 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x Packages [74.2 kB] 61s Get:7 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x c-n-f Metadata [2124 B] 61s Get:8 http://ftpmaster.internal/ubuntu oracular-proposed/restricted s390x Packages [1368 B] 61s Get:9 http://ftpmaster.internal/ubuntu oracular-proposed/restricted s390x c-n-f Metadata [120 B] 61s Get:10 http://ftpmaster.internal/ubuntu oracular-proposed/universe s390x Packages [369 kB] 61s Get:11 http://ftpmaster.internal/ubuntu oracular-proposed/universe s390x c-n-f Metadata [8408 B] 61s Get:12 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse s390x Packages [1788 B] 61s Get:13 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse s390x c-n-f Metadata [120 B] 61s Fetched 1002 kB in 1s (1451 kB/s) 61s Reading package lists... 63s Reading package lists... 63s Building dependency tree... 63s Reading state information... 64s Calculating upgrade... 64s The following packages will be upgraded: 64s libc-bin libc-dev-bin libc-devtools libc6 libc6-dev locales 64s 6 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 64s Need to get 9392 kB of archives. 64s After this operation, 109 kB of additional disk space will be used. 64s Get:1 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x libc-devtools s390x 2.39-3.1ubuntu3 [30.7 kB] 64s Get:2 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x libc6-dev s390x 2.39-3.1ubuntu3 [1626 kB] 64s Get:3 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x libc-dev-bin s390x 2.39-3.1ubuntu3 [20.2 kB] 64s Get:4 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x libc6 s390x 2.39-3.1ubuntu3 [2841 kB] 64s Get:5 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x libc-bin s390x 2.39-3.1ubuntu3 [654 kB] 64s Get:6 http://ftpmaster.internal/ubuntu oracular-proposed/main s390x locales all 2.39-3.1ubuntu3 [4220 kB] 65s Preconfiguring packages ... 65s Fetched 9392 kB in 1s (11.5 MB/s) 65s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 54730 files and directories currently installed.) 65s Preparing to unpack .../libc-devtools_2.39-3.1ubuntu3_s390x.deb ... 65s Unpacking libc-devtools (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 65s Preparing to unpack .../libc6-dev_2.39-3.1ubuntu3_s390x.deb ... 65s Unpacking libc6-dev:s390x (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 65s Preparing to unpack .../libc-dev-bin_2.39-3.1ubuntu3_s390x.deb ... 65s Unpacking libc-dev-bin (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 65s Preparing to unpack .../libc6_2.39-3.1ubuntu3_s390x.deb ... 65s Unpacking libc6:s390x (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 65s Setting up libc6:s390x (2.39-3.1ubuntu3) ... 65s Error: Could not restart systemd, systemd binary not working 65s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 54730 files and directories currently installed.) 65s Preparing to unpack .../libc-bin_2.39-3.1ubuntu3_s390x.deb ... 65s Unpacking libc-bin (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 65s Setting up libc-bin (2.39-3.1ubuntu3) ... 65s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 54730 files and directories currently installed.) 65s Preparing to unpack .../locales_2.39-3.1ubuntu3_all.deb ... 65s Unpacking locales (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 65s Setting up locales (2.39-3.1ubuntu3) ... 66s Generating locales (this might take a while)... 67s en_US.UTF-8... done 67s Generation complete. 67s Setting up libc-dev-bin (2.39-3.1ubuntu3) ... 67s Setting up libc-devtools (2.39-3.1ubuntu3) ... 67s Setting up libc6-dev:s390x (2.39-3.1ubuntu3) ... 67s Processing triggers for man-db (2.12.1-2) ... 67s Processing triggers for systemd (256-1ubuntu1) ... 68s Reading package lists... 68s Building dependency tree... 68s Reading state information... 68s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 68s Hit:1 http://ftpmaster.internal/ubuntu oracular-proposed InRelease 68s Get:2 http://ftpmaster.internal/ubuntu oracular InRelease [121 kB] 69s Hit:3 http://ftpmaster.internal/ubuntu oracular-updates InRelease 69s Hit:4 http://ftpmaster.internal/ubuntu oracular-security InRelease 69s Get:5 http://ftpmaster.internal/ubuntu oracular/universe Sources [20.3 MB] 70s Get:6 http://ftpmaster.internal/ubuntu oracular/main Sources [1388 kB] 70s Get:7 http://ftpmaster.internal/ubuntu oracular/main s390x Packages [1341 kB] 70s Get:8 http://ftpmaster.internal/ubuntu oracular/universe s390x Packages [14.6 MB] 73s Fetched 37.8 MB in 5s (8052 kB/s) 73s Reading package lists... 74s Reading package lists... 74s Building dependency tree... 74s Reading state information... 74s Calculating upgrade... 74s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 74s Reading package lists... 74s Building dependency tree... 74s Reading state information... 74s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 77s autopkgtest [22:35:42]: testbed running kernel: Linux 6.8.0-31-generic #31-Ubuntu SMP Sat Apr 20 00:14:26 UTC 2024 77s autopkgtest [22:35:42]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 80s Get:1 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (dsc) [2309 B] 80s Get:2 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (tar) [4319 kB] 80s Get:3 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (diff) [7568 B] 81s gpgv: Signature made Mon Apr 1 04:43:53 2024 UTC 81s gpgv: using RSA key A089FB36AAFBDAD5ACC1325069F790171A210984 81s gpgv: Can't check signature: No public key 81s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-5build1.dsc: no acceptable signature found 81s autopkgtest [22:35:46]: testing package libedlib version 1.2.7-5build1 81s autopkgtest [22:35:46]: build not needed 82s autopkgtest [22:35:47]: test run-unit-test: preparing testbed 83s Reading package lists... 83s Building dependency tree... 83s Reading state information... 83s Starting pkgProblemResolver with broken count: 0 83s Starting 2 pkgProblemResolver with broken count: 0 83s Done 83s The following additional packages will be installed: 83s edlib-aligner libedlib-dev libedlib1 python3-edlib 83s The following NEW packages will be installed: 83s autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib 83s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 83s Need to get 165 kB/166 kB of archives. 83s After this operation, 444 kB of additional disk space will be used. 83s Get:1 /tmp/autopkgtest.YYOeKK/1-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [728 B] 83s Get:2 http://ftpmaster.internal/ubuntu oracular/universe s390x libedlib1 s390x 1.2.7-5build1 [25.7 kB] 83s Get:3 http://ftpmaster.internal/ubuntu oracular/universe s390x edlib-aligner s390x 1.2.7-5build1 [33.2 kB] 84s Get:4 http://ftpmaster.internal/ubuntu oracular/universe s390x libedlib-dev s390x 1.2.7-5build1 [29.3 kB] 84s Get:5 http://ftpmaster.internal/ubuntu oracular/universe s390x python3-edlib s390x 1.2.7-5build1 [76.8 kB] 84s Fetched 165 kB in 0s (350 kB/s) 84s Selecting previously unselected package libedlib1:s390x. 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 54730 files and directories currently installed.) 84s Preparing to unpack .../libedlib1_1.2.7-5build1_s390x.deb ... 84s Unpacking libedlib1:s390x (1.2.7-5build1) ... 84s Selecting previously unselected package edlib-aligner. 84s Preparing to unpack .../edlib-aligner_1.2.7-5build1_s390x.deb ... 84s Unpacking edlib-aligner (1.2.7-5build1) ... 84s Selecting previously unselected package libedlib-dev:s390x. 84s Preparing to unpack .../libedlib-dev_1.2.7-5build1_s390x.deb ... 84s Unpacking libedlib-dev:s390x (1.2.7-5build1) ... 84s Selecting previously unselected package python3-edlib:s390x. 84s Preparing to unpack .../python3-edlib_1.2.7-5build1_s390x.deb ... 84s Unpacking python3-edlib:s390x (1.2.7-5build1) ... 84s Selecting previously unselected package autopkgtest-satdep. 84s Preparing to unpack .../1-autopkgtest-satdep.deb ... 84s Unpacking autopkgtest-satdep (0) ... 84s Setting up libedlib1:s390x (1.2.7-5build1) ... 84s Setting up python3-edlib:s390x (1.2.7-5build1) ... 84s Setting up edlib-aligner (1.2.7-5build1) ... 84s Setting up libedlib-dev:s390x (1.2.7-5build1) ... 84s Setting up autopkgtest-satdep (0) ... 84s Processing triggers for man-db (2.12.1-2) ... 84s Processing triggers for libc-bin (2.39-3.1ubuntu3) ... 86s (Reading database ... 54766 files and directories currently installed.) 86s Removing autopkgtest-satdep (0) ... 87s autopkgtest [22:35:52]: test run-unit-test: [----------------------- 87s Using NW alignment mode. 87s Reading queries... 87s Read 1 queries, 110 residues total. 87s Reading target fasta file... 87s Read target, 109 residues. 87s 87s Comparing queries to target... 87s 87s Query #0 (110 residues): score = 17 87s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 87s ||||||| | |||||||||| ||||||||||||||||||||||||||| 87s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 87s 87s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 87s | |||||||||||| || |||||||||| ||||||||| |||||| | 87s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 87s 87s T: AESIKSKKKKKE-STTB (93 - 108) 87s ||||||||||| ||| 87s Q: -ESIKSKKKKKENSTT- (94 - 109) 87s 87s 87s Cpu time of searching: 0.000046 87s autopkgtest [22:35:52]: test run-unit-test: -----------------------] 88s run-unit-test PASS 88s autopkgtest [22:35:53]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 88s autopkgtest [22:35:53]: @@@@@@@@@@@@@@@@@@@@ summary 88s run-unit-test PASS 92s nova [W] Using flock in prodstack6-s390x 92s Creating nova instance adt-oracular-s390x-libedlib-20240712-223425-juju-7f2275-prod-proposed-migration-environment-2-66b72aae-0f12-4640-b49d-587b7df8d310 from image adt/ubuntu-oracular-s390x-server-20240712.img (UUID f311c47c-be53-41f3-9922-fb5f2e9c075e)...