0s autopkgtest [20:36:38]: starting date and time: 2024-07-12 20:36:38+0000 0s autopkgtest [20:36:38]: git checkout: fd3bed09 nova: allow more retries for quota issues 0s autopkgtest [20:36:38]: host juju-7f2275-prod-proposed-migration-environment-3; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.mo2mg430/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:glibc --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=glibc/2.39-3.1ubuntu3 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-3@bos01-ppc64el-17.secgroup --name adt-oracular-ppc64el-libedlib-20240712-203637-juju-7f2275-prod-proposed-migration-environment-3-b897144e-1629-42df-a853-536ac9f231d3 --image adt/ubuntu-oracular-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-3 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://us.ports.ubuntu.com/ubuntu-ports/ 130s autopkgtest [20:38:48]: testbed dpkg architecture: ppc64el 130s autopkgtest [20:38:48]: testbed apt version: 2.9.6 130s autopkgtest [20:38:48]: @@@@@@@@@@@@@@@@@@@@ test bed setup 131s Get:1 http://ftpmaster.internal/ubuntu oracular-proposed InRelease [126 kB] 131s Get:2 http://ftpmaster.internal/ubuntu oracular-proposed/main Sources [46.5 kB] 131s Get:3 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse Sources [3288 B] 131s Get:4 http://ftpmaster.internal/ubuntu oracular-proposed/universe Sources [367 kB] 131s Get:5 http://ftpmaster.internal/ubuntu oracular-proposed/restricted Sources [8548 B] 131s Get:6 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el Packages [73.8 kB] 131s Get:7 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el c-n-f Metadata [2128 B] 131s Get:8 http://ftpmaster.internal/ubuntu oracular-proposed/restricted ppc64el Packages [1368 B] 131s Get:9 http://ftpmaster.internal/ubuntu oracular-proposed/restricted ppc64el c-n-f Metadata [120 B] 131s Get:10 http://ftpmaster.internal/ubuntu oracular-proposed/universe ppc64el Packages [370 kB] 131s Get:11 http://ftpmaster.internal/ubuntu oracular-proposed/universe ppc64el c-n-f Metadata [8448 B] 131s Get:12 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse ppc64el Packages [1788 B] 131s Get:13 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse ppc64el c-n-f Metadata [120 B] 133s Fetched 1009 kB in 1s (1319 kB/s) 133s Reading package lists... 136s Reading package lists... 136s Building dependency tree... 136s Reading state information... 136s Calculating upgrade... 136s The following packages will be upgraded: 136s binutils binutils-common binutils-powerpc64le-linux-gnu gir1.2-glib-2.0 136s inetutils-telnet libbinutils libc-bin libc-dev-bin libc-devtools libc6 136s libc6-dev libctf-nobfd0 libctf0 libglib2.0-0t64 libglib2.0-data 136s libnghttp2-14 libnss3 libsframe1 libssl3t64 locales openssh-client 136s openssh-server openssh-sftp-server openssl telnet 136s 25 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 136s Need to get 23.0 MB of archives. 136s After this operation, 1586 kB disk space will be freed. 136s Get:1 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el libc-devtools ppc64el 2.39-3.1ubuntu3 [29.5 kB] 136s Get:2 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el libc6-dev ppc64el 2.39-3.1ubuntu3 [1982 kB] 137s Get:3 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el libc-dev-bin ppc64el 2.39-3.1ubuntu3 [21.0 kB] 137s Get:4 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el libc6 ppc64el 2.39-3.1ubuntu3 [3174 kB] 137s Get:5 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el libc-bin ppc64el 2.39-3.1ubuntu3 [720 kB] 137s Get:6 http://ftpmaster.internal/ubuntu oracular/main ppc64el libssl3t64 ppc64el 3.2.2-1ubuntu1 [2345 kB] 137s Get:7 http://ftpmaster.internal/ubuntu oracular/main ppc64el openssh-sftp-server ppc64el 1:9.6p1-3ubuntu17 [43.6 kB] 137s Get:8 http://ftpmaster.internal/ubuntu oracular/main ppc64el openssh-server ppc64el 1:9.6p1-3ubuntu17 [624 kB] 137s Get:9 http://ftpmaster.internal/ubuntu oracular/main ppc64el openssh-client ppc64el 1:9.6p1-3ubuntu17 [1108 kB] 137s Get:10 http://ftpmaster.internal/ubuntu oracular/main ppc64el gir1.2-glib-2.0 ppc64el 2.80.4-1ubuntu1 [182 kB] 137s Get:11 http://ftpmaster.internal/ubuntu oracular/main ppc64el libglib2.0-0t64 ppc64el 2.80.4-1ubuntu1 [1763 kB] 137s Get:12 http://ftpmaster.internal/ubuntu oracular/main ppc64el libglib2.0-data all 2.80.4-1ubuntu1 [49.3 kB] 137s Get:13 http://ftpmaster.internal/ubuntu oracular-proposed/main ppc64el locales all 2.39-3.1ubuntu3 [4220 kB] 137s Get:14 http://ftpmaster.internal/ubuntu oracular/main ppc64el openssl ppc64el 3.2.2-1ubuntu1 [1147 kB] 137s Get:15 http://ftpmaster.internal/ubuntu oracular/main ppc64el inetutils-telnet ppc64el 2:2.5-5ubuntu1 [120 kB] 137s Get:16 http://ftpmaster.internal/ubuntu oracular/main ppc64el libnghttp2-14 ppc64el 1.62.1-2 [89.3 kB] 137s Get:17 http://ftpmaster.internal/ubuntu oracular/main ppc64el telnet all 0.17+2.5-5ubuntu1 [3688 B] 137s Get:18 http://ftpmaster.internal/ubuntu oracular/main ppc64el libctf0 ppc64el 2.42.50.20240710-1ubuntu1 [113 kB] 137s Get:19 http://ftpmaster.internal/ubuntu oracular/main ppc64el libctf-nobfd0 ppc64el 2.42.50.20240710-1ubuntu1 [113 kB] 137s Get:20 http://ftpmaster.internal/ubuntu oracular/main ppc64el binutils-powerpc64le-linux-gnu ppc64el 2.42.50.20240710-1ubuntu1 [2492 kB] 137s Get:21 http://ftpmaster.internal/ubuntu oracular/main ppc64el libbinutils ppc64el 2.42.50.20240710-1ubuntu1 [702 kB] 137s Get:22 http://ftpmaster.internal/ubuntu oracular/main ppc64el binutils ppc64el 2.42.50.20240710-1ubuntu1 [3092 B] 137s Get:23 http://ftpmaster.internal/ubuntu oracular/main ppc64el binutils-common ppc64el 2.42.50.20240710-1ubuntu1 [220 kB] 137s Get:24 http://ftpmaster.internal/ubuntu oracular/main ppc64el libsframe1 ppc64el 2.42.50.20240710-1ubuntu1 [15.8 kB] 137s Get:25 http://ftpmaster.internal/ubuntu oracular/main ppc64el libnss3 ppc64el 2:3.102-1 [1748 kB] 138s Preconfiguring packages ... 138s Fetched 23.0 MB in 1s (18.3 MB/s) 138s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 72765 files and directories currently installed.) 138s Preparing to unpack .../libc-devtools_2.39-3.1ubuntu3_ppc64el.deb ... 138s Unpacking libc-devtools (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 138s Preparing to unpack .../libc6-dev_2.39-3.1ubuntu3_ppc64el.deb ... 138s Unpacking libc6-dev:ppc64el (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 138s Preparing to unpack .../libc-dev-bin_2.39-3.1ubuntu3_ppc64el.deb ... 138s Unpacking libc-dev-bin (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 138s Preparing to unpack .../libc6_2.39-3.1ubuntu3_ppc64el.deb ... 138s Unpacking libc6:ppc64el (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 138s Setting up libc6:ppc64el (2.39-3.1ubuntu3) ... 139s Error: Could not restart systemd, systemd binary not working 139s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 72765 files and directories currently installed.) 139s Preparing to unpack .../libc-bin_2.39-3.1ubuntu3_ppc64el.deb ... 139s Unpacking libc-bin (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 139s Setting up libc-bin (2.39-3.1ubuntu3) ... 139s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 72765 files and directories currently installed.) 139s Preparing to unpack .../libssl3t64_3.2.2-1ubuntu1_ppc64el.deb ... 139s Unpacking libssl3t64:ppc64el (3.2.2-1ubuntu1) over (3.2.1-3ubuntu1) ... 139s Setting up libssl3t64:ppc64el (3.2.2-1ubuntu1) ... 139s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 72765 files and directories currently installed.) 139s Preparing to unpack .../00-openssh-sftp-server_1%3a9.6p1-3ubuntu17_ppc64el.deb ... 139s Unpacking openssh-sftp-server (1:9.6p1-3ubuntu17) over (1:9.6p1-3ubuntu15) ... 139s Preparing to unpack .../01-openssh-server_1%3a9.6p1-3ubuntu17_ppc64el.deb ... 139s Unpacking openssh-server (1:9.6p1-3ubuntu17) over (1:9.6p1-3ubuntu15) ... 139s Preparing to unpack .../02-openssh-client_1%3a9.6p1-3ubuntu17_ppc64el.deb ... 139s Unpacking openssh-client (1:9.6p1-3ubuntu17) over (1:9.6p1-3ubuntu15) ... 139s Preparing to unpack .../03-gir1.2-glib-2.0_2.80.4-1ubuntu1_ppc64el.deb ... 139s Unpacking gir1.2-glib-2.0:ppc64el (2.80.4-1ubuntu1) over (2.80.3-1ubuntu1) ... 139s Preparing to unpack .../04-libglib2.0-0t64_2.80.4-1ubuntu1_ppc64el.deb ... 139s Unpacking libglib2.0-0t64:ppc64el (2.80.4-1ubuntu1) over (2.80.3-1ubuntu1) ... 139s Preparing to unpack .../05-libglib2.0-data_2.80.4-1ubuntu1_all.deb ... 139s Unpacking libglib2.0-data (2.80.4-1ubuntu1) over (2.80.3-1ubuntu1) ... 139s Preparing to unpack .../06-locales_2.39-3.1ubuntu3_all.deb ... 139s Unpacking locales (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 139s Preparing to unpack .../07-openssl_3.2.2-1ubuntu1_ppc64el.deb ... 139s Unpacking openssl (3.2.2-1ubuntu1) over (3.2.1-3ubuntu1) ... 140s Preparing to unpack .../08-inetutils-telnet_2%3a2.5-5ubuntu1_ppc64el.deb ... 140s Unpacking inetutils-telnet (2:2.5-5ubuntu1) over (2:2.5-3ubuntu4) ... 140s Preparing to unpack .../09-libnghttp2-14_1.62.1-2_ppc64el.deb ... 140s Unpacking libnghttp2-14:ppc64el (1.62.1-2) over (1.62.1-1) ... 140s Preparing to unpack .../10-telnet_0.17+2.5-5ubuntu1_all.deb ... 140s Unpacking telnet (0.17+2.5-5ubuntu1) over (0.17+2.5-3ubuntu4) ... 140s Preparing to unpack .../11-libctf0_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking libctf0:ppc64el (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../12-libctf-nobfd0_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking libctf-nobfd0:ppc64el (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../13-binutils-powerpc64le-linux-gnu_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking binutils-powerpc64le-linux-gnu (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../14-libbinutils_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking libbinutils:ppc64el (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../15-binutils_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking binutils (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../16-binutils-common_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking binutils-common:ppc64el (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../17-libsframe1_2.42.50.20240710-1ubuntu1_ppc64el.deb ... 140s Unpacking libsframe1:ppc64el (2.42.50.20240710-1ubuntu1) over (2.42.50.20240625-1ubuntu1) ... 140s Preparing to unpack .../18-libnss3_2%3a3.102-1_ppc64el.deb ... 140s Unpacking libnss3:ppc64el (2:3.102-1) over (2:3.101-1) ... 140s Setting up openssh-client (1:9.6p1-3ubuntu17) ... 140s Setting up binutils-common:ppc64el (2.42.50.20240710-1ubuntu1) ... 140s Setting up libnghttp2-14:ppc64el (1.62.1-2) ... 140s Setting up inetutils-telnet (2:2.5-5ubuntu1) ... 140s Setting up libctf-nobfd0:ppc64el (2.42.50.20240710-1ubuntu1) ... 140s Setting up libnss3:ppc64el (2:3.102-1) ... 140s Setting up locales (2.39-3.1ubuntu3) ... 140s Generating locales (this might take a while)... 142s en_US.UTF-8... done 142s Generation complete. 142s Setting up libsframe1:ppc64el (2.42.50.20240710-1ubuntu1) ... 142s Setting up libglib2.0-0t64:ppc64el (2.80.4-1ubuntu1) ... 142s No schema files found: doing nothing. 142s Setting up libglib2.0-data (2.80.4-1ubuntu1) ... 142s Setting up gir1.2-glib-2.0:ppc64el (2.80.4-1ubuntu1) ... 142s Setting up libbinutils:ppc64el (2.42.50.20240710-1ubuntu1) ... 142s Setting up libc-dev-bin (2.39-3.1ubuntu3) ... 142s Setting up openssl (3.2.2-1ubuntu1) ... 142s Installing new version of config file /etc/ssl/openssl.cnf ... 142s Setting up libc-devtools (2.39-3.1ubuntu3) ... 142s Setting up libctf0:ppc64el (2.42.50.20240710-1ubuntu1) ... 142s Setting up openssh-sftp-server (1:9.6p1-3ubuntu17) ... 142s Setting up telnet (0.17+2.5-5ubuntu1) ... 142s Setting up openssh-server (1:9.6p1-3ubuntu17) ... 142s Installing new version of config file /etc/pam.d/sshd ... 143s Setting up libc6-dev:ppc64el (2.39-3.1ubuntu3) ... 143s Setting up binutils-powerpc64le-linux-gnu (2.42.50.20240710-1ubuntu1) ... 143s Setting up binutils (2.42.50.20240710-1ubuntu1) ... 143s Processing triggers for libc-bin (2.39-3.1ubuntu3) ... 143s Processing triggers for ufw (0.36.2-6) ... 143s Processing triggers for systemd (256-1ubuntu1) ... 144s Processing triggers for man-db (2.12.1-2) ... 145s Reading package lists... 145s Building dependency tree... 145s Reading state information... 145s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 146s Hit:1 http://ftpmaster.internal/ubuntu oracular-proposed InRelease 146s Hit:2 http://ftpmaster.internal/ubuntu oracular InRelease 146s Hit:3 http://ftpmaster.internal/ubuntu oracular-updates InRelease 146s Hit:4 http://ftpmaster.internal/ubuntu oracular-security InRelease 147s Reading package lists... 147s Reading package lists... 148s Building dependency tree... 148s Reading state information... 148s Calculating upgrade... 148s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 148s Reading package lists... 148s Building dependency tree... 148s Reading state information... 148s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 149s autopkgtest [20:39:07]: rebooting testbed after setup commands that affected boot 183s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 202s autopkgtest [20:40:00]: testbed running kernel: Linux 6.8.0-31-generic #31-Ubuntu SMP Sat Apr 20 00:05:55 UTC 2024 216s autopkgtest [20:40:14]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 221s Get:1 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (dsc) [2309 B] 221s Get:2 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (tar) [4319 kB] 221s Get:3 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (diff) [7568 B] 221s gpgv: Signature made Mon Apr 1 04:43:53 2024 UTC 221s gpgv: using RSA key A089FB36AAFBDAD5ACC1325069F790171A210984 221s gpgv: Can't check signature: No public key 221s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-5build1.dsc: no acceptable signature found 221s autopkgtest [20:40:19]: testing package libedlib version 1.2.7-5build1 225s autopkgtest [20:40:23]: build not needed 226s autopkgtest [20:40:24]: test run-unit-test: preparing testbed 227s Reading package lists... 228s Building dependency tree... 228s Reading state information... 228s Starting pkgProblemResolver with broken count: 0 228s Starting 2 pkgProblemResolver with broken count: 0 228s Done 228s The following additional packages will be installed: 228s edlib-aligner libedlib-dev libedlib1 python3-edlib 228s The following NEW packages will be installed: 228s autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib 228s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 228s Need to get 153 kB/154 kB of archives. 228s After this operation, 481 kB of additional disk space will be used. 228s Get:1 /tmp/autopkgtest.NIgB9S/1-autopkgtest-satdep.deb autopkgtest-satdep ppc64el 0 [732 B] 228s Get:2 http://ftpmaster.internal/ubuntu oracular/universe ppc64el libedlib1 ppc64el 1.2.7-5build1 [22.7 kB] 228s Get:3 http://ftpmaster.internal/ubuntu oracular/universe ppc64el edlib-aligner ppc64el 1.2.7-5build1 [29.7 kB] 228s Get:4 http://ftpmaster.internal/ubuntu oracular/universe ppc64el libedlib-dev ppc64el 1.2.7-5build1 [26.5 kB] 228s Get:5 http://ftpmaster.internal/ubuntu oracular/universe ppc64el python3-edlib ppc64el 1.2.7-5build1 [74.1 kB] 229s Fetched 153 kB in 0s (324 kB/s) 229s Selecting previously unselected package libedlib1:ppc64el. 229s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 72764 files and directories currently installed.) 229s Preparing to unpack .../libedlib1_1.2.7-5build1_ppc64el.deb ... 229s Unpacking libedlib1:ppc64el (1.2.7-5build1) ... 229s Selecting previously unselected package edlib-aligner. 229s Preparing to unpack .../edlib-aligner_1.2.7-5build1_ppc64el.deb ... 229s Unpacking edlib-aligner (1.2.7-5build1) ... 229s Selecting previously unselected package libedlib-dev:ppc64el. 229s Preparing to unpack .../libedlib-dev_1.2.7-5build1_ppc64el.deb ... 229s Unpacking libedlib-dev:ppc64el (1.2.7-5build1) ... 229s Selecting previously unselected package python3-edlib:ppc64el. 229s Preparing to unpack .../python3-edlib_1.2.7-5build1_ppc64el.deb ... 229s Unpacking python3-edlib:ppc64el (1.2.7-5build1) ... 229s Selecting previously unselected package autopkgtest-satdep. 229s Preparing to unpack .../1-autopkgtest-satdep.deb ... 229s Unpacking autopkgtest-satdep (0) ... 229s Setting up libedlib1:ppc64el (1.2.7-5build1) ... 229s Setting up python3-edlib:ppc64el (1.2.7-5build1) ... 229s Setting up edlib-aligner (1.2.7-5build1) ... 229s Setting up libedlib-dev:ppc64el (1.2.7-5build1) ... 229s Setting up autopkgtest-satdep (0) ... 229s Processing triggers for man-db (2.12.1-2) ... 229s Processing triggers for libc-bin (2.39-3.1ubuntu3) ... 232s (Reading database ... 72800 files and directories currently installed.) 232s Removing autopkgtest-satdep (0) ... 233s autopkgtest [20:40:31]: test run-unit-test: [----------------------- 234s Using NW alignment mode. 234s Reading queries... 234s Read 1 queries, 110 residues total. 234s Reading target fasta file... 234s Read target, 109 residues. 234s 234s Comparing queries to target... 234s 234s Query #0 (110 residues): score = 17 234s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 234s ||||||| | |||||||||| ||||||||||||||||||||||||||| 234s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 234s 234s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 234s | |||||||||||| || |||||||||| ||||||||| |||||| | 234s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 234s 234s T: AESIKSKKKKKE-STTB (93 - 108) 234s ||||||||||| ||| 234s Q: -ESIKSKKKKKENSTT- (94 - 109) 234s 234s 234s Cpu time of searching: 0.000047 234s autopkgtest [20:40:32]: test run-unit-test: -----------------------] 235s run-unit-test PASS 235s autopkgtest [20:40:33]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 235s autopkgtest [20:40:33]: @@@@@@@@@@@@@@@@@@@@ summary 235s run-unit-test PASS 249s nova [W] Using flock in scalingstack-bos01-ppc64el 249s Creating nova instance adt-oracular-ppc64el-libedlib-20240712-203637-juju-7f2275-prod-proposed-migration-environment-3-b897144e-1629-42df-a853-536ac9f231d3 from image adt/ubuntu-oracular-ppc64el-server-20240711.img (UUID 1684f527-7688-45d2-8425-82b1ad2da4ea)...