0s autopkgtest [20:39:35]: starting date and time: 2024-07-12 20:39:35+0000 0s autopkgtest [20:39:35]: git checkout: fd3bed09 nova: allow more retries for quota issues 0s autopkgtest [20:39:35]: host juju-7f2275-prod-proposed-migration-environment-9; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.d7qh7829/out --timeout-copy=6000 --setup-commands 'ln -s /dev/null /etc/systemd/system/bluetooth.service; printf "http_proxy=http://squid.internal:3128\nhttps_proxy=http://squid.internal:3128\nno_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,keyserver.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com\n" >> /etc/environment' --apt-pocket=proposed=src:glibc --apt-upgrade libedlib --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=glibc/2.39-3.1ubuntu3 -- lxd -r lxd-armhf-10.145.243.27 lxd-armhf-10.145.243.27:autopkgtest/ubuntu/oracular/armhf 56s autopkgtest [20:40:30]: testbed dpkg architecture: armhf 57s autopkgtest [20:40:32]: testbed apt version: 2.9.6 58s autopkgtest [20:40:32]: @@@@@@@@@@@@@@@@@@@@ test bed setup 66s Get:1 http://ftpmaster.internal/ubuntu oracular-proposed InRelease [126 kB] 66s Get:2 http://ftpmaster.internal/ubuntu oracular-proposed/main Sources [46.5 kB] 66s Get:3 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse Sources [3288 B] 66s Get:4 http://ftpmaster.internal/ubuntu oracular-proposed/restricted Sources [8548 B] 66s Get:5 http://ftpmaster.internal/ubuntu oracular-proposed/universe Sources [367 kB] 66s Get:6 http://ftpmaster.internal/ubuntu oracular-proposed/main armhf Packages [57.7 kB] 66s Get:7 http://ftpmaster.internal/ubuntu oracular-proposed/main armhf c-n-f Metadata [1440 B] 66s Get:8 http://ftpmaster.internal/ubuntu oracular-proposed/restricted armhf Packages [1368 B] 66s Get:9 http://ftpmaster.internal/ubuntu oracular-proposed/restricted armhf c-n-f Metadata [120 B] 66s Get:10 http://ftpmaster.internal/ubuntu oracular-proposed/universe armhf Packages [314 kB] 66s Get:11 http://ftpmaster.internal/ubuntu oracular-proposed/universe armhf c-n-f Metadata [6416 B] 66s Get:12 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse armhf Packages [1796 B] 66s Get:13 http://ftpmaster.internal/ubuntu oracular-proposed/multiverse armhf c-n-f Metadata [120 B] 68s Fetched 934 kB in 1s (1072 kB/s) 68s Reading package lists... 87s tee: /proc/self/fd/2: Permission denied 110s Hit:1 http://ftpmaster.internal/ubuntu oracular-proposed InRelease 110s Hit:2 http://ftpmaster.internal/ubuntu oracular InRelease 110s Hit:3 http://ftpmaster.internal/ubuntu oracular-updates InRelease 110s Hit:4 http://ftpmaster.internal/ubuntu oracular-security InRelease 111s Reading package lists... 111s Reading package lists... 112s Building dependency tree... 112s Reading state information... 113s Calculating upgrade... 113s The following packages will be upgraded: 113s inetutils-telnet libc-bin libc6 libssl3t64 locales openssh-client 113s openssh-server openssh-sftp-server openssl telnet 113s 10 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 113s Need to get 11.9 MB of archives. 113s After this operation, 285 kB of additional disk space will be used. 113s Get:1 http://ftpmaster.internal/ubuntu oracular-proposed/main armhf libc6 armhf 2.39-3.1ubuntu3 [2825 kB] 114s Get:2 http://ftpmaster.internal/ubuntu oracular-proposed/main armhf libc-bin armhf 2.39-3.1ubuntu3 [527 kB] 114s Get:3 http://ftpmaster.internal/ubuntu oracular/main armhf libssl3t64 armhf 3.2.2-1ubuntu1 [1729 kB] 114s Get:4 http://ftpmaster.internal/ubuntu oracular/main armhf openssh-sftp-server armhf 1:9.6p1-3ubuntu17 [35.6 kB] 114s Get:5 http://ftpmaster.internal/ubuntu oracular/main armhf openssh-server armhf 1:9.6p1-3ubuntu17 [502 kB] 114s Get:6 http://ftpmaster.internal/ubuntu oracular/main armhf openssh-client armhf 1:9.6p1-3ubuntu17 [888 kB] 114s Get:7 http://ftpmaster.internal/ubuntu oracular-proposed/main armhf locales all 2.39-3.1ubuntu3 [4220 kB] 114s Get:8 http://ftpmaster.internal/ubuntu oracular/main armhf openssl armhf 3.2.2-1ubuntu1 [1095 kB] 114s Get:9 http://ftpmaster.internal/ubuntu oracular/main armhf inetutils-telnet armhf 2:2.5-5ubuntu1 [94.4 kB] 114s Get:10 http://ftpmaster.internal/ubuntu oracular/main armhf telnet all 0.17+2.5-5ubuntu1 [3688 B] 115s Preconfiguring packages ... 115s Fetched 11.9 MB in 1s (12.8 MB/s) 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58437 files and directories currently installed.) 115s Preparing to unpack .../libc6_2.39-3.1ubuntu3_armhf.deb ... 115s Unpacking libc6:armhf (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 115s Setting up libc6:armhf (2.39-3.1ubuntu3) ... 116s Error: Could not restart systemd, systemd binary not working 116s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58437 files and directories currently installed.) 116s Preparing to unpack .../libc-bin_2.39-3.1ubuntu3_armhf.deb ... 116s Unpacking libc-bin (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 116s Setting up libc-bin (2.39-3.1ubuntu3) ... 116s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58437 files and directories currently installed.) 116s Preparing to unpack .../libssl3t64_3.2.2-1ubuntu1_armhf.deb ... 116s Unpacking libssl3t64:armhf (3.2.2-1ubuntu1) over (3.2.1-3ubuntu1) ... 116s Setting up libssl3t64:armhf (3.2.2-1ubuntu1) ... 116s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58437 files and directories currently installed.) 116s Preparing to unpack .../0-openssh-sftp-server_1%3a9.6p1-3ubuntu17_armhf.deb ... 116s Unpacking openssh-sftp-server (1:9.6p1-3ubuntu17) over (1:9.6p1-3ubuntu15) ... 116s Preparing to unpack .../1-openssh-server_1%3a9.6p1-3ubuntu17_armhf.deb ... 116s Unpacking openssh-server (1:9.6p1-3ubuntu17) over (1:9.6p1-3ubuntu15) ... 116s Preparing to unpack .../2-openssh-client_1%3a9.6p1-3ubuntu17_armhf.deb ... 116s Unpacking openssh-client (1:9.6p1-3ubuntu17) over (1:9.6p1-3ubuntu15) ... 116s Preparing to unpack .../3-locales_2.39-3.1ubuntu3_all.deb ... 116s Unpacking locales (2.39-3.1ubuntu3) over (2.39-0ubuntu9) ... 117s Preparing to unpack .../4-openssl_3.2.2-1ubuntu1_armhf.deb ... 117s Unpacking openssl (3.2.2-1ubuntu1) over (3.2.1-3ubuntu1) ... 117s Preparing to unpack .../5-inetutils-telnet_2%3a2.5-5ubuntu1_armhf.deb ... 117s Unpacking inetutils-telnet (2:2.5-5ubuntu1) over (2:2.5-3ubuntu4) ... 117s Preparing to unpack .../6-telnet_0.17+2.5-5ubuntu1_all.deb ... 117s Unpacking telnet (0.17+2.5-5ubuntu1) over (0.17+2.5-3ubuntu4) ... 117s Setting up openssh-client (1:9.6p1-3ubuntu17) ... 117s Setting up inetutils-telnet (2:2.5-5ubuntu1) ... 117s Setting up locales (2.39-3.1ubuntu3) ... 118s Generating locales (this might take a while)... 121s en_US.UTF-8... done 121s Generation complete. 121s Setting up openssl (3.2.2-1ubuntu1) ... 121s Installing new version of config file /etc/ssl/openssl.cnf ... 121s Setting up openssh-sftp-server (1:9.6p1-3ubuntu17) ... 121s Setting up telnet (0.17+2.5-5ubuntu1) ... 121s Setting up openssh-server (1:9.6p1-3ubuntu17) ... 121s Installing new version of config file /etc/pam.d/sshd ... 122s Processing triggers for ufw (0.36.2-6) ... 122s Processing triggers for systemd (256-1ubuntu1) ... 123s Processing triggers for man-db (2.12.1-2) ... 124s Processing triggers for libc-bin (2.39-3.1ubuntu3) ... 125s Reading package lists... 125s Building dependency tree... 125s Reading state information... 126s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 128s autopkgtest [20:41:43]: rebooting testbed after setup commands that affected boot 200s autopkgtest [20:42:55]: testbed running kernel: Linux 6.5.0-41-generic #41~22.04.2-Ubuntu SMP PREEMPT_DYNAMIC Mon Jun 3 16:28:24 UTC 2 228s autopkgtest [20:43:23]: @@@@@@@@@@@@@@@@@@@@ apt-source libedlib 251s Get:1 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (dsc) [2309 B] 251s Get:2 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (tar) [4319 kB] 251s Get:3 http://ftpmaster.internal/ubuntu oracular/universe libedlib 1.2.7-5build1 (diff) [7568 B] 251s gpgv: Signature made Mon Apr 1 04:43:53 2024 UTC 251s gpgv: using RSA key A089FB36AAFBDAD5ACC1325069F790171A210984 251s gpgv: Can't check signature: No public key 251s dpkg-source: warning: cannot verify inline signature for ./libedlib_1.2.7-5build1.dsc: no acceptable signature found 251s autopkgtest [20:43:46]: testing package libedlib version 1.2.7-5build1 253s autopkgtest [20:43:48]: build not needed 256s autopkgtest [20:43:51]: test run-unit-test: preparing testbed 266s Reading package lists... 267s Building dependency tree... 267s Reading state information... 267s Starting pkgProblemResolver with broken count: 0 267s Starting 2 pkgProblemResolver with broken count: 0 267s Done 268s The following additional packages will be installed: 268s edlib-aligner libedlib-dev libedlib1 python3-edlib 268s The following NEW packages will be installed: 268s autopkgtest-satdep edlib-aligner libedlib-dev libedlib1 python3-edlib 269s 0 upgraded, 5 newly installed, 0 to remove and 0 not upgraded. 269s Need to get 116 kB/117 kB of archives. 269s After this operation, 270 kB of additional disk space will be used. 269s Get:1 /tmp/autopkgtest.pSFqeB/1-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [728 B] 269s Get:2 http://ftpmaster.internal/ubuntu oracular/universe armhf libedlib1 armhf 1.2.7-5build1 [15.5 kB] 269s Get:3 http://ftpmaster.internal/ubuntu oracular/universe armhf edlib-aligner armhf 1.2.7-5build1 [20.5 kB] 269s Get:4 http://ftpmaster.internal/ubuntu oracular/universe armhf libedlib-dev armhf 1.2.7-5build1 [19.8 kB] 269s Get:5 http://ftpmaster.internal/ubuntu oracular/universe armhf python3-edlib armhf 1.2.7-5build1 [60.3 kB] 269s Fetched 116 kB in 0s (256 kB/s) 270s Selecting previously unselected package libedlib1:armhf. 270s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58436 files and directories currently installed.) 270s Preparing to unpack .../libedlib1_1.2.7-5build1_armhf.deb ... 270s Unpacking libedlib1:armhf (1.2.7-5build1) ... 270s Selecting previously unselected package edlib-aligner. 270s Preparing to unpack .../edlib-aligner_1.2.7-5build1_armhf.deb ... 270s Unpacking edlib-aligner (1.2.7-5build1) ... 270s Selecting previously unselected package libedlib-dev:armhf. 270s Preparing to unpack .../libedlib-dev_1.2.7-5build1_armhf.deb ... 270s Unpacking libedlib-dev:armhf (1.2.7-5build1) ... 270s Selecting previously unselected package python3-edlib:armhf. 270s Preparing to unpack .../python3-edlib_1.2.7-5build1_armhf.deb ... 270s Unpacking python3-edlib:armhf (1.2.7-5build1) ... 270s Selecting previously unselected package autopkgtest-satdep. 270s Preparing to unpack .../1-autopkgtest-satdep.deb ... 270s Unpacking autopkgtest-satdep (0) ... 270s Setting up libedlib1:armhf (1.2.7-5build1) ... 270s Setting up python3-edlib:armhf (1.2.7-5build1) ... 270s Setting up edlib-aligner (1.2.7-5build1) ... 270s Setting up libedlib-dev:armhf (1.2.7-5build1) ... 270s Setting up autopkgtest-satdep (0) ... 270s Processing triggers for man-db (2.12.1-2) ... 270s Processing triggers for libc-bin (2.39-3.1ubuntu3) ... 288s (Reading database ... 58473 files and directories currently installed.) 288s Removing autopkgtest-satdep (0) ... 294s autopkgtest [20:44:29]: test run-unit-test: [----------------------- 296s Using NW alignment mode. 296s Reading queries... 296s Read 1 queries, 110 residues total. 296s Reading target fasta file... 296s Read target, 109 residues. 296s 296s Comparing queries to target... 296s 296s Query #0 (110 residues): score = 17 296s T: MMEEERFAASADEIFHVTQEVC-RTASELTESESRNVIVDELFCVGVTEM (0 - 48) 296s ||||||| | |||||||||| ||||||||||||||||||||||||||| 296s Q: MMEEERFKA---EIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEM (0 - 46) 296s 296s T: VAEQIRVLAKDIEA---HA-RKTVQPQDVLDDLCCRRNEGL-EIINNF-K (49 - 92) 296s | |||||||||||| || |||||||||| ||||||||| |||||| | 296s Q: VWEQIRVLAKDIEAFAEHAGRKTVQPQDVL--LCCRRNEGLYEIINNFHK (47 - 94) 296s 296s T: AESIKSKKKKKE-STTB (93 - 108) 296s ||||||||||| ||| 296s Q: -ESIKSKKKKKENSTT- (94 - 109) 296s 296s 296s Cpu time of searching: 0.000073 296s autopkgtest [20:44:31]: test run-unit-test: -----------------------] 300s autopkgtest [20:44:35]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 300s run-unit-test PASS 304s autopkgtest [20:44:39]: @@@@@@@@@@@@@@@@@@@@ summary 304s run-unit-test PASS