0s autopkgtest [13:47:59]: starting date and time: 2024-03-27 13:47:59+0000 0s autopkgtest [13:47:59]: git checkout: 4a1cd702 l/adt_testbed: don't blame the testbed for unsolvable build deps 0s autopkgtest [13:47:59]: host juju-7f2275-prod-proposed-migration-environment-3; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.7uij9q5o/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed --apt-upgrade glam2 --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 --env=ADT_TEST_TRIGGERS=fftw3/3.3.10-1ubuntu2 -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-3@bos02-s390x-16.secgroup --name adt-noble-s390x-glam2-20240327-134759-juju-7f2275-prod-proposed-migration-environment-3-07761b5a-f0e0-4499-a3df-172d60ac89a7 --image adt/ubuntu-noble-s390x-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-3 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 119s autopkgtest [13:49:58]: testbed dpkg architecture: s390x 119s autopkgtest [13:49:58]: testbed apt version: 2.7.12 119s autopkgtest [13:49:58]: @@@@@@@@@@@@@@@@@@@@ test bed setup 120s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 121s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [56.5 kB] 121s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [8504 B] 121s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [493 kB] 121s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [3998 kB] 122s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main s390x Packages [685 kB] 123s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main s390x c-n-f Metadata [3032 B] 123s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted s390x Packages [1372 B] 123s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted s390x c-n-f Metadata [116 B] 123s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x Packages [4116 kB] 123s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x c-n-f Metadata [7292 B] 123s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse s390x Packages [48.3 kB] 123s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse s390x c-n-f Metadata [116 B] 125s Fetched 9534 kB in 4s (2313 kB/s) 125s Reading package lists... 127s Reading package lists... 127s Building dependency tree... 127s Reading state information... 127s Calculating upgrade... 127s The following packages will be upgraded: 127s binutils binutils-common binutils-s390x-linux-gnu libbinutils libctf-nobfd0 127s libctf0 libexpat1 libsframe1 127s 8 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 127s Need to get 3274 kB of archives. 127s After this operation, 2048 B disk space will be freed. 127s Get:1 http://ftpmaster.internal/ubuntu noble/main s390x libexpat1 s390x 2.6.1-2 [94.8 kB] 128s Get:2 http://ftpmaster.internal/ubuntu noble/main s390x libctf0 s390x 2.42-4ubuntu1 [98.4 kB] 128s Get:3 http://ftpmaster.internal/ubuntu noble/main s390x libctf-nobfd0 s390x 2.42-4ubuntu1 [100 kB] 128s Get:4 http://ftpmaster.internal/ubuntu noble/main s390x binutils-s390x-linux-gnu s390x 2.42-4ubuntu1 [2270 kB] 129s Get:5 http://ftpmaster.internal/ubuntu noble/main s390x libbinutils s390x 2.42-4ubuntu1 [477 kB] 129s Get:6 http://ftpmaster.internal/ubuntu noble/main s390x binutils s390x 2.42-4ubuntu1 [3056 B] 129s Get:7 http://ftpmaster.internal/ubuntu noble/main s390x binutils-common s390x 2.42-4ubuntu1 [217 kB] 129s Get:8 http://ftpmaster.internal/ubuntu noble/main s390x libsframe1 s390x 2.42-4ubuntu1 [14.2 kB] 130s Fetched 3274 kB in 2s (1627 kB/s) 130s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 130s Preparing to unpack .../0-libexpat1_2.6.1-2_s390x.deb ... 130s Unpacking libexpat1:s390x (2.6.1-2) over (2.6.0-1) ... 130s Preparing to unpack .../1-libctf0_2.42-4ubuntu1_s390x.deb ... 130s Unpacking libctf0:s390x (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Preparing to unpack .../2-libctf-nobfd0_2.42-4ubuntu1_s390x.deb ... 130s Unpacking libctf-nobfd0:s390x (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Preparing to unpack .../3-binutils-s390x-linux-gnu_2.42-4ubuntu1_s390x.deb ... 130s Unpacking binutils-s390x-linux-gnu (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Preparing to unpack .../4-libbinutils_2.42-4ubuntu1_s390x.deb ... 130s Unpacking libbinutils:s390x (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Preparing to unpack .../5-binutils_2.42-4ubuntu1_s390x.deb ... 130s Unpacking binutils (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Preparing to unpack .../6-binutils-common_2.42-4ubuntu1_s390x.deb ... 130s Unpacking binutils-common:s390x (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Preparing to unpack .../7-libsframe1_2.42-4ubuntu1_s390x.deb ... 130s Unpacking libsframe1:s390x (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 130s Setting up libexpat1:s390x (2.6.1-2) ... 130s Setting up binutils-common:s390x (2.42-4ubuntu1) ... 130s Setting up libctf-nobfd0:s390x (2.42-4ubuntu1) ... 130s Setting up libsframe1:s390x (2.42-4ubuntu1) ... 130s Setting up libbinutils:s390x (2.42-4ubuntu1) ... 130s Setting up libctf0:s390x (2.42-4ubuntu1) ... 130s Setting up binutils-s390x-linux-gnu (2.42-4ubuntu1) ... 130s Setting up binutils (2.42-4ubuntu1) ... 130s Processing triggers for libc-bin (2.39-0ubuntu6) ... 130s Processing triggers for man-db (2.12.0-3) ... 130s Reading package lists... 131s Building dependency tree... 131s Reading state information... 131s 0 upgraded, 0 newly installed, 0 to remove and 236 not upgraded. 131s Hit:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease 131s Hit:2 http://ftpmaster.internal/ubuntu noble InRelease 131s Hit:3 http://ftpmaster.internal/ubuntu noble-updates InRelease 131s Hit:4 http://ftpmaster.internal/ubuntu noble-security InRelease 133s Reading package lists... 133s Reading package lists... 133s Building dependency tree... 133s Reading state information... 133s Calculating upgrade... 133s The following packages were automatically installed and are no longer required: 133s libaio1 libnetplan0 python3-distutils python3-lib2to3 133s Use 'sudo apt autoremove' to remove them. 133s The following packages will be REMOVED: 133s libapt-pkg6.0 libarchive13 libatm1 libcurl3-gnutls libcurl4 libdb5.3 libelf1 133s libext2fs2 libgdbm-compat4 libgdbm6 libglib2.0-0 libgnutls30 libgpgme11 133s libhogweed6 libmagic1 libnettle8 libnpth0 libnvme1 libparted2 libperl5.38 133s libpng16-16 libpsl5 libreadline8 libreiserfscore0 libssl3 libtirpc3 liburcu8 133s libuv1 133s The following NEW packages will be installed: 133s bpfcc-tools bpftrace fontconfig-config fonts-dejavu-core fonts-dejavu-mono 133s hwdata ieee-data libaio1t64 libapt-pkg6.0t64 libarchive13t64 libatm1t64 133s libbpfcc libc-dev-bin libc-devtools libc6-dev libclang-cpp18 libclang1-18 133s libcrypt-dev libcurl3t64-gnutls libcurl4t64 libdb5.3t64 libdeflate0 133s libdw1t64 libelf1t64 libext2fs2t64 libfontconfig1 libfreetype6 libgd3 133s libgdbm-compat4t64 libgdbm6t64 libglib2.0-0t64 libgnutls30t64 libgpgme11t64 133s libhogweed6t64 libjbig0 libjpeg-turbo8 libjpeg8 libllvm18 libmagic1t64 133s libnetplan1 libnettle8t64 libnpth0t64 libnvme1t64 libparted2t64 133s libperl5.38t64 libpng16-16t64 libpsl5t64 libreadline8t64 libreiserfscore0t64 133s libsharpyuv0 libssl3t64 libtiff6 libtirpc3t64 liburcu8t64 libuv1t64 libwebp7 133s libxpm4 linux-headers-6.8.0-20 linux-headers-6.8.0-20-generic 133s linux-image-6.8.0-20-generic linux-libc-dev linux-modules-6.8.0-20-generic 133s linux-modules-extra-6.8.0-20-generic linux-tools-6.8.0-20 133s linux-tools-6.8.0-20-generic linux-tools-common manpages manpages-dev 133s python3-bpfcc python3-netaddr rpcsvc-proto ubuntu-kernel-accessories 133s xdg-user-dirs 133s The following packages have been kept back: 133s s390-tools 133s The following packages will be upgraded: 133s apparmor apt apt-utils base-files bash bind9-dnsutils bind9-host bind9-libs 133s bolt bsdextrautils bsdutils btrfs-progs coreutils cryptsetup-bin curl dbus 133s dbus-bin dbus-daemon dbus-session-bus-common dbus-system-bus-common 133s dbus-user-session dhcpcd-base dirmngr dmsetup dpkg dpkg-dev e2fsprogs 133s e2fsprogs-l10n eject fdisk file ftp fwupd gawk gcc-13-base gcc-14-base 133s gir1.2-girepository-2.0 gir1.2-glib-2.0 gnupg gnupg-l10n gnupg-utils gpg 133s gpg-agent gpg-wks-client gpgconf gpgsm gpgv groff-base ibverbs-providers 133s inetutils-telnet info initramfs-tools initramfs-tools-bin 133s initramfs-tools-core install-info iproute2 jq keyboxd kmod kpartx 133s krb5-locales libapparmor1 libaudit-common libaudit1 libblkid1 133s libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 libblockdev-mdraid3 133s libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 libblockdev-utils3 133s libblockdev3 libbpf1 libbrotli1 libcap-ng0 libcom-err2 libcryptsetup12 133s libdbus-1-3 libdebconfclient0 libdevmapper1.02.1 libdpkg-perl 133s libevent-core-2.1-7 libfdisk1 libfido2-1 libftdi1-2 libfwupd2 libgcc-s1 133s libgirepository-1.0-1 libglib2.0-data libgssapi-krb5-2 libgudev-1.0-0 133s libgusb2 libibverbs1 libjcat1 libjq1 libjson-glib-1.0-0 133s libjson-glib-1.0-common libk5crypto3 libkmod2 libkrb5-3 libkrb5support0 133s libldap-common libldap2 liblocale-gettext-perl liblzma5 libmagic-mgc 133s libmbim-glib4 libmbim-proxy libmm-glib0 libmount1 libnghttp2-14 libnsl2 133s libnss-systemd libpam-modules libpam-modules-bin libpam-runtime 133s libpam-systemd libpam0g libplymouth5 libpolkit-agent-1-0 133s libpolkit-gobject-1-0 libproc2-0 libprotobuf-c1 libpython3-stdlib 133s libpython3.11-minimal libpython3.11-stdlib libpython3.12-minimal 133s libpython3.12-stdlib libqmi-glib5 libqmi-proxy libqrtr-glib0 librtmp1 133s libsasl2-2 libsasl2-modules libsasl2-modules-db libseccomp2 libselinux1 133s libsemanage-common libsemanage2 libslang2 libsmartcols1 libsqlite3-0 libss2 133s libssh-4 libstdc++6 libsystemd-shared libsystemd0 libtext-charwidth-perl 133s libtext-iconv-perl libtirpc-common libudev1 libudisks2-0 libusb-1.0-0 133s libuuid1 libvolume-key1 libxml2 libxmlb2 libxmuu1 linux-generic 133s linux-headers-generic linux-headers-virtual linux-image-generic 133s linux-image-virtual linux-virtual logsave lshw lsof man-db motd-news-config 133s mount mtr-tiny multipath-tools netplan-generator netplan.io openssh-client 133s openssh-server openssh-sftp-server openssl parted perl perl-base 133s perl-modules-5.38 pinentry-curses plymouth plymouth-theme-ubuntu-text procps 133s python-apt-common python3 python3-apt python3-cryptography python3-dbus 133s python3-distutils python3-gdbm python3-gi python3-lib2to3 python3-minimal 133s python3-netplan python3-pkg-resources python3-pyrsistent python3-setuptools 133s python3-typing-extensions python3-yaml python3.11 python3.11-minimal 133s python3.12 python3.12-minimal readline-common rsync rsyslog s390-tools-data 133s shared-mime-info sudo systemd systemd-dev systemd-resolved systemd-sysv 133s systemd-timesyncd tcpdump telnet tnftp ubuntu-pro-client 133s ubuntu-pro-client-l10n udev udisks2 usb.ids util-linux uuid-runtime 133s vim-common vim-tiny wget xxd xz-utils zlib1g 134s 235 upgraded, 73 newly installed, 28 to remove and 1 not upgraded. 134s Need to get 225 MB of archives. 134s After this operation, 524 MB of additional disk space will be used. 134s Get:1 http://ftpmaster.internal/ubuntu noble-proposed/main s390x motd-news-config all 13ubuntu8 [5098 B] 134s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main s390x base-files s390x 13ubuntu8 [74.2 kB] 134s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bash s390x 5.2.21-2ubuntu3 [845 kB] 134s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bsdutils s390x 1:2.39.3-9ubuntu2 [96.1 kB] 134s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libbrotli1 s390x 1.1.0-2build1 [375 kB] 135s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgssapi-krb5-2 s390x 1.20.1-6ubuntu1 [149 kB] 135s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libkrb5-3 s390x 1.20.1-6ubuntu1 [360 kB] 135s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libkrb5support0 s390x 1.20.1-6ubuntu1 [34.6 kB] 135s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libk5crypto3 s390x 1.20.1-6ubuntu1 [90.3 kB] 135s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libcom-err2 s390x 1.47.0-2.4~exp1ubuntu2 [22.9 kB] 135s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/main s390x zlib1g s390x 1:1.3.dfsg-3.1ubuntu1 [75.7 kB] 135s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/main s390x librtmp1 s390x 2.4+20151223.gitfa8646d.1-2build6 [58.4 kB] 135s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/main s390x udisks2 s390x 2.10.1-6 [298 kB] 135s Get:14 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libudisks2-0 s390x 2.10.1-6 [179 kB] 135s Get:15 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblkid1 s390x 2.39.3-9ubuntu2 [128 kB] 135s Get:16 http://ftpmaster.internal/ubuntu noble-proposed/main s390x liblzma5 s390x 5.6.0-0.2 [137 kB] 135s Get:17 http://ftpmaster.internal/ubuntu noble-proposed/main s390x kmod s390x 31+20240202-2ubuntu4 [107 kB] 135s Get:18 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libkmod2 s390x 31+20240202-2ubuntu4 [56.3 kB] 135s Get:19 http://ftpmaster.internal/ubuntu noble-proposed/main s390x systemd-dev all 255.4-1ubuntu5 [103 kB] 135s Get:20 http://ftpmaster.internal/ubuntu noble-proposed/main s390x systemd-timesyncd s390x 255.4-1ubuntu5 [35.3 kB] 135s Get:21 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dbus-session-bus-common all 1.14.10-4ubuntu2 [80.3 kB] 135s Get:22 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libaudit-common all 1:3.1.2-2.1 [5674 B] 135s Get:23 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libcap-ng0 s390x 0.8.4-2build1 [15.7 kB] 135s Get:24 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libaudit1 s390x 1:3.1.2-2.1 [48.9 kB] 135s Get:25 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpam0g s390x 1.5.3-5ubuntu3 [69.8 kB] 135s Get:26 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libselinux1 s390x 3.5-2ubuntu1 [84.7 kB] 135s Get:27 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libcurl4t64 s390x 8.5.0-2ubuntu8 [363 kB] 135s Get:28 http://ftpmaster.internal/ubuntu noble-proposed/main s390x curl s390x 8.5.0-2ubuntu8 [227 kB] 136s Get:29 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpsl5t64 s390x 0.21.2-1.1 [57.6 kB] 136s Get:30 http://ftpmaster.internal/ubuntu noble-proposed/main s390x wget s390x 1.21.4-1ubuntu2 [351 kB] 136s Get:31 http://ftpmaster.internal/ubuntu noble-proposed/main s390x tnftp s390x 20230507-2build1 [107 kB] 136s Get:32 http://ftpmaster.internal/ubuntu noble-proposed/main s390x tcpdump s390x 4.99.4-3ubuntu2 [490 kB] 136s Get:33 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsystemd-shared s390x 255.4-1ubuntu5 [2131 kB] 136s Get:34 http://ftpmaster.internal/ubuntu noble-proposed/main s390x systemd-resolved s390x 255.4-1ubuntu5 [304 kB] 136s Get:35 http://ftpmaster.internal/ubuntu noble-proposed/main s390x sudo s390x 1.9.15p5-3ubuntu3 [968 kB] 136s Get:36 http://ftpmaster.internal/ubuntu noble-proposed/main s390x rsync s390x 3.2.7-1build1 [446 kB] 136s Get:37 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-cryptography s390x 41.0.7-4build2 [918 kB] 137s Get:38 http://ftpmaster.internal/ubuntu noble-proposed/main s390x openssl s390x 3.0.13-0ubuntu2 [1010 kB] 137s Get:39 http://ftpmaster.internal/ubuntu noble-proposed/main s390x openssh-sftp-server s390x 1:9.6p1-3ubuntu11 [39.0 kB] 137s Get:40 http://ftpmaster.internal/ubuntu noble-proposed/main s390x openssh-client s390x 1:9.6p1-3ubuntu11 [935 kB] 137s Get:41 http://ftpmaster.internal/ubuntu noble-proposed/main s390x openssh-server s390x 1:9.6p1-3ubuntu11 [529 kB] 137s Get:42 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libssh-4 s390x 0.10.6-2build1 [189 kB] 137s Get:43 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsasl2-modules s390x 2.1.28+dfsg1-5ubuntu1 [76.6 kB] 137s Get:44 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3.12 s390x 3.12.2-4build3 [645 kB] 137s Get:45 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3.12-minimal s390x 3.12.2-4build3 [2419 kB] 137s Get:46 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpython3.12-minimal s390x 3.12.2-4build3 [829 kB] 137s Get:47 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libparted2t64 s390x 3.6-3.1build2 [172 kB] 137s Get:48 http://ftpmaster.internal/ubuntu noble-proposed/main s390x parted s390x 3.6-3.1build2 [44.6 kB] 137s Get:49 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3.11 s390x 3.11.8-1build4 [589 kB] 137s Get:50 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3.11-minimal s390x 3.11.8-1build4 [2280 kB] 138s Get:51 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpython3.11-minimal s390x 3.11.8-1build4 [838 kB] 138s Get:52 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpython3.11-stdlib s390x 3.11.8-1build4 [1944 kB] 138s Get:53 http://ftpmaster.internal/ubuntu noble-proposed/main s390x shared-mime-info s390x 2.4-1build1 [474 kB] 138s Get:54 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gir1.2-girepository-2.0 s390x 1.79.1-1ubuntu6 [24.5 kB] 138s Get:55 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gir1.2-glib-2.0 s390x 2.79.3-3ubuntu5 [180 kB] 138s Get:56 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgirepository-1.0-1 s390x 1.79.1-1ubuntu6 [84.0 kB] 138s Get:57 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-gi s390x 3.47.0-3build1 [236 kB] 138s Get:58 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-dbus s390x 1.3.2-5build2 [100 kB] 138s Get:59 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libnetplan1 s390x 1.0-1 [123 kB] 138s Get:60 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-netplan s390x 1.0-1 [23.0 kB] 138s Get:61 http://ftpmaster.internal/ubuntu noble-proposed/main s390x netplan-generator s390x 1.0-1 [59.1 kB] 138s Get:62 http://ftpmaster.internal/ubuntu noble-proposed/main s390x initramfs-tools-bin s390x 0.142ubuntu23 [20.5 kB] 138s Get:63 http://ftpmaster.internal/ubuntu noble-proposed/main s390x initramfs-tools-core all 0.142ubuntu23 [50.1 kB] 138s Get:64 http://ftpmaster.internal/ubuntu noble-proposed/main s390x initramfs-tools all 0.142ubuntu23 [9058 B] 138s Get:65 http://ftpmaster.internal/ubuntu noble-proposed/main s390x netplan.io s390x 1.0-1 [65.4 kB] 138s Get:66 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libxmlb2 s390x 0.3.15-1build1 [70.6 kB] 138s Get:67 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgpgme11t64 s390x 1.18.0-4.1ubuntu3 [150 kB] 138s Get:68 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libvolume-key1 s390x 0.3.12-7build1 [40.8 kB] 138s Get:69 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libqrtr-glib0 s390x 1.2.2-1ubuntu3 [17.5 kB] 138s Get:70 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libqmi-glib5 s390x 1.35.2-0ubuntu1 [918 kB] 138s Get:71 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libqmi-proxy s390x 1.35.2-0ubuntu1 [6122 B] 138s Get:72 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpolkit-agent-1-0 s390x 124-1ubuntu1 [17.8 kB] 138s Get:73 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpolkit-gobject-1-0 s390x 124-1ubuntu1 [48.3 kB] 138s Get:74 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libmm-glib0 s390x 1.23.4-0ubuntu1 [251 kB] 138s Get:75 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libmbim-glib4 s390x 1.31.2-0ubuntu2 [238 kB] 138s Get:76 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libmbim-proxy s390x 1.31.2-0ubuntu2 [6154 B] 138s Get:77 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libjson-glib-1.0-common all 1.8.0-2build1 [4210 B] 138s Get:78 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libjson-glib-1.0-0 s390x 1.8.0-2build1 [68.4 kB] 138s Get:79 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgusb2 s390x 0.4.8-1build1 [39.0 kB] 138s Get:80 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgudev-1.0-0 s390x 1:238-3ubuntu2 [15.7 kB] 138s Get:81 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libarchive13t64 s390x 3.7.2-1.1ubuntu2 [419 kB] 138s Get:82 http://ftpmaster.internal/ubuntu noble-proposed/main s390x fwupd s390x 1.9.15-2 [4435 kB] 138s Get:83 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libcurl3t64-gnutls s390x 8.5.0-2ubuntu8 [356 kB] 138s Get:84 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libfwupd2 s390x 1.9.15-2 [136 kB] 138s Get:85 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev3 s390x 3.1.0-1build1 [52.3 kB] 138s Get:86 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-utils3 s390x 3.1.0-1build1 [19.2 kB] 138s Get:87 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-swap3 s390x 3.1.0-1build1 [7778 B] 138s Get:88 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-part3 s390x 3.1.0-1build1 [15.4 kB] 138s Get:89 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libnvme1t64 s390x 1.8-3 [78.7 kB] 138s Get:90 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-nvme3 s390x 3.1.0-1build1 [18.3 kB] 138s Get:91 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-mdraid3 s390x 3.1.0-1build1 [13.2 kB] 138s Get:92 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-loop3 s390x 3.1.0-1build1 [7138 B] 138s Get:93 http://ftpmaster.internal/ubuntu noble-proposed/main s390x e2fsprogs-l10n all 1.47.0-2.4~exp1ubuntu2 [5996 B] 138s Get:94 http://ftpmaster.internal/ubuntu noble-proposed/main s390x logsave s390x 1.47.0-2.4~exp1ubuntu2 [22.5 kB] 138s Get:95 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libext2fs2t64 s390x 1.47.0-2.4~exp1ubuntu2 [235 kB] 138s Get:96 http://ftpmaster.internal/ubuntu noble-proposed/main s390x e2fsprogs s390x 1.47.0-2.4~exp1ubuntu2 [615 kB] 138s Get:97 http://ftpmaster.internal/ubuntu noble/main s390x libreiserfscore0t64 s390x 1:3.6.27-7.1 [85.5 kB] 138s Get:98 http://ftpmaster.internal/ubuntu noble-proposed/main s390x btrfs-progs s390x 6.6.3-1.1build1 [959 kB] 138s Get:99 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-fs3 s390x 3.1.0-1build1 [36.5 kB] 138s Get:100 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libblockdev-crypto3 s390x 3.1.0-1build1 [21.6 kB] 138s Get:101 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bolt s390x 0.9.6-2build1 [142 kB] 139s Get:102 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libglib2.0-0t64 s390x 2.79.3-3ubuntu5 [1566 kB] 139s Get:103 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libjcat1 s390x 0.2.0-2build2 [34.4 kB] 139s Get:104 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libldap2 s390x 2.6.7+dfsg-1~exp1ubuntu6 [202 kB] 139s Get:105 http://ftpmaster.internal/ubuntu noble-proposed/main s390x ubuntu-pro-client-l10n s390x 31.2.2 [19.4 kB] 139s Get:106 http://ftpmaster.internal/ubuntu noble-proposed/main s390x ubuntu-pro-client s390x 31.2.2 [214 kB] 139s Get:107 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gnupg-utils s390x 2.4.4-2ubuntu15 [116 kB] 139s Get:108 http://ftpmaster.internal/ubuntu noble-proposed/main s390x keyboxd s390x 2.4.4-2ubuntu15 [83.1 kB] 139s Get:109 http://ftpmaster.internal/ubuntu noble/main s390x libnpth0t64 s390x 1.6-3.1 [8148 B] 139s Get:110 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gpgv s390x 2.4.4-2ubuntu15 [165 kB] 139s Get:111 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gpg-wks-client s390x 2.4.4-2ubuntu15 [76.8 kB] 140s Get:112 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gpg-agent s390x 2.4.4-2ubuntu15 [240 kB] 140s Get:113 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gpg s390x 2.4.4-2ubuntu15 [589 kB] 140s Get:114 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dirmngr s390x 2.4.4-2ubuntu15 [340 kB] 140s Get:115 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gnupg all 2.4.4-2ubuntu15 [359 kB] 140s Get:116 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-apt s390x 2.7.7 [171 kB] 140s Get:117 http://ftpmaster.internal/ubuntu noble-proposed/main s390x apt-utils s390x 2.7.14 [214 kB] 140s Get:118 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libapt-pkg6.0t64 s390x 2.7.14 [1014 kB] 140s Get:119 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libnettle8t64 s390x 3.9.1-2.2 [210 kB] 140s Get:120 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libhogweed6t64 s390x 3.9.1-2.2 [204 kB] 140s Get:121 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgnutls30t64 s390x 3.8.3-1.1ubuntu2 [1044 kB] 140s Get:122 http://ftpmaster.internal/ubuntu noble-proposed/main s390x apt s390x 2.7.14 [1390 kB] 140s Get:123 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gpgconf s390x 2.4.4-2ubuntu15 [111 kB] 140s Get:124 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gpgsm s390x 2.4.4-2ubuntu15 [244 kB] 141s Get:125 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libreadline8t64 s390x 8.2-4 [170 kB] 141s Get:126 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gawk s390x 1:5.2.1-2build2 [496 kB] 141s Get:127 http://ftpmaster.internal/ubuntu noble-proposed/main s390x fdisk s390x 2.39.3-9ubuntu2 [124 kB] 141s Get:128 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpython3.12-stdlib s390x 3.12.2-4build3 [2046 kB] 141s Get:129 http://ftpmaster.internal/ubuntu noble-proposed/main s390x perl-base s390x 5.38.2-3.2 [1961 kB] 141s Get:130 http://ftpmaster.internal/ubuntu noble-proposed/main s390x perl-modules-5.38 all 5.38.2-3.2 [3110 kB] 141s Get:131 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-gdbm s390x 3.12.2-3ubuntu1.1 [19.0 kB] 141s Get:132 http://ftpmaster.internal/ubuntu noble-proposed/main s390x man-db s390x 2.12.0-3build4 [1246 kB] 142s Get:133 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgdbm6t64 s390x 1.23-5.1 [36.4 kB] 142s Get:134 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgdbm-compat4t64 s390x 1.23-5.1 [6880 B] 142s Get:135 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libperl5.38t64 s390x 5.38.2-3.2 [5007 kB] 142s Get:136 http://ftpmaster.internal/ubuntu noble-proposed/main s390x perl s390x 5.38.2-3.2 [231 kB] 142s Get:137 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libdb5.3t64 s390x 5.3.28+dfsg2-6 [763 kB] 142s Get:138 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsasl2-modules-db s390x 2.1.28+dfsg1-5ubuntu1 [21.1 kB] 142s Get:139 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsasl2-2 s390x 2.1.28+dfsg1-5ubuntu1 [57.8 kB] 142s Get:140 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libfido2-1 s390x 1.14.0-1build1 [81.0 kB] 142s Get:141 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libcryptsetup12 s390x 2:2.7.0-1ubuntu2 [264 kB] 142s Get:142 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dhcpcd-base s390x 1:10.0.6-1ubuntu2 [217 kB] 142s Get:143 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libuv1t64 s390x 1.48.0-1.1 [101 kB] 142s Get:144 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bind9-host s390x 1:9.18.24-0ubuntu3 [50.5 kB] 142s Get:145 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bind9-dnsutils s390x 1:9.18.24-0ubuntu3 [162 kB] 142s Get:146 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bind9-libs s390x 1:9.18.24-0ubuntu3 [1243 kB] 142s Get:147 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libssl3t64 s390x 3.0.13-0ubuntu2 [1675 kB] 142s Get:148 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libnss-systemd s390x 255.4-1ubuntu5 [166 kB] 142s Get:149 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libudev1 s390x 255.4-1ubuntu5 [178 kB] 142s Get:150 http://ftpmaster.internal/ubuntu noble-proposed/main s390x systemd s390x 255.4-1ubuntu5 [3533 kB] 143s Get:151 http://ftpmaster.internal/ubuntu noble-proposed/main s390x udev s390x 255.4-1ubuntu5 [1887 kB] 143s Get:152 http://ftpmaster.internal/ubuntu noble-proposed/main s390x systemd-sysv s390x 255.4-1ubuntu5 [11.9 kB] 143s Get:153 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpam-systemd s390x 255.4-1ubuntu5 [242 kB] 143s Get:154 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsystemd0 s390x 255.4-1ubuntu5 [443 kB] 143s Get:155 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpam-modules-bin s390x 1.5.3-5ubuntu3 [57.4 kB] 143s Get:156 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpam-modules s390x 1.5.3-5ubuntu3 [289 kB] 143s Get:157 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpam-runtime all 1.5.3-5ubuntu3 [40.8 kB] 143s Get:158 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dbus-user-session s390x 1.14.10-4ubuntu2 [9960 B] 143s Get:159 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libapparmor1 s390x 4.0.0-beta3-0ubuntu2 [50.8 kB] 143s Get:160 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dbus-system-bus-common all 1.14.10-4ubuntu2 [81.5 kB] 143s Get:161 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dbus-bin s390x 1.14.10-4ubuntu2 [41.4 kB] 143s Get:162 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dbus s390x 1.14.10-4ubuntu2 [24.3 kB] 143s Get:163 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dbus-daemon s390x 1.14.10-4ubuntu2 [118 kB] 143s Get:164 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libdbus-1-3 s390x 1.14.10-4ubuntu2 [213 kB] 143s Get:165 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libmount1 s390x 2.39.3-9ubuntu2 [138 kB] 143s Get:166 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libseccomp2 s390x 2.5.5-1ubuntu2 [53.4 kB] 143s Get:167 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libdevmapper1.02.1 s390x 2:1.02.185-3ubuntu2 [142 kB] 143s Get:168 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libuuid1 s390x 2.39.3-9ubuntu2 [35.6 kB] 143s Get:169 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libfdisk1 s390x 2.39.3-9ubuntu2 [151 kB] 143s Get:170 http://ftpmaster.internal/ubuntu noble-proposed/main s390x mount s390x 2.39.3-9ubuntu2 [119 kB] 143s Get:171 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsqlite3-0 s390x 3.45.1-1ubuntu1 [747 kB] 143s Get:172 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gcc-14-base s390x 14-20240315-1ubuntu1 [47.0 kB] 143s Get:173 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgcc-s1 s390x 14-20240315-1ubuntu1 [35.9 kB] 143s Get:174 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libstdc++6 s390x 14-20240315-1ubuntu1 [908 kB] 143s Get:175 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dpkg s390x 1.22.6ubuntu5 [1278 kB] 143s Get:176 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-minimal s390x 3.12.2-0ubuntu1 [27.1 kB] 143s Get:177 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3 s390x 3.12.2-0ubuntu1 [24.1 kB] 143s Get:178 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpython3-stdlib s390x 3.12.2-0ubuntu1 [9804 B] 143s Get:179 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsmartcols1 s390x 2.39.3-9ubuntu2 [67.9 kB] 143s Get:180 http://ftpmaster.internal/ubuntu noble-proposed/main s390x bsdextrautils s390x 2.39.3-9ubuntu2 [76.3 kB] 143s Get:181 http://ftpmaster.internal/ubuntu noble-proposed/main s390x groff-base s390x 1.23.0-3build1 [1049 kB] 143s Get:182 http://ftpmaster.internal/ubuntu noble-proposed/main s390x pinentry-curses s390x 1.2.1-3ubuntu4 [37.6 kB] 143s Get:183 http://ftpmaster.internal/ubuntu noble-proposed/main s390x readline-common all 8.2-4 [56.4 kB] 143s Get:184 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libxml2 s390x 2.9.14+dfsg-1.3ubuntu2 [818 kB] 143s Get:185 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libbpf1 s390x 1:1.3.0-2build1 [176 kB] 143s Get:186 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libelf1t64 s390x 0.190-1.1build2 [69.7 kB] 143s Get:187 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libtirpc-common all 1.3.4+ds-1.1 [8018 B] 143s Get:188 http://ftpmaster.internal/ubuntu noble-proposed/main s390x lsof s390x 4.95.0-1build2 [248 kB] 143s Get:189 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libnsl2 s390x 1.3.0-3build2 [44.1 kB] 143s Get:190 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libtirpc3t64 s390x 1.3.4+ds-1.1 [85.8 kB] 143s Get:191 http://ftpmaster.internal/ubuntu noble-proposed/main s390x iproute2 s390x 6.1.0-1ubuntu5 [1156 kB] 143s Get:192 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-yaml s390x 6.0.1-2build1 [121 kB] 143s Get:193 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libusb-1.0-0 s390x 2:1.0.27-1 [54.8 kB] 143s Get:194 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libprotobuf-c1 s390x 1.4.1-1ubuntu3 [23.4 kB] 143s Get:195 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libnghttp2-14 s390x 1.59.0-1build1 [77.8 kB] 143s Get:196 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libproc2-0 s390x 2:4.0.4-4ubuntu2 [60.1 kB] 143s Get:197 http://ftpmaster.internal/ubuntu noble-proposed/main s390x procps s390x 2:4.0.4-4ubuntu2 [724 kB] 144s Get:198 http://ftpmaster.internal/ubuntu noble-proposed/main s390x coreutils s390x 9.4-3ubuntu3 [1482 kB] 144s Get:199 http://ftpmaster.internal/ubuntu noble-proposed/main s390x util-linux s390x 2.39.3-9ubuntu2 [1143 kB] 144s Get:200 http://ftpmaster.internal/ubuntu noble-proposed/main s390x file s390x 1:5.45-3 [22.2 kB] 144s Get:201 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libmagic-mgc s390x 1:5.45-3 [305 kB] 144s Get:202 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libmagic1t64 s390x 1:5.45-3 [93.1 kB] 144s Get:203 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libplymouth5 s390x 24.004.60-1ubuntu6 [151 kB] 144s Get:204 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libpng16-16t64 s390x 1.6.43-3 [200 kB] 144s Get:205 http://ftpmaster.internal/ubuntu noble-proposed/main s390x multipath-tools s390x 0.9.4-5ubuntu6 [318 kB] 145s Get:206 http://ftpmaster.internal/ubuntu noble/main s390x liburcu8t64 s390x 0.14.0-3.1 [67.3 kB] 145s Get:207 http://ftpmaster.internal/ubuntu noble-proposed/main s390x liblocale-gettext-perl s390x 1.07-6ubuntu4 [15.8 kB] 145s Get:208 http://ftpmaster.internal/ubuntu noble-proposed/main s390x uuid-runtime s390x 2.39.3-9ubuntu2 [33.4 kB] 145s Get:209 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libdebconfclient0 s390x 0.271ubuntu2 [11.4 kB] 145s Get:210 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsemanage-common all 3.5-1build4 [10.1 kB] 145s Get:211 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsemanage2 s390x 3.5-1build4 [96.7 kB] 145s Get:212 http://ftpmaster.internal/ubuntu noble-proposed/main s390x install-info s390x 7.1-3build1 [64.5 kB] 145s Get:213 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gcc-13-base s390x 13.2.0-21ubuntu1 [48.3 kB] 145s Get:214 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libss2 s390x 1.47.0-2.4~exp1ubuntu2 [17.2 kB] 145s Get:215 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dmsetup s390x 2:1.02.185-3ubuntu2 [80.4 kB] 145s Get:216 http://ftpmaster.internal/ubuntu noble-proposed/main s390x eject s390x 2.39.3-9ubuntu2 [26.2 kB] 145s Get:217 http://ftpmaster.internal/ubuntu noble-proposed/main s390x krb5-locales all 1.20.1-6ubuntu1 [13.8 kB] 145s Get:218 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libglib2.0-data all 2.79.3-3ubuntu5 [46.6 kB] 145s Get:219 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libslang2 s390x 2.3.3-3build1 [501 kB] 145s Get:220 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libtext-charwidth-perl s390x 0.04-11build2 [9484 B] 145s Get:221 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libtext-iconv-perl s390x 1.7-8build2 [13.8 kB] 145s Get:222 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python-apt-common all 2.7.7 [19.8 kB] 145s Get:223 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-setuptools all 68.1.2-2ubuntu1 [396 kB] 145s Get:224 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-pkg-resources all 68.1.2-2ubuntu1 [168 kB] 145s Get:225 http://ftpmaster.internal/ubuntu noble-proposed/main s390x rsyslog s390x 8.2312.0-3ubuntu7 [536 kB] 145s Get:226 http://ftpmaster.internal/ubuntu noble-proposed/main s390x vim-tiny s390x 2:9.1.0016-1ubuntu6 [879 kB] 146s Get:227 http://ftpmaster.internal/ubuntu noble-proposed/main s390x vim-common all 2:9.1.0016-1ubuntu6 [385 kB] 146s Get:228 http://ftpmaster.internal/ubuntu noble/main s390x xdg-user-dirs s390x 0.18-1 [18.5 kB] 146s Get:229 http://ftpmaster.internal/ubuntu noble-proposed/main s390x xxd s390x 2:9.1.0016-1ubuntu6 [63.5 kB] 146s Get:230 http://ftpmaster.internal/ubuntu noble-proposed/main s390x apparmor s390x 4.0.0-beta3-0ubuntu2 [710 kB] 146s Get:231 http://ftpmaster.internal/ubuntu noble-proposed/main s390x ftp all 20230507-2build1 [4724 B] 146s Get:232 http://ftpmaster.internal/ubuntu noble-proposed/main s390x inetutils-telnet s390x 2:2.5-3ubuntu3 [105 kB] 146s Get:233 http://ftpmaster.internal/ubuntu noble-proposed/main s390x info s390x 7.1-3build1 [152 kB] 146s Get:234 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libxmuu1 s390x 2:1.1.3-3build1 [8860 B] 146s Get:235 http://ftpmaster.internal/ubuntu noble-proposed/main s390x lshw s390x 02.19.git.2021.06.19.996aaad9c7-2build2 [346 kB] 146s Get:236 http://ftpmaster.internal/ubuntu noble/main s390x manpages all 6.05.01-1 [1340 kB] 146s Get:237 http://ftpmaster.internal/ubuntu noble-proposed/main s390x mtr-tiny s390x 0.95-1.1build1 [57.0 kB] 146s Get:238 http://ftpmaster.internal/ubuntu noble-proposed/main s390x plymouth-theme-ubuntu-text s390x 24.004.60-1ubuntu6 [10.2 kB] 146s Get:239 http://ftpmaster.internal/ubuntu noble-proposed/main s390x plymouth s390x 24.004.60-1ubuntu6 [147 kB] 146s Get:240 http://ftpmaster.internal/ubuntu noble-proposed/main s390x telnet all 0.17+2.5-3ubuntu3 [3682 B] 146s Get:241 http://ftpmaster.internal/ubuntu noble-proposed/main s390x usb.ids all 2024.03.18-1 [223 kB] 146s Get:242 http://ftpmaster.internal/ubuntu noble-proposed/main s390x xz-utils s390x 5.6.0-0.2 [274 kB] 146s Get:243 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libllvm18 s390x 1:18.1.2-1ubuntu2 [33.4 MB] 149s Get:244 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libclang-cpp18 s390x 1:18.1.2-1ubuntu2 [16.1 MB] 150s Get:245 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x libbpfcc s390x 0.29.1+ds-1ubuntu4 [697 kB] 150s Get:246 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x python3-bpfcc all 0.29.1+ds-1ubuntu4 [40.2 kB] 150s Get:247 http://ftpmaster.internal/ubuntu noble/main s390x ieee-data all 20220827.1 [2113 kB] 150s Get:248 http://ftpmaster.internal/ubuntu noble/main s390x python3-netaddr all 0.8.0-2ubuntu1 [319 kB] 150s Get:249 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x bpfcc-tools all 0.29.1+ds-1ubuntu4 [687 kB] 150s Get:250 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libclang1-18 s390x 1:18.1.2-1ubuntu2 [9349 kB] 151s Get:251 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libdw1t64 s390x 0.190-1.1build2 [286 kB] 151s Get:252 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x bpftrace s390x 0.20.2-1ubuntu1 [1139 kB] 151s Get:253 http://ftpmaster.internal/ubuntu noble-proposed/main s390x cryptsetup-bin s390x 2:2.7.0-1ubuntu2 [211 kB] 151s Get:254 http://ftpmaster.internal/ubuntu noble-proposed/main s390x dpkg-dev all 1.22.6ubuntu5 [1074 kB] 151s Get:255 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libdpkg-perl all 1.22.6ubuntu5 [269 kB] 151s Get:256 http://ftpmaster.internal/ubuntu noble/main s390x fonts-dejavu-mono all 2.37-8 [502 kB] 151s Get:257 http://ftpmaster.internal/ubuntu noble/main s390x fonts-dejavu-core all 2.37-8 [835 kB] 151s Get:258 http://ftpmaster.internal/ubuntu noble/main s390x fontconfig-config s390x 2.15.0-1.1ubuntu1 [37.4 kB] 151s Get:259 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gnupg-l10n all 2.4.4-2ubuntu15 [65.8 kB] 151s Get:260 http://ftpmaster.internal/ubuntu noble/main s390x hwdata all 0.379-1 [29.1 kB] 151s Get:261 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libibverbs1 s390x 50.0-2build1 [70.0 kB] 151s Get:262 http://ftpmaster.internal/ubuntu noble-proposed/main s390x ibverbs-providers s390x 50.0-2build1 [408 kB] 151s Get:263 http://ftpmaster.internal/ubuntu noble-proposed/main s390x jq s390x 1.7.1-3 [66.5 kB] 151s Get:264 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libjq1 s390x 1.7.1-3 [168 kB] 151s Get:265 http://ftpmaster.internal/ubuntu noble/main s390x libaio1t64 s390x 0.3.113-6 [7290 B] 151s Get:266 http://ftpmaster.internal/ubuntu noble/main s390x libatm1t64 s390x 1:2.5.1-5.1 [24.5 kB] 151s Get:267 http://ftpmaster.internal/ubuntu noble/main s390x libc-dev-bin s390x 2.39-0ubuntu6 [20.2 kB] 151s Get:268 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libfreetype6 s390x 2.13.2+dfsg-1build2 [437 kB] 151s Get:269 http://ftpmaster.internal/ubuntu noble/main s390x libfontconfig1 s390x 2.15.0-1.1ubuntu1 [150 kB] 151s Get:270 http://ftpmaster.internal/ubuntu noble/main s390x libjpeg-turbo8 s390x 2.1.5-2ubuntu1 [128 kB] 151s Get:271 http://ftpmaster.internal/ubuntu noble/main s390x libjpeg8 s390x 8c-2ubuntu11 [2146 B] 151s Get:272 http://ftpmaster.internal/ubuntu noble/main s390x libdeflate0 s390x 1.19-1 [46.0 kB] 151s Get:273 http://ftpmaster.internal/ubuntu noble/main s390x libjbig0 s390x 2.1-6.1ubuntu1 [29.8 kB] 151s Get:274 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libsharpyuv0 s390x 1.3.2-0.4build2 [14.9 kB] 151s Get:275 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libwebp7 s390x 1.3.2-0.4build2 [207 kB] 151s Get:276 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libtiff6 s390x 4.5.1+git230720-4ubuntu1 [218 kB] 151s Get:277 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libxpm4 s390x 1:3.5.17-1build1 [41.4 kB] 151s Get:278 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgd3 s390x 2.3.3-9ubuntu3 [141 kB] 151s Get:279 http://ftpmaster.internal/ubuntu noble/main s390x libc-devtools s390x 2.39-0ubuntu6 [30.6 kB] 151s Get:280 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-libc-dev s390x 6.8.0-20.20 [1592 kB] 151s Get:281 http://ftpmaster.internal/ubuntu noble/main s390x libcrypt-dev s390x 1:4.4.36-4 [135 kB] 151s Get:282 http://ftpmaster.internal/ubuntu noble/main s390x rpcsvc-proto s390x 1.4.2-0ubuntu6 [64.7 kB] 151s Get:283 http://ftpmaster.internal/ubuntu noble/main s390x libc6-dev s390x 2.39-0ubuntu6 [1629 kB] 151s Get:284 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libevent-core-2.1-7 s390x 2.1.12-stable-9build1 [94.3 kB] 151s Get:285 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libftdi1-2 s390x 1.5-6build4 [29.3 kB] 151s Get:286 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libldap-common all 2.6.7+dfsg-1~exp1ubuntu6 [31.3 kB] 151s Get:287 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-modules-6.8.0-20-generic s390x 6.8.0-20.20 [21.0 MB] 152s Get:288 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-image-6.8.0-20-generic s390x 6.8.0-20.20 [9872 kB] 153s Get:289 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-modules-extra-6.8.0-20-generic s390x 6.8.0-20.20 [11.7 MB] 154s Get:290 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-generic s390x 6.8.0-20.20+1 [1734 B] 154s Get:291 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-image-generic s390x 6.8.0-20.20+1 [9688 B] 154s Get:292 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-virtual s390x 6.8.0-20.20+1 [1682 B] 154s Get:293 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-image-virtual s390x 6.8.0-20.20+1 [9700 B] 154s Get:294 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-headers-virtual s390x 6.8.0-20.20+1 [1642 B] 154s Get:295 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-headers-6.8.0-20 all 6.8.0-20.20 [13.6 MB] 154s Get:296 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-headers-6.8.0-20-generic s390x 6.8.0-20.20 [2579 kB] 155s Get:297 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-headers-generic s390x 6.8.0-20.20+1 [9608 B] 155s Get:298 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-tools-common all 6.8.0-20.20 [437 kB] 155s Get:299 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-tools-6.8.0-20 s390x 6.8.0-20.20 [2674 kB] 155s Get:300 http://ftpmaster.internal/ubuntu noble-proposed/main s390x linux-tools-6.8.0-20-generic s390x 6.8.0-20.20 [1724 B] 155s Get:301 http://ftpmaster.internal/ubuntu noble/main s390x manpages-dev all 6.05.01-1 [2018 kB] 155s Get:302 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-distutils all 3.12.2-3ubuntu1.1 [133 kB] 155s Get:303 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-lib2to3 all 3.12.2-3ubuntu1.1 [79.1 kB] 155s Get:304 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-pyrsistent s390x 0.20.0-1build1 [55.8 kB] 155s Get:305 http://ftpmaster.internal/ubuntu noble-proposed/main s390x python3-typing-extensions all 4.10.0-1 [60.7 kB] 155s Get:306 http://ftpmaster.internal/ubuntu noble-proposed/main s390x s390-tools-data all 2.31.0-0ubuntu3 [17.8 kB] 155s Get:307 http://ftpmaster.internal/ubuntu noble/main s390x ubuntu-kernel-accessories s390x 1.536build1 [10.5 kB] 155s Get:308 http://ftpmaster.internal/ubuntu noble-proposed/main s390x kpartx s390x 0.9.4-5ubuntu6 [32.8 kB] 156s Preconfiguring packages ... 156s Fetched 225 MB in 22s (10.3 MB/s) 156s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 156s Preparing to unpack .../motd-news-config_13ubuntu8_all.deb ... 156s Unpacking motd-news-config (13ubuntu8) over (13ubuntu7) ... 156s Preparing to unpack .../base-files_13ubuntu8_s390x.deb ... 156s Unpacking base-files (13ubuntu8) over (13ubuntu7) ... 156s Setting up base-files (13ubuntu8) ... 157s motd-news.service is a disabled or a static unit not running, not starting it. 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 157s Preparing to unpack .../bash_5.2.21-2ubuntu3_s390x.deb ... 157s Unpacking bash (5.2.21-2ubuntu3) over (5.2.21-2ubuntu2) ... 157s Setting up bash (5.2.21-2ubuntu3) ... 157s update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 157s Preparing to unpack .../bsdutils_1%3a2.39.3-9ubuntu2_s390x.deb ... 157s Unpacking bsdutils (1:2.39.3-9ubuntu2) over (1:2.39.3-6ubuntu2) ... 157s Setting up bsdutils (1:2.39.3-9ubuntu2) ... 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 157s Preparing to unpack .../0-libbrotli1_1.1.0-2build1_s390x.deb ... 157s Unpacking libbrotli1:s390x (1.1.0-2build1) over (1.1.0-2) ... 157s Preparing to unpack .../1-libgssapi-krb5-2_1.20.1-6ubuntu1_s390x.deb ... 157s Unpacking libgssapi-krb5-2:s390x (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 157s Preparing to unpack .../2-libkrb5-3_1.20.1-6ubuntu1_s390x.deb ... 157s Unpacking libkrb5-3:s390x (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 157s Preparing to unpack .../3-libkrb5support0_1.20.1-6ubuntu1_s390x.deb ... 157s Unpacking libkrb5support0:s390x (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 157s Preparing to unpack .../4-libk5crypto3_1.20.1-6ubuntu1_s390x.deb ... 157s Unpacking libk5crypto3:s390x (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 157s Preparing to unpack .../5-libcom-err2_1.47.0-2.4~exp1ubuntu2_s390x.deb ... 157s Unpacking libcom-err2:s390x (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 157s Preparing to unpack .../6-zlib1g_1%3a1.3.dfsg-3.1ubuntu1_s390x.deb ... 157s Unpacking zlib1g:s390x (1:1.3.dfsg-3.1ubuntu1) over (1:1.3.dfsg-3ubuntu1) ... 157s Setting up zlib1g:s390x (1:1.3.dfsg-3.1ubuntu1) ... 157s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 157s Preparing to unpack .../librtmp1_2.4+20151223.gitfa8646d.1-2build6_s390x.deb ... 157s Unpacking librtmp1:s390x (2.4+20151223.gitfa8646d.1-2build6) over (2.4+20151223.gitfa8646d.1-2build4) ... 158s Preparing to unpack .../udisks2_2.10.1-6_s390x.deb ... 158s Unpacking udisks2 (2.10.1-6) over (2.10.1-1ubuntu2) ... 158s Preparing to unpack .../libudisks2-0_2.10.1-6_s390x.deb ... 158s Unpacking libudisks2-0:s390x (2.10.1-6) over (2.10.1-1ubuntu2) ... 158s Preparing to unpack .../libblkid1_2.39.3-9ubuntu2_s390x.deb ... 158s Unpacking libblkid1:s390x (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 158s Setting up libblkid1:s390x (2.39.3-9ubuntu2) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Preparing to unpack .../liblzma5_5.6.0-0.2_s390x.deb ... 158s Unpacking liblzma5:s390x (5.6.0-0.2) over (5.4.5-0.3) ... 158s Setting up liblzma5:s390x (5.6.0-0.2) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Preparing to unpack .../0-kmod_31+20240202-2ubuntu4_s390x.deb ... 158s Unpacking kmod (31+20240202-2ubuntu4) over (30+20230601-2ubuntu1) ... 158s Preparing to unpack .../1-libkmod2_31+20240202-2ubuntu4_s390x.deb ... 158s Unpacking libkmod2:s390x (31+20240202-2ubuntu4) over (30+20230601-2ubuntu1) ... 158s Preparing to unpack .../2-systemd-dev_255.4-1ubuntu5_all.deb ... 158s Unpacking systemd-dev (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 158s Preparing to unpack .../3-systemd-timesyncd_255.4-1ubuntu5_s390x.deb ... 158s Unpacking systemd-timesyncd (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 158s Preparing to unpack .../4-dbus-session-bus-common_1.14.10-4ubuntu2_all.deb ... 158s Unpacking dbus-session-bus-common (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 158s Preparing to unpack .../5-libaudit-common_1%3a3.1.2-2.1_all.deb ... 158s Unpacking libaudit-common (1:3.1.2-2.1) over (1:3.1.2-2) ... 158s Setting up libaudit-common (1:3.1.2-2.1) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Preparing to unpack .../libcap-ng0_0.8.4-2build1_s390x.deb ... 158s Unpacking libcap-ng0:s390x (0.8.4-2build1) over (0.8.4-2) ... 158s Setting up libcap-ng0:s390x (0.8.4-2build1) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Preparing to unpack .../libaudit1_1%3a3.1.2-2.1_s390x.deb ... 158s Unpacking libaudit1:s390x (1:3.1.2-2.1) over (1:3.1.2-2) ... 158s Setting up libaudit1:s390x (1:3.1.2-2.1) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Preparing to unpack .../libpam0g_1.5.3-5ubuntu3_s390x.deb ... 158s Unpacking libpam0g:s390x (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 158s Setting up libpam0g:s390x (1.5.3-5ubuntu3) ... 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Preparing to unpack .../libselinux1_3.5-2ubuntu1_s390x.deb ... 158s Unpacking libselinux1:s390x (3.5-2ubuntu1) over (3.5-2build1) ... 158s Setting up libselinux1:s390x (3.5-2ubuntu1) ... 158s dpkg: libcurl4:s390x: dependency problems, but removing anyway as you requested: 158s s390-tools depends on libcurl4 (>= 7.16.2). 158s curl depends on libcurl4 (= 8.5.0-2ubuntu2). 158s 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 158s Removing libcurl4:s390x (8.5.0-2ubuntu2) ... 158s Selecting previously unselected package libcurl4t64:s390x. 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52162 files and directories currently installed.) 158s Preparing to unpack .../libcurl4t64_8.5.0-2ubuntu8_s390x.deb ... 158s Unpacking libcurl4t64:s390x (8.5.0-2ubuntu8) ... 158s Preparing to unpack .../curl_8.5.0-2ubuntu8_s390x.deb ... 158s Unpacking curl (8.5.0-2ubuntu8) over (8.5.0-2ubuntu2) ... 158s dpkg: libpsl5:s390x: dependency problems, but removing anyway as you requested: 158s wget depends on libpsl5 (>= 0.16.0). 158s libcurl3-gnutls:s390x depends on libpsl5 (>= 0.16.0). 158s 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52168 files and directories currently installed.) 158s Removing libpsl5:s390x (0.21.2-1build1) ... 158s Selecting previously unselected package libpsl5t64:s390x. 158s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52163 files and directories currently installed.) 158s Preparing to unpack .../00-libpsl5t64_0.21.2-1.1_s390x.deb ... 158s Unpacking libpsl5t64:s390x (0.21.2-1.1) ... 158s Preparing to unpack .../01-wget_1.21.4-1ubuntu2_s390x.deb ... 158s Unpacking wget (1.21.4-1ubuntu2) over (1.21.4-1ubuntu1) ... 158s Preparing to unpack .../02-tnftp_20230507-2build1_s390x.deb ... 158s Unpacking tnftp (20230507-2build1) over (20230507-2) ... 158s Preparing to unpack .../03-tcpdump_4.99.4-3ubuntu2_s390x.deb ... 158s Unpacking tcpdump (4.99.4-3ubuntu2) over (4.99.4-3ubuntu1) ... 158s Preparing to unpack .../04-libsystemd-shared_255.4-1ubuntu5_s390x.deb ... 158s Unpacking libsystemd-shared:s390x (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 158s Preparing to unpack .../05-systemd-resolved_255.4-1ubuntu5_s390x.deb ... 158s Unpacking systemd-resolved (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 159s Preparing to unpack .../06-sudo_1.9.15p5-3ubuntu3_s390x.deb ... 159s Unpacking sudo (1.9.15p5-3ubuntu3) over (1.9.15p5-3ubuntu1) ... 159s Preparing to unpack .../07-rsync_3.2.7-1build1_s390x.deb ... 159s Unpacking rsync (3.2.7-1build1) over (3.2.7-1) ... 159s Preparing to unpack .../08-python3-cryptography_41.0.7-4build2_s390x.deb ... 159s Unpacking python3-cryptography (41.0.7-4build2) over (41.0.7-3) ... 159s Preparing to unpack .../09-openssl_3.0.13-0ubuntu2_s390x.deb ... 159s Unpacking openssl (3.0.13-0ubuntu2) over (3.0.10-1ubuntu4) ... 159s Preparing to unpack .../10-openssh-sftp-server_1%3a9.6p1-3ubuntu11_s390x.deb ... 159s Unpacking openssh-sftp-server (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 159s Preparing to unpack .../11-openssh-client_1%3a9.6p1-3ubuntu11_s390x.deb ... 159s Unpacking openssh-client (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 159s Preparing to unpack .../12-openssh-server_1%3a9.6p1-3ubuntu11_s390x.deb ... 159s Unpacking openssh-server (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 159s Preparing to unpack .../13-libssh-4_0.10.6-2build1_s390x.deb ... 159s Unpacking libssh-4:s390x (0.10.6-2build1) over (0.10.6-2) ... 159s Preparing to unpack .../14-libsasl2-modules_2.1.28+dfsg1-5ubuntu1_s390x.deb ... 159s Unpacking libsasl2-modules:s390x (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 159s Preparing to unpack .../15-python3.12_3.12.2-4build3_s390x.deb ... 159s Unpacking python3.12 (3.12.2-4build3) over (3.12.2-1) ... 159s Preparing to unpack .../16-python3.12-minimal_3.12.2-4build3_s390x.deb ... 159s Unpacking python3.12-minimal (3.12.2-4build3) over (3.12.2-1) ... 159s Preparing to unpack .../17-libpython3.12-minimal_3.12.2-4build3_s390x.deb ... 159s Unpacking libpython3.12-minimal:s390x (3.12.2-4build3) over (3.12.2-1) ... 159s dpkg: libparted2:s390x: dependency problems, but removing anyway as you requested: 159s parted depends on libparted2 (= 3.6-3). 159s 159s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52169 files and directories currently installed.) 159s Removing libparted2:s390x (3.6-3) ... 159s Selecting previously unselected package libparted2t64:s390x. 159s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52163 files and directories currently installed.) 159s Preparing to unpack .../00-libparted2t64_3.6-3.1build2_s390x.deb ... 159s Unpacking libparted2t64:s390x (3.6-3.1build2) ... 159s Preparing to unpack .../01-parted_3.6-3.1build2_s390x.deb ... 159s Unpacking parted (3.6-3.1build2) over (3.6-3) ... 159s Preparing to unpack .../02-python3.11_3.11.8-1build4_s390x.deb ... 159s Unpacking python3.11 (3.11.8-1build4) over (3.11.8-1) ... 159s Preparing to unpack .../03-python3.11-minimal_3.11.8-1build4_s390x.deb ... 159s Unpacking python3.11-minimal (3.11.8-1build4) over (3.11.8-1) ... 160s Preparing to unpack .../04-libpython3.11-minimal_3.11.8-1build4_s390x.deb ... 160s Unpacking libpython3.11-minimal:s390x (3.11.8-1build4) over (3.11.8-1) ... 160s Preparing to unpack .../05-libpython3.11-stdlib_3.11.8-1build4_s390x.deb ... 160s Unpacking libpython3.11-stdlib:s390x (3.11.8-1build4) over (3.11.8-1) ... 160s Preparing to unpack .../06-shared-mime-info_2.4-1build1_s390x.deb ... 160s Unpacking shared-mime-info (2.4-1build1) over (2.4-1) ... 160s Preparing to unpack .../07-gir1.2-girepository-2.0_1.79.1-1ubuntu6_s390x.deb ... 160s Unpacking gir1.2-girepository-2.0:s390x (1.79.1-1ubuntu6) over (1.79.1-1) ... 160s Preparing to unpack .../08-gir1.2-glib-2.0_2.79.3-3ubuntu5_s390x.deb ... 160s Unpacking gir1.2-glib-2.0:s390x (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 160s Preparing to unpack .../09-libgirepository-1.0-1_1.79.1-1ubuntu6_s390x.deb ... 160s Unpacking libgirepository-1.0-1:s390x (1.79.1-1ubuntu6) over (1.79.1-1) ... 160s Preparing to unpack .../10-python3-gi_3.47.0-3build1_s390x.deb ... 160s Unpacking python3-gi (3.47.0-3build1) over (3.47.0-3) ... 160s Preparing to unpack .../11-python3-dbus_1.3.2-5build2_s390x.deb ... 160s Unpacking python3-dbus (1.3.2-5build2) over (1.3.2-5build1) ... 160s Selecting previously unselected package libnetplan1:s390x. 160s Preparing to unpack .../12-libnetplan1_1.0-1_s390x.deb ... 160s Unpacking libnetplan1:s390x (1.0-1) ... 160s Preparing to unpack .../13-python3-netplan_1.0-1_s390x.deb ... 160s Unpacking python3-netplan (1.0-1) over (0.107.1-3) ... 160s Preparing to unpack .../14-netplan-generator_1.0-1_s390x.deb ... 160s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 160s Unpacking netplan-generator (1.0-1) over (0.107.1-3) ... 160s Preparing to unpack .../15-initramfs-tools-bin_0.142ubuntu23_s390x.deb ... 160s Unpacking initramfs-tools-bin (0.142ubuntu23) over (0.142ubuntu20) ... 160s Preparing to unpack .../16-initramfs-tools-core_0.142ubuntu23_all.deb ... 160s Unpacking initramfs-tools-core (0.142ubuntu23) over (0.142ubuntu20) ... 160s Preparing to unpack .../17-initramfs-tools_0.142ubuntu23_all.deb ... 160s Unpacking initramfs-tools (0.142ubuntu23) over (0.142ubuntu20) ... 160s Preparing to unpack .../18-netplan.io_1.0-1_s390x.deb ... 160s Unpacking netplan.io (1.0-1) over (0.107.1-3) ... 160s Preparing to unpack .../19-libxmlb2_0.3.15-1build1_s390x.deb ... 160s Unpacking libxmlb2:s390x (0.3.15-1build1) over (0.3.15-1) ... 160s dpkg: libgpgme11:s390x: dependency problems, but removing anyway as you requested: 160s libvolume-key1:s390x depends on libgpgme11 (>= 1.4.1). 160s libjcat1:s390x depends on libgpgme11 (>= 1.2.0). 160s 160s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52172 files and directories currently installed.) 160s Removing libgpgme11:s390x (1.18.0-4ubuntu1) ... 161s Selecting previously unselected package libgpgme11t64:s390x. 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52166 files and directories currently installed.) 161s Preparing to unpack .../00-libgpgme11t64_1.18.0-4.1ubuntu3_s390x.deb ... 161s Unpacking libgpgme11t64:s390x (1.18.0-4.1ubuntu3) ... 161s Preparing to unpack .../01-libvolume-key1_0.3.12-7build1_s390x.deb ... 161s Unpacking libvolume-key1:s390x (0.3.12-7build1) over (0.3.12-5build2) ... 161s Preparing to unpack .../02-libqrtr-glib0_1.2.2-1ubuntu3_s390x.deb ... 161s Unpacking libqrtr-glib0:s390x (1.2.2-1ubuntu3) over (1.2.2-1ubuntu2) ... 161s Preparing to unpack .../03-libqmi-glib5_1.35.2-0ubuntu1_s390x.deb ... 161s Unpacking libqmi-glib5:s390x (1.35.2-0ubuntu1) over (1.34.0-2) ... 161s Preparing to unpack .../04-libqmi-proxy_1.35.2-0ubuntu1_s390x.deb ... 161s Unpacking libqmi-proxy (1.35.2-0ubuntu1) over (1.34.0-2) ... 161s Preparing to unpack .../05-libpolkit-agent-1-0_124-1ubuntu1_s390x.deb ... 161s Unpacking libpolkit-agent-1-0:s390x (124-1ubuntu1) over (124-1) ... 161s Preparing to unpack .../06-libpolkit-gobject-1-0_124-1ubuntu1_s390x.deb ... 161s Unpacking libpolkit-gobject-1-0:s390x (124-1ubuntu1) over (124-1) ... 161s Preparing to unpack .../07-libmm-glib0_1.23.4-0ubuntu1_s390x.deb ... 161s Unpacking libmm-glib0:s390x (1.23.4-0ubuntu1) over (1.22.0-3) ... 161s Preparing to unpack .../08-libmbim-glib4_1.31.2-0ubuntu2_s390x.deb ... 161s Unpacking libmbim-glib4:s390x (1.31.2-0ubuntu2) over (1.30.0-1) ... 161s Preparing to unpack .../09-libmbim-proxy_1.31.2-0ubuntu2_s390x.deb ... 161s Unpacking libmbim-proxy (1.31.2-0ubuntu2) over (1.30.0-1) ... 161s Preparing to unpack .../10-libjson-glib-1.0-common_1.8.0-2build1_all.deb ... 161s Unpacking libjson-glib-1.0-common (1.8.0-2build1) over (1.8.0-2) ... 161s Preparing to unpack .../11-libjson-glib-1.0-0_1.8.0-2build1_s390x.deb ... 161s Unpacking libjson-glib-1.0-0:s390x (1.8.0-2build1) over (1.8.0-2) ... 161s Preparing to unpack .../12-libgusb2_0.4.8-1build1_s390x.deb ... 161s Unpacking libgusb2:s390x (0.4.8-1build1) over (0.4.8-1) ... 161s Preparing to unpack .../13-libgudev-1.0-0_1%3a238-3ubuntu2_s390x.deb ... 161s Unpacking libgudev-1.0-0:s390x (1:238-3ubuntu2) over (1:238-3) ... 161s dpkg: libarchive13:s390x: dependency problems, but removing anyway as you requested: 161s fwupd depends on libarchive13 (>= 3.2.1). 161s 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52173 files and directories currently installed.) 161s Removing libarchive13:s390x (3.7.2-1ubuntu2) ... 161s Selecting previously unselected package libarchive13t64:s390x. 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 161s Preparing to unpack .../libarchive13t64_3.7.2-1.1ubuntu2_s390x.deb ... 161s Unpacking libarchive13t64:s390x (3.7.2-1.1ubuntu2) ... 161s Preparing to unpack .../fwupd_1.9.15-2_s390x.deb ... 161s Unpacking fwupd (1.9.15-2) over (1.9.14-1) ... 161s dpkg: libcurl3-gnutls:s390x: dependency problems, but removing anyway as you requested: 161s libfwupd2:s390x depends on libcurl3-gnutls (>= 7.63.0). 161s 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52174 files and directories currently installed.) 161s Removing libcurl3-gnutls:s390x (8.5.0-2ubuntu2) ... 161s Selecting previously unselected package libcurl3t64-gnutls:s390x. 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 161s Preparing to unpack .../0-libcurl3t64-gnutls_8.5.0-2ubuntu8_s390x.deb ... 161s Unpacking libcurl3t64-gnutls:s390x (8.5.0-2ubuntu8) ... 161s Preparing to unpack .../1-libfwupd2_1.9.15-2_s390x.deb ... 161s Unpacking libfwupd2:s390x (1.9.15-2) over (1.9.14-1) ... 161s Preparing to unpack .../2-libblockdev3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s Preparing to unpack .../3-libblockdev-utils3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev-utils3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s Preparing to unpack .../4-libblockdev-swap3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev-swap3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s Preparing to unpack .../5-libblockdev-part3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev-part3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s dpkg: libnvme1: dependency problems, but removing anyway as you requested: 161s libblockdev-nvme3:s390x depends on libnvme1 (>= 1.7.1). 161s 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52174 files and directories currently installed.) 161s Removing libnvme1 (1.8-2) ... 161s Selecting previously unselected package libnvme1t64. 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52167 files and directories currently installed.) 161s Preparing to unpack .../0-libnvme1t64_1.8-3_s390x.deb ... 161s Unpacking libnvme1t64 (1.8-3) ... 161s Preparing to unpack .../1-libblockdev-nvme3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev-nvme3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s Preparing to unpack .../2-libblockdev-mdraid3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev-mdraid3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s Preparing to unpack .../3-libblockdev-loop3_3.1.0-1build1_s390x.deb ... 161s Unpacking libblockdev-loop3:s390x (3.1.0-1build1) over (3.1.0-1) ... 161s Preparing to unpack .../4-e2fsprogs-l10n_1.47.0-2.4~exp1ubuntu2_all.deb ... 161s Unpacking e2fsprogs-l10n (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 161s Preparing to unpack .../5-logsave_1.47.0-2.4~exp1ubuntu2_s390x.deb ... 161s Unpacking logsave (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 161s dpkg: libext2fs2:s390x: dependency problems, but removing anyway as you requested: 161s libblockdev-fs3:s390x depends on libext2fs2 (>= 1.42.11). 161s e2fsprogs depends on libext2fs2 (= 1.47.0-2ubuntu1). 161s btrfs-progs depends on libext2fs2 (>= 1.42). 161s 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52175 files and directories currently installed.) 161s Removing libext2fs2:s390x (1.47.0-2ubuntu1) ... 161s Selecting previously unselected package libext2fs2t64:s390x. 161s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52168 files and directories currently installed.) 161s Preparing to unpack .../libext2fs2t64_1.47.0-2.4~exp1ubuntu2_s390x.deb ... 161s Adding 'diversion of /lib/s390x-linux-gnu/libe2p.so.2 to /lib/s390x-linux-gnu/libe2p.so.2.usr-is-merged by libext2fs2t64' 161s Adding 'diversion of /lib/s390x-linux-gnu/libe2p.so.2.3 to /lib/s390x-linux-gnu/libe2p.so.2.3.usr-is-merged by libext2fs2t64' 161s Adding 'diversion of /lib/s390x-linux-gnu/libext2fs.so.2 to /lib/s390x-linux-gnu/libext2fs.so.2.usr-is-merged by libext2fs2t64' 161s Adding 'diversion of /lib/s390x-linux-gnu/libext2fs.so.2.4 to /lib/s390x-linux-gnu/libext2fs.so.2.4.usr-is-merged by libext2fs2t64' 161s Unpacking libext2fs2t64:s390x (1.47.0-2.4~exp1ubuntu2) ... 161s Setting up libcom-err2:s390x (1.47.0-2.4~exp1ubuntu2) ... 161s Setting up libext2fs2t64:s390x (1.47.0-2.4~exp1ubuntu2) ... 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52184 files and directories currently installed.) 162s Preparing to unpack .../e2fsprogs_1.47.0-2.4~exp1ubuntu2_s390x.deb ... 162s Unpacking e2fsprogs (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 162s dpkg: libreiserfscore0: dependency problems, but removing anyway as you requested: 162s btrfs-progs depends on libreiserfscore0 (>= 1:3.6.27). 162s 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52184 files and directories currently installed.) 162s Removing libreiserfscore0 (1:3.6.27-7) ... 162s Selecting previously unselected package libreiserfscore0t64. 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52179 files and directories currently installed.) 162s Preparing to unpack .../libreiserfscore0t64_1%3a3.6.27-7.1_s390x.deb ... 162s Unpacking libreiserfscore0t64 (1:3.6.27-7.1) ... 162s Preparing to unpack .../btrfs-progs_6.6.3-1.1build1_s390x.deb ... 162s Unpacking btrfs-progs (6.6.3-1.1build1) over (6.6.3-1.1) ... 162s Preparing to unpack .../libblockdev-fs3_3.1.0-1build1_s390x.deb ... 162s Unpacking libblockdev-fs3:s390x (3.1.0-1build1) over (3.1.0-1) ... 162s Preparing to unpack .../libblockdev-crypto3_3.1.0-1build1_s390x.deb ... 162s Unpacking libblockdev-crypto3:s390x (3.1.0-1build1) over (3.1.0-1) ... 162s Preparing to unpack .../bolt_0.9.6-2build1_s390x.deb ... 162s Unpacking bolt (0.9.6-2build1) over (0.9.6-2) ... 162s dpkg: libglib2.0-0:s390x: dependency problems, but removing anyway as you requested: 162s s390-tools depends on libglib2.0-0 (>= 2.77.0). 162s libnetplan0:s390x depends on libglib2.0-0 (>= 2.75.3). 162s libjcat1:s390x depends on libglib2.0-0 (>= 2.75.3). 162s 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52185 files and directories currently installed.) 162s Removing libglib2.0-0:s390x (2.79.2-1~ubuntu1) ... 162s Selecting previously unselected package libglib2.0-0t64:s390x. 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52160 files and directories currently installed.) 162s Preparing to unpack .../0-libglib2.0-0t64_2.79.3-3ubuntu5_s390x.deb ... 162s libglib2.0-0t64.preinst: Removing /var/lib/dpkg/info/libglib2.0-0:s390x.postrm to avoid loss of /usr/share/glib-2.0/schemas/gschemas.compiled... 162s removed '/var/lib/dpkg/info/libglib2.0-0:s390x.postrm' 162s Unpacking libglib2.0-0t64:s390x (2.79.3-3ubuntu5) ... 162s Preparing to unpack .../1-libjcat1_0.2.0-2build2_s390x.deb ... 162s Unpacking libjcat1:s390x (0.2.0-2build2) over (0.2.0-2) ... 162s Preparing to unpack .../2-libldap2_2.6.7+dfsg-1~exp1ubuntu6_s390x.deb ... 162s Unpacking libldap2:s390x (2.6.7+dfsg-1~exp1ubuntu6) over (2.6.7+dfsg-1~exp1ubuntu1) ... 162s Preparing to unpack .../3-ubuntu-pro-client-l10n_31.2.2_s390x.deb ... 162s Unpacking ubuntu-pro-client-l10n (31.2.2) over (31.1) ... 162s Preparing to unpack .../4-ubuntu-pro-client_31.2.2_s390x.deb ... 162s Unpacking ubuntu-pro-client (31.2.2) over (31.1) ... 162s Preparing to unpack .../5-gnupg-utils_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking gnupg-utils (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Preparing to unpack .../6-keyboxd_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking keyboxd (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s dpkg: libnpth0:s390x: dependency problems, but removing anyway as you requested: 162s gpgv depends on libnpth0 (>= 0.90). 162s gpgsm depends on libnpth0 (>= 0.90). 162s gpg-agent depends on libnpth0 (>= 0.90). 162s gpg depends on libnpth0 (>= 0.90). 162s dirmngr depends on libnpth0 (>= 0.90). 162s 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52185 files and directories currently installed.) 162s Removing libnpth0:s390x (1.6-3build2) ... 162s Selecting previously unselected package libnpth0t64:s390x. 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52180 files and directories currently installed.) 162s Preparing to unpack .../libnpth0t64_1.6-3.1_s390x.deb ... 162s Unpacking libnpth0t64:s390x (1.6-3.1) ... 162s Setting up libnpth0t64:s390x (1.6-3.1) ... 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52186 files and directories currently installed.) 162s Preparing to unpack .../gpgv_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking gpgv (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Setting up gpgv (2.4.4-2ubuntu15) ... 162s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52186 files and directories currently installed.) 162s Preparing to unpack .../0-gpg-wks-client_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking gpg-wks-client (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Preparing to unpack .../1-gpg-agent_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking gpg-agent (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Preparing to unpack .../2-gpg_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking gpg (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Preparing to unpack .../3-dirmngr_2.4.4-2ubuntu15_s390x.deb ... 162s Unpacking dirmngr (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Preparing to unpack .../4-gnupg_2.4.4-2ubuntu15_all.deb ... 162s Unpacking gnupg (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 162s Preparing to unpack .../5-python3-apt_2.7.7_s390x.deb ... 163s Unpacking python3-apt (2.7.7) over (2.7.6) ... 163s Preparing to unpack .../6-apt-utils_2.7.14_s390x.deb ... 163s Unpacking apt-utils (2.7.14) over (2.7.12) ... 163s dpkg: libapt-pkg6.0:s390x: dependency problems, but removing anyway as you requested: 163s apt depends on libapt-pkg6.0 (>= 2.7.12). 163s 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52184 files and directories currently installed.) 163s Removing libapt-pkg6.0:s390x (2.7.12) ... 163s dpkg: libnettle8:s390x: dependency problems, but removing anyway as you requested: 163s libhogweed6:s390x depends on libnettle8. 163s libgnutls30:s390x depends on libnettle8 (>= 3.9~). 163s 163s Removing libnettle8:s390x (3.9.1-2) ... 163s Selecting previously unselected package libapt-pkg6.0t64:s390x. 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52128 files and directories currently installed.) 163s Preparing to unpack .../libapt-pkg6.0t64_2.7.14_s390x.deb ... 163s Unpacking libapt-pkg6.0t64:s390x (2.7.14) ... 163s Setting up libapt-pkg6.0t64:s390x (2.7.14) ... 163s Selecting previously unselected package libnettle8t64:s390x. 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52178 files and directories currently installed.) 163s Preparing to unpack .../libnettle8t64_3.9.1-2.2_s390x.deb ... 163s Unpacking libnettle8t64:s390x (3.9.1-2.2) ... 163s Setting up libnettle8t64:s390x (3.9.1-2.2) ... 163s dpkg: libhogweed6:s390x: dependency problems, but removing anyway as you requested: 163s libgnutls30:s390x depends on libhogweed6 (>= 3.6). 163s 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52186 files and directories currently installed.) 163s Removing libhogweed6:s390x (3.9.1-2) ... 163s Selecting previously unselected package libhogweed6t64:s390x. 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52181 files and directories currently installed.) 163s Preparing to unpack .../libhogweed6t64_3.9.1-2.2_s390x.deb ... 163s Unpacking libhogweed6t64:s390x (3.9.1-2.2) ... 163s Setting up libhogweed6t64:s390x (3.9.1-2.2) ... 163s dpkg: libgnutls30:s390x: dependency problems, but removing anyway as you requested: 163s apt depends on libgnutls30 (>= 3.8.1). 163s 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52187 files and directories currently installed.) 163s Removing libgnutls30:s390x (3.8.3-1ubuntu1) ... 163s Selecting previously unselected package libgnutls30t64:s390x. 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52178 files and directories currently installed.) 163s Preparing to unpack .../libgnutls30t64_3.8.3-1.1ubuntu2_s390x.deb ... 163s Unpacking libgnutls30t64:s390x (3.8.3-1.1ubuntu2) ... 163s Setting up libgnutls30t64:s390x (3.8.3-1.1ubuntu2) ... 163s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52206 files and directories currently installed.) 163s Preparing to unpack .../archives/apt_2.7.14_s390x.deb ... 163s Unpacking apt (2.7.14) over (2.7.12) ... 163s Setting up apt (2.7.14) ... 164s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52206 files and directories currently installed.) 164s Preparing to unpack .../gpgconf_2.4.4-2ubuntu15_s390x.deb ... 164s Unpacking gpgconf (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 164s Preparing to unpack .../gpgsm_2.4.4-2ubuntu15_s390x.deb ... 164s Unpacking gpgsm (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 164s dpkg: libreadline8:s390x: dependency problems, but removing anyway as you requested: 164s libpython3.12-stdlib:s390x depends on libreadline8 (>= 7.0~beta). 164s gawk depends on libreadline8 (>= 6.0). 164s fdisk depends on libreadline8 (>= 6.0). 164s 164s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52206 files and directories currently installed.) 164s Removing libreadline8:s390x (8.2-3) ... 164s Selecting previously unselected package libreadline8t64:s390x. 164s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52194 files and directories currently installed.) 164s Preparing to unpack .../libreadline8t64_8.2-4_s390x.deb ... 164s Adding 'diversion of /lib/s390x-linux-gnu/libhistory.so.8 to /lib/s390x-linux-gnu/libhistory.so.8.usr-is-merged by libreadline8t64' 164s Adding 'diversion of /lib/s390x-linux-gnu/libhistory.so.8.2 to /lib/s390x-linux-gnu/libhistory.so.8.2.usr-is-merged by libreadline8t64' 164s Adding 'diversion of /lib/s390x-linux-gnu/libreadline.so.8 to /lib/s390x-linux-gnu/libreadline.so.8.usr-is-merged by libreadline8t64' 164s Adding 'diversion of /lib/s390x-linux-gnu/libreadline.so.8.2 to /lib/s390x-linux-gnu/libreadline.so.8.2.usr-is-merged by libreadline8t64' 164s Unpacking libreadline8t64:s390x (8.2-4) ... 164s Setting up libreadline8t64:s390x (8.2-4) ... 164s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52214 files and directories currently installed.) 164s Preparing to unpack .../gawk_1%3a5.2.1-2build2_s390x.deb ... 164s Unpacking gawk (1:5.2.1-2build2) over (1:5.2.1-2) ... 164s Preparing to unpack .../fdisk_2.39.3-9ubuntu2_s390x.deb ... 164s Unpacking fdisk (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 164s Preparing to unpack .../libpython3.12-stdlib_3.12.2-4build3_s390x.deb ... 164s Unpacking libpython3.12-stdlib:s390x (3.12.2-4build3) over (3.12.2-1) ... 164s Preparing to unpack .../perl-base_5.38.2-3.2_s390x.deb ... 164s Unpacking perl-base (5.38.2-3.2) over (5.38.2-3) ... 164s Setting up perl-base (5.38.2-3.2) ... 164s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52212 files and directories currently installed.) 164s Preparing to unpack .../perl-modules-5.38_5.38.2-3.2_all.deb ... 164s Unpacking perl-modules-5.38 (5.38.2-3.2) over (5.38.2-3) ... 165s Preparing to unpack .../python3-gdbm_3.12.2-3ubuntu1.1_s390x.deb ... 165s Unpacking python3-gdbm:s390x (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 165s Preparing to unpack .../man-db_2.12.0-3build4_s390x.deb ... 165s Unpacking man-db (2.12.0-3build4) over (2.12.0-3) ... 165s dpkg: libgdbm-compat4:s390x: dependency problems, but removing anyway as you requested: 165s libperl5.38:s390x depends on libgdbm-compat4 (>= 1.18-3). 165s 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52212 files and directories currently installed.) 165s Removing libgdbm-compat4:s390x (1.23-5) ... 165s dpkg: libgdbm6:s390x: dependency problems, but removing anyway as you requested: 165s libperl5.38:s390x depends on libgdbm6 (>= 1.21). 165s 165s Removing libgdbm6:s390x (1.23-5) ... 165s Selecting previously unselected package libgdbm6t64:s390x. 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52202 files and directories currently installed.) 165s Preparing to unpack .../libgdbm6t64_1.23-5.1_s390x.deb ... 165s Unpacking libgdbm6t64:s390x (1.23-5.1) ... 165s Selecting previously unselected package libgdbm-compat4t64:s390x. 165s Preparing to unpack .../libgdbm-compat4t64_1.23-5.1_s390x.deb ... 165s Unpacking libgdbm-compat4t64:s390x (1.23-5.1) ... 165s dpkg: libperl5.38:s390x: dependency problems, but removing anyway as you requested: 165s perl depends on libperl5.38 (= 5.38.2-3). 165s 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52214 files and directories currently installed.) 165s Removing libperl5.38:s390x (5.38.2-3) ... 165s Selecting previously unselected package libperl5.38t64:s390x. 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 51692 files and directories currently installed.) 165s Preparing to unpack .../libperl5.38t64_5.38.2-3.2_s390x.deb ... 165s Unpacking libperl5.38t64:s390x (5.38.2-3.2) ... 165s Preparing to unpack .../perl_5.38.2-3.2_s390x.deb ... 165s Unpacking perl (5.38.2-3.2) over (5.38.2-3) ... 165s dpkg: libdb5.3:s390x: dependency problems, but removing anyway as you requested: 165s libsasl2-modules-db:s390x depends on libdb5.3. 165s libpam-modules:s390x depends on libdb5.3. 165s iproute2 depends on libdb5.3. 165s 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52214 files and directories currently installed.) 165s Removing libdb5.3:s390x (5.3.28+dfsg2-4) ... 165s Selecting previously unselected package libdb5.3t64:s390x. 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52208 files and directories currently installed.) 165s Preparing to unpack .../0-libdb5.3t64_5.3.28+dfsg2-6_s390x.deb ... 165s Unpacking libdb5.3t64:s390x (5.3.28+dfsg2-6) ... 165s Preparing to unpack .../1-libsasl2-modules-db_2.1.28+dfsg1-5ubuntu1_s390x.deb ... 165s Unpacking libsasl2-modules-db:s390x (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 165s Preparing to unpack .../2-libsasl2-2_2.1.28+dfsg1-5ubuntu1_s390x.deb ... 165s Unpacking libsasl2-2:s390x (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 165s Preparing to unpack .../3-libfido2-1_1.14.0-1build1_s390x.deb ... 165s Unpacking libfido2-1:s390x (1.14.0-1build1) over (1.14.0-1) ... 165s Preparing to unpack .../4-libcryptsetup12_2%3a2.7.0-1ubuntu2_s390x.deb ... 165s Unpacking libcryptsetup12:s390x (2:2.7.0-1ubuntu2) over (2:2.7.0-1ubuntu1) ... 165s Preparing to unpack .../5-dhcpcd-base_1%3a10.0.6-1ubuntu2_s390x.deb ... 165s Unpacking dhcpcd-base (1:10.0.6-1ubuntu2) over (1:10.0.6-1ubuntu1) ... 165s dpkg: libuv1:s390x: dependency problems, but removing anyway as you requested: 165s bind9-libs:s390x depends on libuv1 (>= 1.40.0). 165s 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52214 files and directories currently installed.) 165s Removing libuv1:s390x (1.48.0-1) ... 165s Selecting previously unselected package libuv1t64:s390x. 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52209 files and directories currently installed.) 165s Preparing to unpack .../libuv1t64_1.48.0-1.1_s390x.deb ... 165s Unpacking libuv1t64:s390x (1.48.0-1.1) ... 165s Preparing to unpack .../bind9-host_1%3a9.18.24-0ubuntu3_s390x.deb ... 165s Unpacking bind9-host (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 165s Preparing to unpack .../bind9-dnsutils_1%3a9.18.24-0ubuntu3_s390x.deb ... 165s Unpacking bind9-dnsutils (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 165s Preparing to unpack .../bind9-libs_1%3a9.18.24-0ubuntu3_s390x.deb ... 165s Unpacking bind9-libs:s390x (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 165s dpkg: libssl3:s390x: dependency problems, but removing anyway as you requested: 165s systemd depends on libssl3 (>= 3.0.0). 165s s390-tools depends on libssl3 (>= 3.0.0). 165s linux-headers-6.8.0-11-generic depends on libssl3 (>= 3.0.0). 165s 165s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 165s Removing libssl3:s390x (3.0.10-1ubuntu4) ... 165s Selecting previously unselected package libssl3t64:s390x. 166s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52204 files and directories currently installed.) 166s Preparing to unpack .../libssl3t64_3.0.13-0ubuntu2_s390x.deb ... 166s Unpacking libssl3t64:s390x (3.0.13-0ubuntu2) ... 166s Setting up libssl3t64:s390x (3.0.13-0ubuntu2) ... 166s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 166s Preparing to unpack .../libnss-systemd_255.4-1ubuntu5_s390x.deb ... 166s Unpacking libnss-systemd:s390x (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 166s Preparing to unpack .../libudev1_255.4-1ubuntu5_s390x.deb ... 166s Unpacking libudev1:s390x (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 166s Setting up libudev1:s390x (255.4-1ubuntu5) ... 166s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 166s Preparing to unpack .../systemd_255.4-1ubuntu5_s390x.deb ... 166s Unpacking systemd (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 166s Preparing to unpack .../udev_255.4-1ubuntu5_s390x.deb ... 166s Unpacking udev (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 166s Preparing to unpack .../libsystemd0_255.4-1ubuntu5_s390x.deb ... 166s Unpacking libsystemd0:s390x (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 166s Setting up libsystemd0:s390x (255.4-1ubuntu5) ... 166s Setting up libcryptsetup12:s390x (2:2.7.0-1ubuntu2) ... 166s Setting up libkmod2:s390x (31+20240202-2ubuntu4) ... 166s Setting up libsystemd-shared:s390x (255.4-1ubuntu5) ... 166s Setting up systemd-dev (255.4-1ubuntu5) ... 166s Setting up systemd (255.4-1ubuntu5) ... 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 167s Preparing to unpack .../systemd-sysv_255.4-1ubuntu5_s390x.deb ... 167s Unpacking systemd-sysv (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 167s Preparing to unpack .../libpam-systemd_255.4-1ubuntu5_s390x.deb ... 167s Unpacking libpam-systemd:s390x (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 167s Preparing to unpack .../libpam-modules-bin_1.5.3-5ubuntu3_s390x.deb ... 167s Unpacking libpam-modules-bin (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 167s Setting up libpam-modules-bin (1.5.3-5ubuntu3) ... 167s pam_namespace.service is a disabled or a static unit not running, not starting it. 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 167s Preparing to unpack .../libpam-modules_1.5.3-5ubuntu3_s390x.deb ... 167s Unpacking libpam-modules:s390x (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 167s Setting up libpam-modules:s390x (1.5.3-5ubuntu3) ... 167s Installing new version of config file /etc/security/namespace.init ... 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 167s Preparing to unpack .../libpam-runtime_1.5.3-5ubuntu3_all.deb ... 167s Unpacking libpam-runtime (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 167s Setting up libpam-runtime (1.5.3-5ubuntu3) ... 167s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 167s Preparing to unpack .../0-dbus-user-session_1.14.10-4ubuntu2_s390x.deb ... 167s Unpacking dbus-user-session (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 167s Preparing to unpack .../1-libapparmor1_4.0.0-beta3-0ubuntu2_s390x.deb ... 167s Unpacking libapparmor1:s390x (4.0.0-beta3-0ubuntu2) over (4.0.0~alpha4-0ubuntu1) ... 168s Preparing to unpack .../2-dbus-system-bus-common_1.14.10-4ubuntu2_all.deb ... 168s Unpacking dbus-system-bus-common (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 168s Preparing to unpack .../3-dbus-bin_1.14.10-4ubuntu2_s390x.deb ... 168s Unpacking dbus-bin (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 168s Preparing to unpack .../4-dbus_1.14.10-4ubuntu2_s390x.deb ... 168s Unpacking dbus (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 168s Preparing to unpack .../5-dbus-daemon_1.14.10-4ubuntu2_s390x.deb ... 168s Unpacking dbus-daemon (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 168s Preparing to unpack .../6-libdbus-1-3_1.14.10-4ubuntu2_s390x.deb ... 168s Unpacking libdbus-1-3:s390x (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 168s Preparing to unpack .../7-libmount1_2.39.3-9ubuntu2_s390x.deb ... 168s Unpacking libmount1:s390x (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 168s Setting up libmount1:s390x (2.39.3-9ubuntu2) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 168s Preparing to unpack .../libseccomp2_2.5.5-1ubuntu2_s390x.deb ... 168s Unpacking libseccomp2:s390x (2.5.5-1ubuntu2) over (2.5.5-1ubuntu1) ... 168s Setting up libseccomp2:s390x (2.5.5-1ubuntu2) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 168s Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.185-3ubuntu2_s390x.deb ... 168s Unpacking libdevmapper1.02.1:s390x (2:1.02.185-3ubuntu2) over (2:1.02.185-3ubuntu1) ... 168s Preparing to unpack .../libuuid1_2.39.3-9ubuntu2_s390x.deb ... 168s Unpacking libuuid1:s390x (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 168s Setting up libuuid1:s390x (2.39.3-9ubuntu2) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 168s Preparing to unpack .../libfdisk1_2.39.3-9ubuntu2_s390x.deb ... 168s Unpacking libfdisk1:s390x (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 168s Preparing to unpack .../mount_2.39.3-9ubuntu2_s390x.deb ... 168s Unpacking mount (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 168s Preparing to unpack .../libsqlite3-0_3.45.1-1ubuntu1_s390x.deb ... 168s Unpacking libsqlite3-0:s390x (3.45.1-1ubuntu1) over (3.45.1-1) ... 168s Preparing to unpack .../gcc-14-base_14-20240315-1ubuntu1_s390x.deb ... 168s Unpacking gcc-14-base:s390x (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 168s Setting up gcc-14-base:s390x (14-20240315-1ubuntu1) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 168s Preparing to unpack .../libgcc-s1_14-20240315-1ubuntu1_s390x.deb ... 168s Unpacking libgcc-s1:s390x (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 168s Setting up libgcc-s1:s390x (14-20240315-1ubuntu1) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 168s Preparing to unpack .../libstdc++6_14-20240315-1ubuntu1_s390x.deb ... 168s Unpacking libstdc++6:s390x (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 168s Setting up libstdc++6:s390x (14-20240315-1ubuntu1) ... 168s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 168s Preparing to unpack .../dpkg_1.22.6ubuntu5_s390x.deb ... 168s Unpacking dpkg (1.22.6ubuntu5) over (1.22.4ubuntu5) ... 168s Setting up dpkg (1.22.6ubuntu5) ... 169s Setting up libpython3.12-minimal:s390x (3.12.2-4build3) ... 169s Setting up python3.12-minimal (3.12.2-4build3) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 170s Preparing to unpack .../python3-minimal_3.12.2-0ubuntu1_s390x.deb ... 170s Unpacking python3-minimal (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 170s Setting up python3-minimal (3.12.2-0ubuntu1) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 170s Preparing to unpack .../python3_3.12.2-0ubuntu1_s390x.deb ... 170s Unpacking python3 (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 170s Preparing to unpack .../libpython3-stdlib_3.12.2-0ubuntu1_s390x.deb ... 170s Unpacking libpython3-stdlib:s390x (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 170s Preparing to unpack .../libsmartcols1_2.39.3-9ubuntu2_s390x.deb ... 170s Unpacking libsmartcols1:s390x (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 170s Setting up libsmartcols1:s390x (2.39.3-9ubuntu2) ... 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 170s Preparing to unpack .../0-bsdextrautils_2.39.3-9ubuntu2_s390x.deb ... 170s Unpacking bsdextrautils (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 170s Preparing to unpack .../1-groff-base_1.23.0-3build1_s390x.deb ... 170s Unpacking groff-base (1.23.0-3build1) over (1.23.0-3) ... 170s Preparing to unpack .../2-pinentry-curses_1.2.1-3ubuntu4_s390x.deb ... 170s Unpacking pinentry-curses (1.2.1-3ubuntu4) over (1.2.1-3ubuntu1) ... 170s Preparing to unpack .../3-readline-common_8.2-4_all.deb ... 170s Unpacking readline-common (8.2-4) over (8.2-3) ... 170s Preparing to unpack .../4-libxml2_2.9.14+dfsg-1.3ubuntu2_s390x.deb ... 170s Unpacking libxml2:s390x (2.9.14+dfsg-1.3ubuntu2) over (2.9.14+dfsg-1.3ubuntu1) ... 170s Preparing to unpack .../5-libbpf1_1%3a1.3.0-2build1_s390x.deb ... 170s Unpacking libbpf1:s390x (1:1.3.0-2build1) over (1:1.3.0-2) ... 170s dpkg: libelf1:s390x: dependency problems, but removing anyway as you requested: 170s linux-headers-6.8.0-11-generic depends on libelf1 (>= 0.144). 170s iproute2 depends on libelf1 (>= 0.131). 170s 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 170s Removing libelf1:s390x (0.190-1) ... 170s Selecting previously unselected package libelf1t64:s390x. 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52210 files and directories currently installed.) 170s Preparing to unpack .../libelf1t64_0.190-1.1build2_s390x.deb ... 170s Unpacking libelf1t64:s390x (0.190-1.1build2) ... 170s Preparing to unpack .../libtirpc-common_1.3.4+ds-1.1_all.deb ... 170s Unpacking libtirpc-common (1.3.4+ds-1.1) over (1.3.4+ds-1build1) ... 170s Preparing to unpack .../lsof_4.95.0-1build2_s390x.deb ... 170s Unpacking lsof (4.95.0-1build2) over (4.95.0-1build1) ... 170s Preparing to unpack .../libnsl2_1.3.0-3build2_s390x.deb ... 170s Unpacking libnsl2:s390x (1.3.0-3build2) over (1.3.0-3) ... 170s dpkg: libtirpc3:s390x: dependency problems, but removing anyway as you requested: 170s iproute2 depends on libtirpc3 (>= 1.0.2). 170s 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 170s Removing libtirpc3:s390x (1.3.4+ds-1build1) ... 170s Selecting previously unselected package libtirpc3t64:s390x. 170s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52209 files and directories currently installed.) 170s Preparing to unpack .../0-libtirpc3t64_1.3.4+ds-1.1_s390x.deb ... 170s Adding 'diversion of /lib/s390x-linux-gnu/libtirpc.so.3 to /lib/s390x-linux-gnu/libtirpc.so.3.usr-is-merged by libtirpc3t64' 170s Adding 'diversion of /lib/s390x-linux-gnu/libtirpc.so.3.0.0 to /lib/s390x-linux-gnu/libtirpc.so.3.0.0.usr-is-merged by libtirpc3t64' 170s Unpacking libtirpc3t64:s390x (1.3.4+ds-1.1) ... 170s Preparing to unpack .../1-iproute2_6.1.0-1ubuntu5_s390x.deb ... 170s Unpacking iproute2 (6.1.0-1ubuntu5) over (6.1.0-1ubuntu2) ... 170s Preparing to unpack .../2-python3-yaml_6.0.1-2build1_s390x.deb ... 171s Unpacking python3-yaml (6.0.1-2build1) over (6.0.1-2) ... 171s Preparing to unpack .../3-libusb-1.0-0_2%3a1.0.27-1_s390x.deb ... 171s Unpacking libusb-1.0-0:s390x (2:1.0.27-1) over (2:1.0.26-1) ... 171s Preparing to unpack .../4-libprotobuf-c1_1.4.1-1ubuntu3_s390x.deb ... 171s Unpacking libprotobuf-c1:s390x (1.4.1-1ubuntu3) over (1.4.1-1ubuntu2) ... 171s Preparing to unpack .../5-libnghttp2-14_1.59.0-1build1_s390x.deb ... 171s Unpacking libnghttp2-14:s390x (1.59.0-1build1) over (1.59.0-1) ... 171s Preparing to unpack .../6-libproc2-0_2%3a4.0.4-4ubuntu2_s390x.deb ... 171s Unpacking libproc2-0:s390x (2:4.0.4-4ubuntu2) over (2:4.0.4-4ubuntu1) ... 171s Preparing to unpack .../7-procps_2%3a4.0.4-4ubuntu2_s390x.deb ... 171s Unpacking procps (2:4.0.4-4ubuntu2) over (2:4.0.4-4ubuntu1) ... 171s Preparing to unpack .../8-coreutils_9.4-3ubuntu3_s390x.deb ... 171s Unpacking coreutils (9.4-3ubuntu3) over (9.4-2ubuntu4) ... 171s Setting up coreutils (9.4-3ubuntu3) ... 171s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52220 files and directories currently installed.) 171s Preparing to unpack .../util-linux_2.39.3-9ubuntu2_s390x.deb ... 171s Unpacking util-linux (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 171s Setting up util-linux (2.39.3-9ubuntu2) ... 172s fstrim.service is a disabled or a static unit not running, not starting it. 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52220 files and directories currently installed.) 172s Removing libatm1:s390x (1:2.5.1-5) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 172s Preparing to unpack .../file_1%3a5.45-3_s390x.deb ... 172s Unpacking file (1:5.45-3) over (1:5.45-2) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52215 files and directories currently installed.) 172s Removing libmagic1:s390x (1:5.45-2) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52205 files and directories currently installed.) 172s Preparing to unpack .../libmagic-mgc_1%3a5.45-3_s390x.deb ... 172s Unpacking libmagic-mgc (1:5.45-3) over (1:5.45-2) ... 172s Selecting previously unselected package libmagic1t64:s390x. 172s Preparing to unpack .../libmagic1t64_1%3a5.45-3_s390x.deb ... 172s Unpacking libmagic1t64:s390x (1:5.45-3) ... 172s Preparing to unpack .../libplymouth5_24.004.60-1ubuntu6_s390x.deb ... 172s Unpacking libplymouth5:s390x (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52216 files and directories currently installed.) 172s Removing libpng16-16:s390x (1.6.43-1) ... 172s Selecting previously unselected package libpng16-16t64:s390x. 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52206 files and directories currently installed.) 172s Preparing to unpack .../libpng16-16t64_1.6.43-3_s390x.deb ... 172s Unpacking libpng16-16t64:s390x (1.6.43-3) ... 172s Preparing to unpack .../multipath-tools_0.9.4-5ubuntu6_s390x.deb ... 172s Unpacking multipath-tools (0.9.4-5ubuntu6) over (0.9.4-5ubuntu3) ... 172s dpkg: liburcu8:s390x: dependency problems, but removing anyway as you requested: 172s xfsprogs depends on liburcu8 (>= 0.13.0). 172s 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52216 files and directories currently installed.) 172s Removing liburcu8:s390x (0.14.0-3) ... 172s Selecting previously unselected package liburcu8t64:s390x. 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52197 files and directories currently installed.) 172s Preparing to unpack .../liburcu8t64_0.14.0-3.1_s390x.deb ... 172s Unpacking liburcu8t64:s390x (0.14.0-3.1) ... 172s Preparing to unpack .../liblocale-gettext-perl_1.07-6ubuntu4_s390x.deb ... 172s Unpacking liblocale-gettext-perl (1.07-6ubuntu4) over (1.07-6build1) ... 172s Preparing to unpack .../uuid-runtime_2.39.3-9ubuntu2_s390x.deb ... 172s Unpacking uuid-runtime (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 172s Preparing to unpack .../libdebconfclient0_0.271ubuntu2_s390x.deb ... 172s Unpacking libdebconfclient0:s390x (0.271ubuntu2) over (0.271ubuntu1) ... 172s Setting up libdebconfclient0:s390x (0.271ubuntu2) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 172s Preparing to unpack .../libsemanage-common_3.5-1build4_all.deb ... 172s Unpacking libsemanage-common (3.5-1build4) over (3.5-1build2) ... 172s Setting up libsemanage-common (3.5-1build4) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 172s Preparing to unpack .../libsemanage2_3.5-1build4_s390x.deb ... 172s Unpacking libsemanage2:s390x (3.5-1build4) over (3.5-1build2) ... 172s Setting up libsemanage2:s390x (3.5-1build4) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 172s Preparing to unpack .../install-info_7.1-3build1_s390x.deb ... 172s Unpacking install-info (7.1-3build1) over (7.1-3) ... 172s Setting up install-info (7.1-3build1) ... 172s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52217 files and directories currently installed.) 172s Preparing to unpack .../00-gcc-13-base_13.2.0-21ubuntu1_s390x.deb ... 172s Unpacking gcc-13-base:s390x (13.2.0-21ubuntu1) over (13.2.0-17ubuntu2) ... 172s Preparing to unpack .../01-libss2_1.47.0-2.4~exp1ubuntu2_s390x.deb ... 172s Unpacking libss2:s390x (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 172s Preparing to unpack .../02-dmsetup_2%3a1.02.185-3ubuntu2_s390x.deb ... 172s Unpacking dmsetup (2:1.02.185-3ubuntu2) over (2:1.02.185-3ubuntu1) ... 172s Preparing to unpack .../03-eject_2.39.3-9ubuntu2_s390x.deb ... 172s Unpacking eject (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 173s Preparing to unpack .../04-krb5-locales_1.20.1-6ubuntu1_all.deb ... 173s Unpacking krb5-locales (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 173s Preparing to unpack .../05-libglib2.0-data_2.79.3-3ubuntu5_all.deb ... 173s Unpacking libglib2.0-data (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 173s Preparing to unpack .../06-libslang2_2.3.3-3build1_s390x.deb ... 173s Unpacking libslang2:s390x (2.3.3-3build1) over (2.3.3-3) ... 173s Preparing to unpack .../07-libtext-charwidth-perl_0.04-11build2_s390x.deb ... 173s Unpacking libtext-charwidth-perl:s390x (0.04-11build2) over (0.04-11build1) ... 173s Preparing to unpack .../08-libtext-iconv-perl_1.7-8build2_s390x.deb ... 173s Unpacking libtext-iconv-perl:s390x (1.7-8build2) over (1.7-8build1) ... 173s Preparing to unpack .../09-python-apt-common_2.7.7_all.deb ... 173s Unpacking python-apt-common (2.7.7) over (2.7.6) ... 173s Preparing to unpack .../10-python3-setuptools_68.1.2-2ubuntu1_all.deb ... 173s Unpacking python3-setuptools (68.1.2-2ubuntu1) over (68.1.2-2) ... 173s Preparing to unpack .../11-python3-pkg-resources_68.1.2-2ubuntu1_all.deb ... 173s Unpacking python3-pkg-resources (68.1.2-2ubuntu1) over (68.1.2-2) ... 173s Preparing to unpack .../12-rsyslog_8.2312.0-3ubuntu7_s390x.deb ... 173s Unpacking rsyslog (8.2312.0-3ubuntu7) over (8.2312.0-3ubuntu3) ... 173s Preparing to unpack .../13-vim-tiny_2%3a9.1.0016-1ubuntu6_s390x.deb ... 173s Unpacking vim-tiny (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 173s Preparing to unpack .../14-vim-common_2%3a9.1.0016-1ubuntu6_all.deb ... 173s Unpacking vim-common (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 173s Selecting previously unselected package xdg-user-dirs. 173s Preparing to unpack .../15-xdg-user-dirs_0.18-1_s390x.deb ... 173s Unpacking xdg-user-dirs (0.18-1) ... 173s Preparing to unpack .../16-xxd_2%3a9.1.0016-1ubuntu6_s390x.deb ... 173s Unpacking xxd (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 173s Preparing to unpack .../17-apparmor_4.0.0-beta3-0ubuntu2_s390x.deb ... 173s Unpacking apparmor (4.0.0-beta3-0ubuntu2) over (4.0.0~alpha4-0ubuntu1) ... 174s Preparing to unpack .../18-ftp_20230507-2build1_all.deb ... 174s Unpacking ftp (20230507-2build1) over (20230507-2) ... 174s Preparing to unpack .../19-inetutils-telnet_2%3a2.5-3ubuntu3_s390x.deb ... 174s Unpacking inetutils-telnet (2:2.5-3ubuntu3) over (2:2.5-3ubuntu1) ... 174s Preparing to unpack .../20-info_7.1-3build1_s390x.deb ... 174s Unpacking info (7.1-3build1) over (7.1-3) ... 174s Preparing to unpack .../21-libxmuu1_2%3a1.1.3-3build1_s390x.deb ... 174s Unpacking libxmuu1:s390x (2:1.1.3-3build1) over (2:1.1.3-3) ... 174s Preparing to unpack .../22-lshw_02.19.git.2021.06.19.996aaad9c7-2build2_s390x.deb ... 174s Unpacking lshw (02.19.git.2021.06.19.996aaad9c7-2build2) over (02.19.git.2021.06.19.996aaad9c7-2build1) ... 174s Selecting previously unselected package manpages. 174s Preparing to unpack .../23-manpages_6.05.01-1_all.deb ... 174s Unpacking manpages (6.05.01-1) ... 174s Preparing to unpack .../24-mtr-tiny_0.95-1.1build1_s390x.deb ... 174s Unpacking mtr-tiny (0.95-1.1build1) over (0.95-1.1) ... 174s Preparing to unpack .../25-plymouth-theme-ubuntu-text_24.004.60-1ubuntu6_s390x.deb ... 174s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 174s Preparing to unpack .../26-plymouth_24.004.60-1ubuntu6_s390x.deb ... 174s Unpacking plymouth (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 174s Preparing to unpack .../27-telnet_0.17+2.5-3ubuntu3_all.deb ... 174s Unpacking telnet (0.17+2.5-3ubuntu3) over (0.17+2.5-3ubuntu1) ... 174s Preparing to unpack .../28-usb.ids_2024.03.18-1_all.deb ... 174s Unpacking usb.ids (2024.03.18-1) over (2024.01.30-1) ... 174s Preparing to unpack .../29-xz-utils_5.6.0-0.2_s390x.deb ... 174s Unpacking xz-utils (5.6.0-0.2) over (5.4.5-0.3) ... 174s Selecting previously unselected package libllvm18:s390x. 174s Preparing to unpack .../30-libllvm18_1%3a18.1.2-1ubuntu2_s390x.deb ... 174s Unpacking libllvm18:s390x (1:18.1.2-1ubuntu2) ... 175s Selecting previously unselected package libclang-cpp18. 175s Preparing to unpack .../31-libclang-cpp18_1%3a18.1.2-1ubuntu2_s390x.deb ... 175s Unpacking libclang-cpp18 (1:18.1.2-1ubuntu2) ... 176s Selecting previously unselected package libbpfcc:s390x. 176s Preparing to unpack .../32-libbpfcc_0.29.1+ds-1ubuntu4_s390x.deb ... 176s Unpacking libbpfcc:s390x (0.29.1+ds-1ubuntu4) ... 176s Selecting previously unselected package python3-bpfcc. 176s Preparing to unpack .../33-python3-bpfcc_0.29.1+ds-1ubuntu4_all.deb ... 176s Unpacking python3-bpfcc (0.29.1+ds-1ubuntu4) ... 176s Selecting previously unselected package ieee-data. 176s Preparing to unpack .../34-ieee-data_20220827.1_all.deb ... 176s Unpacking ieee-data (20220827.1) ... 176s Selecting previously unselected package python3-netaddr. 176s Preparing to unpack .../35-python3-netaddr_0.8.0-2ubuntu1_all.deb ... 176s Unpacking python3-netaddr (0.8.0-2ubuntu1) ... 176s Selecting previously unselected package bpfcc-tools. 176s Preparing to unpack .../36-bpfcc-tools_0.29.1+ds-1ubuntu4_all.deb ... 176s Unpacking bpfcc-tools (0.29.1+ds-1ubuntu4) ... 176s Selecting previously unselected package libclang1-18. 176s Preparing to unpack .../37-libclang1-18_1%3a18.1.2-1ubuntu2_s390x.deb ... 176s Unpacking libclang1-18 (1:18.1.2-1ubuntu2) ... 176s Selecting previously unselected package libdw1t64:s390x. 176s Preparing to unpack .../38-libdw1t64_0.190-1.1build2_s390x.deb ... 176s Unpacking libdw1t64:s390x (0.190-1.1build2) ... 176s Selecting previously unselected package bpftrace. 176s Preparing to unpack .../39-bpftrace_0.20.2-1ubuntu1_s390x.deb ... 176s Unpacking bpftrace (0.20.2-1ubuntu1) ... 176s Preparing to unpack .../40-cryptsetup-bin_2%3a2.7.0-1ubuntu2_s390x.deb ... 176s Unpacking cryptsetup-bin (2:2.7.0-1ubuntu2) over (2:2.7.0-1ubuntu1) ... 176s Preparing to unpack .../41-dpkg-dev_1.22.6ubuntu5_all.deb ... 176s Unpacking dpkg-dev (1.22.6ubuntu5) over (1.22.4ubuntu5) ... 176s Preparing to unpack .../42-libdpkg-perl_1.22.6ubuntu5_all.deb ... 176s Unpacking libdpkg-perl (1.22.6ubuntu5) over (1.22.4ubuntu5) ... 176s Selecting previously unselected package fonts-dejavu-mono. 176s Preparing to unpack .../43-fonts-dejavu-mono_2.37-8_all.deb ... 176s Unpacking fonts-dejavu-mono (2.37-8) ... 176s Selecting previously unselected package fonts-dejavu-core. 176s Preparing to unpack .../44-fonts-dejavu-core_2.37-8_all.deb ... 176s Unpacking fonts-dejavu-core (2.37-8) ... 176s Selecting previously unselected package fontconfig-config. 176s Preparing to unpack .../45-fontconfig-config_2.15.0-1.1ubuntu1_s390x.deb ... 176s Unpacking fontconfig-config (2.15.0-1.1ubuntu1) ... 176s Preparing to unpack .../46-gnupg-l10n_2.4.4-2ubuntu15_all.deb ... 176s Unpacking gnupg-l10n (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 177s Selecting previously unselected package hwdata. 177s Preparing to unpack .../47-hwdata_0.379-1_all.deb ... 177s Unpacking hwdata (0.379-1) ... 177s Preparing to unpack .../48-libibverbs1_50.0-2build1_s390x.deb ... 177s Unpacking libibverbs1:s390x (50.0-2build1) over (50.0-2) ... 177s Preparing to unpack .../49-ibverbs-providers_50.0-2build1_s390x.deb ... 177s Unpacking ibverbs-providers:s390x (50.0-2build1) over (50.0-2) ... 177s Preparing to unpack .../50-jq_1.7.1-3_s390x.deb ... 177s Unpacking jq (1.7.1-3) over (1.7.1-2) ... 177s Preparing to unpack .../51-libjq1_1.7.1-3_s390x.deb ... 177s Unpacking libjq1:s390x (1.7.1-3) over (1.7.1-2) ... 177s Selecting previously unselected package libaio1t64:s390x. 177s Preparing to unpack .../52-libaio1t64_0.3.113-6_s390x.deb ... 177s Unpacking libaio1t64:s390x (0.3.113-6) ... 177s Selecting previously unselected package libatm1t64:s390x. 177s Preparing to unpack .../53-libatm1t64_1%3a2.5.1-5.1_s390x.deb ... 177s Unpacking libatm1t64:s390x (1:2.5.1-5.1) ... 177s Selecting previously unselected package libc-dev-bin. 177s Preparing to unpack .../54-libc-dev-bin_2.39-0ubuntu6_s390x.deb ... 177s Unpacking libc-dev-bin (2.39-0ubuntu6) ... 177s Selecting previously unselected package libfreetype6:s390x. 177s Preparing to unpack .../55-libfreetype6_2.13.2+dfsg-1build2_s390x.deb ... 177s Unpacking libfreetype6:s390x (2.13.2+dfsg-1build2) ... 177s Selecting previously unselected package libfontconfig1:s390x. 177s Preparing to unpack .../56-libfontconfig1_2.15.0-1.1ubuntu1_s390x.deb ... 177s Unpacking libfontconfig1:s390x (2.15.0-1.1ubuntu1) ... 177s Selecting previously unselected package libjpeg-turbo8:s390x. 177s Preparing to unpack .../57-libjpeg-turbo8_2.1.5-2ubuntu1_s390x.deb ... 177s Unpacking libjpeg-turbo8:s390x (2.1.5-2ubuntu1) ... 177s Selecting previously unselected package libjpeg8:s390x. 177s Preparing to unpack .../58-libjpeg8_8c-2ubuntu11_s390x.deb ... 177s Unpacking libjpeg8:s390x (8c-2ubuntu11) ... 177s Selecting previously unselected package libdeflate0:s390x. 177s Preparing to unpack .../59-libdeflate0_1.19-1_s390x.deb ... 177s Unpacking libdeflate0:s390x (1.19-1) ... 177s Selecting previously unselected package libjbig0:s390x. 177s Preparing to unpack .../60-libjbig0_2.1-6.1ubuntu1_s390x.deb ... 177s Unpacking libjbig0:s390x (2.1-6.1ubuntu1) ... 177s Selecting previously unselected package libsharpyuv0:s390x. 177s Preparing to unpack .../61-libsharpyuv0_1.3.2-0.4build2_s390x.deb ... 177s Unpacking libsharpyuv0:s390x (1.3.2-0.4build2) ... 177s Selecting previously unselected package libwebp7:s390x. 177s Preparing to unpack .../62-libwebp7_1.3.2-0.4build2_s390x.deb ... 177s Unpacking libwebp7:s390x (1.3.2-0.4build2) ... 177s Selecting previously unselected package libtiff6:s390x. 177s Preparing to unpack .../63-libtiff6_4.5.1+git230720-4ubuntu1_s390x.deb ... 177s Unpacking libtiff6:s390x (4.5.1+git230720-4ubuntu1) ... 177s Selecting previously unselected package libxpm4:s390x. 177s Preparing to unpack .../64-libxpm4_1%3a3.5.17-1build1_s390x.deb ... 177s Unpacking libxpm4:s390x (1:3.5.17-1build1) ... 177s Selecting previously unselected package libgd3:s390x. 177s Preparing to unpack .../65-libgd3_2.3.3-9ubuntu3_s390x.deb ... 177s Unpacking libgd3:s390x (2.3.3-9ubuntu3) ... 177s Selecting previously unselected package libc-devtools. 177s Preparing to unpack .../66-libc-devtools_2.39-0ubuntu6_s390x.deb ... 177s Unpacking libc-devtools (2.39-0ubuntu6) ... 177s Selecting previously unselected package linux-libc-dev:s390x. 177s Preparing to unpack .../67-linux-libc-dev_6.8.0-20.20_s390x.deb ... 177s Unpacking linux-libc-dev:s390x (6.8.0-20.20) ... 177s Selecting previously unselected package libcrypt-dev:s390x. 177s Preparing to unpack .../68-libcrypt-dev_1%3a4.4.36-4_s390x.deb ... 177s Unpacking libcrypt-dev:s390x (1:4.4.36-4) ... 177s Selecting previously unselected package rpcsvc-proto. 177s Preparing to unpack .../69-rpcsvc-proto_1.4.2-0ubuntu6_s390x.deb ... 177s Unpacking rpcsvc-proto (1.4.2-0ubuntu6) ... 177s Selecting previously unselected package libc6-dev:s390x. 177s Preparing to unpack .../70-libc6-dev_2.39-0ubuntu6_s390x.deb ... 177s Unpacking libc6-dev:s390x (2.39-0ubuntu6) ... 177s Preparing to unpack .../71-libevent-core-2.1-7_2.1.12-stable-9build1_s390x.deb ... 177s Unpacking libevent-core-2.1-7:s390x (2.1.12-stable-9build1) over (2.1.12-stable-9) ... 177s Preparing to unpack .../72-libftdi1-2_1.5-6build4_s390x.deb ... 177s Unpacking libftdi1-2:s390x (1.5-6build4) over (1.5-6build3) ... 177s Preparing to unpack .../73-libldap-common_2.6.7+dfsg-1~exp1ubuntu6_all.deb ... 177s Unpacking libldap-common (2.6.7+dfsg-1~exp1ubuntu6) over (2.6.7+dfsg-1~exp1ubuntu1) ... 177s Selecting previously unselected package linux-modules-6.8.0-20-generic. 177s Preparing to unpack .../74-linux-modules-6.8.0-20-generic_6.8.0-20.20_s390x.deb ... 177s Unpacking linux-modules-6.8.0-20-generic (6.8.0-20.20) ... 177s Selecting previously unselected package linux-image-6.8.0-20-generic. 177s Preparing to unpack .../75-linux-image-6.8.0-20-generic_6.8.0-20.20_s390x.deb ... 177s Unpacking linux-image-6.8.0-20-generic (6.8.0-20.20) ... 177s Selecting previously unselected package linux-modules-extra-6.8.0-20-generic. 177s Preparing to unpack .../76-linux-modules-extra-6.8.0-20-generic_6.8.0-20.20_s390x.deb ... 177s Unpacking linux-modules-extra-6.8.0-20-generic (6.8.0-20.20) ... 178s Preparing to unpack .../77-linux-generic_6.8.0-20.20+1_s390x.deb ... 178s Unpacking linux-generic (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 178s Preparing to unpack .../78-linux-image-generic_6.8.0-20.20+1_s390x.deb ... 178s Unpacking linux-image-generic (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 178s Preparing to unpack .../79-linux-virtual_6.8.0-20.20+1_s390x.deb ... 178s Unpacking linux-virtual (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 178s Preparing to unpack .../80-linux-image-virtual_6.8.0-20.20+1_s390x.deb ... 178s Unpacking linux-image-virtual (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 178s Preparing to unpack .../81-linux-headers-virtual_6.8.0-20.20+1_s390x.deb ... 178s Unpacking linux-headers-virtual (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 178s Selecting previously unselected package linux-headers-6.8.0-20. 178s Preparing to unpack .../82-linux-headers-6.8.0-20_6.8.0-20.20_all.deb ... 178s Unpacking linux-headers-6.8.0-20 (6.8.0-20.20) ... 180s Selecting previously unselected package linux-headers-6.8.0-20-generic. 180s Preparing to unpack .../83-linux-headers-6.8.0-20-generic_6.8.0-20.20_s390x.deb ... 180s Unpacking linux-headers-6.8.0-20-generic (6.8.0-20.20) ... 180s Preparing to unpack .../84-linux-headers-generic_6.8.0-20.20+1_s390x.deb ... 180s Unpacking linux-headers-generic (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 180s Selecting previously unselected package linux-tools-common. 180s Preparing to unpack .../85-linux-tools-common_6.8.0-20.20_all.deb ... 180s Unpacking linux-tools-common (6.8.0-20.20) ... 180s Selecting previously unselected package linux-tools-6.8.0-20. 180s Preparing to unpack .../86-linux-tools-6.8.0-20_6.8.0-20.20_s390x.deb ... 180s Unpacking linux-tools-6.8.0-20 (6.8.0-20.20) ... 180s Selecting previously unselected package linux-tools-6.8.0-20-generic. 180s Preparing to unpack .../87-linux-tools-6.8.0-20-generic_6.8.0-20.20_s390x.deb ... 180s Unpacking linux-tools-6.8.0-20-generic (6.8.0-20.20) ... 180s Selecting previously unselected package manpages-dev. 180s Preparing to unpack .../88-manpages-dev_6.05.01-1_all.deb ... 180s Unpacking manpages-dev (6.05.01-1) ... 181s Preparing to unpack .../89-python3-distutils_3.12.2-3ubuntu1.1_all.deb ... 181s Unpacking python3-distutils (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 181s Preparing to unpack .../90-python3-lib2to3_3.12.2-3ubuntu1.1_all.deb ... 181s Unpacking python3-lib2to3 (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 181s Preparing to unpack .../91-python3-pyrsistent_0.20.0-1build1_s390x.deb ... 181s Unpacking python3-pyrsistent:s390x (0.20.0-1build1) over (0.20.0-1) ... 181s Preparing to unpack .../92-python3-typing-extensions_4.10.0-1_all.deb ... 181s Unpacking python3-typing-extensions (4.10.0-1) over (4.9.0-1) ... 181s Preparing to unpack .../93-s390-tools-data_2.31.0-0ubuntu3_all.deb ... 181s Unpacking s390-tools-data (2.31.0-0ubuntu3) over (2.31.0-0ubuntu1) ... 181s Selecting previously unselected package ubuntu-kernel-accessories. 181s Preparing to unpack .../94-ubuntu-kernel-accessories_1.536build1_s390x.deb ... 181s Unpacking ubuntu-kernel-accessories (1.536build1) ... 181s Preparing to unpack .../95-kpartx_0.9.4-5ubuntu6_s390x.deb ... 181s Unpacking kpartx (0.9.4-5ubuntu6) over (0.9.4-5ubuntu3) ... 181s Setting up cryptsetup-bin (2:2.7.0-1ubuntu2) ... 181s Setting up pinentry-curses (1.2.1-3ubuntu4) ... 181s Setting up motd-news-config (13ubuntu8) ... 181s Setting up libtext-iconv-perl:s390x (1.7-8build2) ... 181s Setting up libtext-charwidth-perl:s390x (0.04-11build2) ... 181s Setting up libsharpyuv0:s390x (1.3.2-0.4build2) ... 181s Setting up liburcu8t64:s390x (0.14.0-3.1) ... 181s Setting up tcpdump (4.99.4-3ubuntu2) ... 181s Setting up libibverbs1:s390x (50.0-2build1) ... 181s Setting up systemd-sysv (255.4-1ubuntu5) ... 181s Setting up ubuntu-kernel-accessories (1.536build1) ... 181s Setting up libapparmor1:s390x (4.0.0-beta3-0ubuntu2) ... 181s Setting up libatm1t64:s390x (1:2.5.1-5.1) ... 181s Setting up libgdbm6t64:s390x (1.23-5.1) ... 181s Setting up bsdextrautils (2.39.3-9ubuntu2) ... 181s Setting up libxpm4:s390x (1:3.5.17-1build1) ... 181s Setting up libgdbm-compat4t64:s390x (1.23-5.1) ... 181s Setting up xdg-user-dirs (0.18-1) ... 181s Setting up ibverbs-providers:s390x (50.0-2build1) ... 181s Setting up linux-headers-6.8.0-20 (6.8.0-20.20) ... 181s Setting up libmagic-mgc (1:5.45-3) ... 181s Setting up gawk (1:5.2.1-2build2) ... 181s Setting up libjq1:s390x (1.7.1-3) ... 181s Setting up manpages (6.05.01-1) ... 181s Setting up libtirpc-common (1.3.4+ds-1.1) ... 181s Setting up libbrotli1:s390x (1.1.0-2build1) ... 181s Setting up libsqlite3-0:s390x (3.45.1-1ubuntu1) ... 181s Setting up libsasl2-modules:s390x (2.1.28+dfsg1-5ubuntu1) ... 181s Setting up libuv1t64:s390x (1.48.0-1.1) ... 181s Setting up libmagic1t64:s390x (1:5.45-3) ... 181s Setting up rsyslog (8.2312.0-3ubuntu7) ... 181s info: The user `syslog' is already a member of `adm'. 182s Setting up libpsl5t64:s390x (0.21.2-1.1) ... 182s Setting up libnghttp2-14:s390x (1.59.0-1build1) ... 182s Setting up libdeflate0:s390x (1.19-1) ... 182s Setting up linux-libc-dev:s390x (6.8.0-20.20) ... 182s Setting up libreiserfscore0t64 (1:3.6.27-7.1) ... 182s Setting up libnss-systemd:s390x (255.4-1ubuntu5) ... 182s Setting up krb5-locales (1.20.1-6ubuntu1) ... 182s Setting up file (1:5.45-3) ... 182s Setting up kmod (31+20240202-2ubuntu4) ... 182s Setting up lshw (02.19.git.2021.06.19.996aaad9c7-2build2) ... 182s Setting up libldap-common (2.6.7+dfsg-1~exp1ubuntu6) ... 182s Setting up libprotobuf-c1:s390x (1.4.1-1ubuntu3) ... 182s Setting up libjbig0:s390x (2.1-6.1ubuntu1) ... 182s Setting up xxd (2:9.1.0016-1ubuntu6) ... 182s Setting up libelf1t64:s390x (0.190-1.1build2) ... 182s Setting up libkrb5support0:s390x (1.20.1-6ubuntu1) ... 182s Setting up libdw1t64:s390x (0.190-1.1build2) ... 182s Setting up linux-headers-6.8.0-20-generic (6.8.0-20.20) ... 182s Setting up eject (2.39.3-9ubuntu2) ... 182s Setting up apparmor (4.0.0-beta3-0ubuntu2) ... 182s Installing new version of config file /etc/apparmor.d/abstractions/authentication ... 182s Installing new version of config file /etc/apparmor.d/abstractions/crypto ... 182s Installing new version of config file /etc/apparmor.d/abstractions/kde-open5 ... 182s Installing new version of config file /etc/apparmor.d/abstractions/openssl ... 182s Installing new version of config file /etc/apparmor.d/code ... 182s Installing new version of config file /etc/apparmor.d/firefox ... 183s Reloading AppArmor profiles 184s Setting up libglib2.0-0t64:s390x (2.79.3-3ubuntu5) ... 184s No schema files found: doing nothing. 184s Setting up libglib2.0-data (2.79.3-3ubuntu5) ... 184s Setting up rpcsvc-proto (1.4.2-0ubuntu6) ... 184s Setting up vim-common (2:9.1.0016-1ubuntu6) ... 184s Setting up gcc-13-base:s390x (13.2.0-21ubuntu1) ... 184s Setting up libqrtr-glib0:s390x (1.2.2-1ubuntu3) ... 184s Setting up libslang2:s390x (2.3.3-3build1) ... 184s Setting up libnvme1t64 (1.8-3) ... 184s Setting up mtr-tiny (0.95-1.1build1) ... 184s Setting up gnupg-l10n (2.4.4-2ubuntu15) ... 184s Setting up librtmp1:s390x (2.4+20151223.gitfa8646d.1-2build6) ... 184s Setting up libdbus-1-3:s390x (1.14.10-4ubuntu2) ... 184s Setting up xz-utils (5.6.0-0.2) ... 184s Setting up perl-modules-5.38 (5.38.2-3.2) ... 184s Setting up libproc2-0:s390x (2:4.0.4-4ubuntu2) ... 184s Setting up libblockdev-utils3:s390x (3.1.0-1build1) ... 184s Setting up fonts-dejavu-mono (2.37-8) ... 184s Setting up libpng16-16t64:s390x (1.6.43-3) ... 184s Setting up systemd-timesyncd (255.4-1ubuntu5) ... 184s Setting up libevent-core-2.1-7:s390x (2.1.12-stable-9build1) ... 184s Setting up udev (255.4-1ubuntu5) ... 185s Setting up libss2:s390x (1.47.0-2.4~exp1ubuntu2) ... 185s Setting up usb.ids (2024.03.18-1) ... 185s Setting up sudo (1.9.15p5-3ubuntu3) ... 185s Setting up fonts-dejavu-core (2.37-8) ... 185s Setting up dhcpcd-base (1:10.0.6-1ubuntu2) ... 185s Setting up gir1.2-glib-2.0:s390x (2.79.3-3ubuntu5) ... 185s Setting up libk5crypto3:s390x (1.20.1-6ubuntu1) ... 185s Setting up libjpeg-turbo8:s390x (2.1.5-2ubuntu1) ... 185s Setting up logsave (1.47.0-2.4~exp1ubuntu2) ... 185s Setting up libwebp7:s390x (1.3.2-0.4build2) ... 185s Setting up libfdisk1:s390x (2.39.3-9ubuntu2) ... 185s Setting up libdb5.3t64:s390x (5.3.28+dfsg2-6) ... 185s Setting up libblockdev-nvme3:s390x (3.1.0-1build1) ... 185s Setting up libdevmapper1.02.1:s390x (2:1.02.185-3ubuntu2) ... 185s Setting up libblockdev-fs3:s390x (3.1.0-1build1) ... 185s Setting up libaio1t64:s390x (0.3.113-6) ... 185s Setting up python-apt-common (2.7.7) ... 185s Setting up mount (2.39.3-9ubuntu2) ... 185s Setting up dmsetup (2:1.02.185-3ubuntu2) ... 185s Setting up uuid-runtime (2.39.3-9ubuntu2) ... 186s uuidd.service is a disabled or a static unit not running, not starting it. 186s Setting up libmm-glib0:s390x (1.23.4-0ubuntu1) ... 186s Setting up groff-base (1.23.0-3build1) ... 186s Setting up libcrypt-dev:s390x (1:4.4.36-4) ... 186s Setting up libplymouth5:s390x (24.004.60-1ubuntu6) ... 186s Setting up dbus-session-bus-common (1.14.10-4ubuntu2) ... 186s Setting up kpartx (0.9.4-5ubuntu6) ... 186s Setting up jq (1.7.1-3) ... 186s Setting up procps (2:4.0.4-4ubuntu2) ... 186s Setting up gpgconf (2.4.4-2ubuntu15) ... 186s Setting up libgirepository-1.0-1:s390x (1.79.1-1ubuntu6) ... 186s Setting up libjson-glib-1.0-common (1.8.0-2build1) ... 186s Setting up libkrb5-3:s390x (1.20.1-6ubuntu1) ... 186s Setting up libpython3.11-minimal:s390x (3.11.8-1build4) ... 186s Setting up libusb-1.0-0:s390x (2:1.0.27-1) ... 186s Setting up libperl5.38t64:s390x (5.38.2-3.2) ... 186s Setting up tnftp (20230507-2build1) ... 186s Setting up dbus-system-bus-common (1.14.10-4ubuntu2) ... 186s Setting up libfido2-1:s390x (1.14.0-1build1) ... 186s Setting up libc-dev-bin (2.39-0ubuntu6) ... 186s Setting up openssl (3.0.13-0ubuntu2) ... 186s Setting up linux-modules-6.8.0-20-generic (6.8.0-20.20) ... 187s Setting up readline-common (8.2-4) ... 187s Setting up libxml2:s390x (2.9.14+dfsg-1.3ubuntu2) ... 187s Setting up libxmuu1:s390x (2:1.1.3-3build1) ... 187s Setting up dbus-bin (1.14.10-4ubuntu2) ... 187s Setting up info (7.1-3build1) ... 187s Setting up liblocale-gettext-perl (1.07-6ubuntu4) ... 187s Setting up gpg (2.4.4-2ubuntu15) ... 187s Setting up libgudev-1.0-0:s390x (1:238-3ubuntu2) ... 187s Setting up libpolkit-gobject-1-0:s390x (124-1ubuntu1) ... 187s Setting up libbpf1:s390x (1:1.3.0-2build1) ... 187s Setting up libmbim-glib4:s390x (1.31.2-0ubuntu2) ... 187s Setting up rsync (3.2.7-1build1) ... 187s rsync.service is a disabled or a static unit not running, not starting it. 187s Setting up libudisks2-0:s390x (2.10.1-6) ... 187s Setting up bolt (0.9.6-2build1) ... 188s bolt.service is a disabled or a static unit not running, not starting it. 188s Setting up s390-tools-data (2.31.0-0ubuntu3) ... 188s Setting up libllvm18:s390x (1:18.1.2-1ubuntu2) ... 188s Setting up gnupg-utils (2.4.4-2ubuntu15) ... 188s Setting up initramfs-tools-bin (0.142ubuntu23) ... 188s Setting up libjpeg8:s390x (8c-2ubuntu11) ... 188s Setting up python3.11-minimal (3.11.8-1build4) ... 189s Setting up libclang1-18 (1:18.1.2-1ubuntu2) ... 189s Setting up manpages-dev (6.05.01-1) ... 189s Setting up linux-modules-extra-6.8.0-20-generic (6.8.0-20.20) ... 189s Setting up apt-utils (2.7.14) ... 189s Setting up gpg-agent (2.4.4-2ubuntu15) ... 189s Setting up libpython3.12-stdlib:s390x (3.12.2-4build3) ... 189s Setting up libblockdev-mdraid3:s390x (3.1.0-1build1) ... 189s Setting up wget (1.21.4-1ubuntu2) ... 189s Setting up linux-image-6.8.0-20-generic (6.8.0-20.20) ... 190s I: /boot/vmlinuz is now a symlink to vmlinuz-6.8.0-20-generic 190s I: /boot/initrd.img is now a symlink to initrd.img-6.8.0-20-generic 190s Setting up libblockdev-swap3:s390x (3.1.0-1build1) ... 190s Setting up plymouth (24.004.60-1ubuntu6) ... 190s update-initramfs: Generating /boot/initrd.img-6.8.0-11-generic 190s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 194s Not invoking zipl: initrd doesn't exist yet 194s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 194s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 194s Setting up fontconfig-config (2.15.0-1.1ubuntu1) ... 194s Setting up libxmlb2:s390x (0.3.15-1build1) ... 194s Setting up btrfs-progs (6.6.3-1.1build1) ... 194s Setting up libpython3.11-stdlib:s390x (3.11.8-1build4) ... 194s Setting up python3.12 (3.12.2-4build3) ... 195s Setting up libblockdev-loop3:s390x (3.1.0-1build1) ... 195s Setting up gpgsm (2.4.4-2ubuntu15) ... 195s Setting up inetutils-telnet (2:2.5-3ubuntu3) ... 195s Setting up e2fsprogs (1.47.0-2.4~exp1ubuntu2) ... 195s update-initramfs: deferring update (trigger activated) 196s e2scrub_all.service is a disabled or a static unit not running, not starting it. 196s Setting up libparted2t64:s390x (3.6-3.1build2) ... 196s Setting up linux-headers-generic (6.8.0-20.20+1) ... 196s Setting up dbus-daemon (1.14.10-4ubuntu2) ... 196s Setting up libmbim-proxy (1.31.2-0ubuntu2) ... 196s Setting up vim-tiny (2:9.1.0016-1ubuntu6) ... 196s Setting up libnetplan1:s390x (1.0-1) ... 196s Setting up man-db (2.12.0-3build4) ... 196s Updating database of manual pages ... 198s man-db.service is a disabled or a static unit not running, not starting it. 198s Setting up libblockdev3:s390x (3.1.0-1build1) ... 198s Setting up fdisk (2.39.3-9ubuntu2) ... 198s Setting up multipath-tools (0.9.4-5ubuntu6) ... 198s Setting up libjson-glib-1.0-0:s390x (1.8.0-2build1) ... 198s Setting up libblockdev-part3:s390x (3.1.0-1build1) ... 198s Setting up libsasl2-modules-db:s390x (2.1.28+dfsg1-5ubuntu1) ... 198s Setting up hwdata (0.379-1) ... 198s Setting up libftdi1-2:s390x (1.5-6build4) ... 198s Setting up perl (5.38.2-3.2) ... 198s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu6) ... 198s update-initramfs: deferring update (trigger activated) 198s Setting up libfreetype6:s390x (2.13.2+dfsg-1build2) ... 198s Setting up gir1.2-girepository-2.0:s390x (1.79.1-1ubuntu6) ... 198s Setting up dbus (1.14.10-4ubuntu2) ... 199s A reboot is required to replace the running dbus-daemon. 199s Please reboot the system when convenient. 199s Setting up shared-mime-info (2.4-1build1) ... 199s Setting up libgssapi-krb5-2:s390x (1.20.1-6ubuntu1) ... 199s Setting up ftp (20230507-2build1) ... 199s Setting up keyboxd (2.4.4-2ubuntu15) ... 199s Setting up libdpkg-perl (1.22.6ubuntu5) ... 199s Setting up libsasl2-2:s390x (2.1.28+dfsg1-5ubuntu1) ... 199s Setting up libssh-4:s390x (0.10.6-2build1) ... 199s Setting up ieee-data (20220827.1) ... 199s Setting up libtiff6:s390x (4.5.1+git230720-4ubuntu1) ... 199s Setting up libpam-systemd:s390x (255.4-1ubuntu5) ... 199s Setting up libpolkit-agent-1-0:s390x (124-1ubuntu1) ... 199s Setting up libc6-dev:s390x (2.39-0ubuntu6) ... 199s Setting up libgpgme11t64:s390x (1.18.0-4.1ubuntu3) ... 199s Setting up libfontconfig1:s390x (2.15.0-1.1ubuntu1) ... 199s Setting up linux-image-virtual (6.8.0-20.20+1) ... 199s Setting up netplan-generator (1.0-1) ... 199s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 199s Setting up initramfs-tools-core (0.142ubuntu23) ... 199s Setting up libclang-cpp18 (1:18.1.2-1ubuntu2) ... 199s Setting up libbpfcc:s390x (0.29.1+ds-1ubuntu4) ... 199s Setting up linux-tools-common (6.8.0-20.20) ... 199s Setting up libarchive13t64:s390x (3.7.2-1.1ubuntu2) ... 199s Setting up libldap2:s390x (2.6.7+dfsg-1~exp1ubuntu6) ... 199s Setting up libpython3-stdlib:s390x (3.12.2-0ubuntu1) ... 199s Setting up systemd-resolved (255.4-1ubuntu5) ... 200s Setting up python3.11 (3.11.8-1build4) ... 201s Setting up linux-image-generic (6.8.0-20.20+1) ... 201s Setting up telnet (0.17+2.5-3ubuntu3) ... 201s Setting up initramfs-tools (0.142ubuntu23) ... 201s update-initramfs: deferring update (trigger activated) 201s Setting up linux-headers-virtual (6.8.0-20.20+1) ... 201s Setting up linux-generic (6.8.0-20.20+1) ... 201s Setting up libcurl4t64:s390x (8.5.0-2ubuntu8) ... 201s Setting up bpftrace (0.20.2-1ubuntu1) ... 201s Setting up bind9-libs:s390x (1:9.18.24-0ubuntu3) ... 201s Setting up libtirpc3t64:s390x (1.3.4+ds-1.1) ... 201s Setting up e2fsprogs-l10n (1.47.0-2.4~exp1ubuntu2) ... 201s Setting up iproute2 (6.1.0-1ubuntu5) ... 201s Setting up openssh-client (1:9.6p1-3ubuntu11) ... 201s Setting up libgusb2:s390x (0.4.8-1build1) ... 201s Setting up libcurl3t64-gnutls:s390x (8.5.0-2ubuntu8) ... 201s Setting up parted (3.6-3.1build2) ... 201s Setting up libqmi-glib5:s390x (1.35.2-0ubuntu1) ... 201s Setting up linux-tools-6.8.0-20 (6.8.0-20.20) ... 201s Setting up python3 (3.12.2-0ubuntu1) ... 201s Setting up libjcat1:s390x (0.2.0-2build2) ... 201s Setting up dpkg-dev (1.22.6ubuntu5) ... 201s Setting up linux-virtual (6.8.0-20.20+1) ... 201s Setting up dirmngr (2.4.4-2ubuntu15) ... 202s Setting up dbus-user-session (1.14.10-4ubuntu2) ... 202s Setting up linux-tools-6.8.0-20-generic (6.8.0-20.20) ... 202s Setting up python3-cryptography (41.0.7-4build2) ... 202s Setting up python3-gi (3.47.0-3build1) ... 202s Setting up libgd3:s390x (2.3.3-9ubuntu3) ... 202s Setting up python3-typing-extensions (4.10.0-1) ... 202s Setting up lsof (4.95.0-1build2) ... 202s Setting up python3-pyrsistent:s390x (0.20.0-1build1) ... 202s Setting up python3-netaddr (0.8.0-2ubuntu1) ... 202s Setting up libnsl2:s390x (1.3.0-3build2) ... 202s Setting up gnupg (2.4.4-2ubuntu15) ... 202s Setting up python3-netplan (1.0-1) ... 202s Setting up curl (8.5.0-2ubuntu8) ... 202s Setting up libvolume-key1:s390x (0.3.12-7build1) ... 202s Setting up bind9-host (1:9.18.24-0ubuntu3) ... 202s Setting up python3-lib2to3 (3.12.2-3ubuntu1.1) ... 203s Setting up python3-bpfcc (0.29.1+ds-1ubuntu4) ... 203s Setting up libc-devtools (2.39-0ubuntu6) ... 203s Setting up python3-pkg-resources (68.1.2-2ubuntu1) ... 203s Setting up python3-distutils (3.12.2-3ubuntu1.1) ... 203s python3.12: can't get files for byte-compilation 203s Setting up openssh-sftp-server (1:9.6p1-3ubuntu11) ... 203s Setting up python3-dbus (1.3.2-5build2) ... 203s Setting up python3-setuptools (68.1.2-2ubuntu1) ... 204s Setting up gpg-wks-client (2.4.4-2ubuntu15) ... 204s Setting up openssh-server (1:9.6p1-3ubuntu11) ... 204s Replacing config file /etc/ssh/sshd_config with new version 206s Created symlink /etc/systemd/system/ssh.service.requires/ssh.socket → /usr/lib/systemd/system/ssh.socket. 207s Setting up libblockdev-crypto3:s390x (3.1.0-1build1) ... 207s Setting up python3-gdbm:s390x (3.12.2-3ubuntu1.1) ... 207s Setting up python3-apt (2.7.7) ... 207s Setting up libfwupd2:s390x (1.9.15-2) ... 207s Setting up python3-yaml (6.0.1-2build1) ... 207s Setting up libqmi-proxy (1.35.2-0ubuntu1) ... 207s Setting up netplan.io (1.0-1) ... 207s Setting up bpfcc-tools (0.29.1+ds-1ubuntu4) ... 207s Setting up bind9-dnsutils (1:9.18.24-0ubuntu3) ... 207s Setting up ubuntu-pro-client (31.2.2) ... 209s Setting up fwupd (1.9.15-2) ... 209s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 209s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 209s Setting up ubuntu-pro-client-l10n (31.2.2) ... 209s Setting up udisks2 (2.10.1-6) ... 210s Processing triggers for ufw (0.36.2-5) ... 210s Processing triggers for debianutils (5.17) ... 210s Processing triggers for install-info (7.1-3build1) ... 210s Processing triggers for libc-bin (2.39-0ubuntu6) ... 210s Processing triggers for linux-image-6.8.0-20-generic (6.8.0-20.20) ... 210s /etc/kernel/postinst.d/initramfs-tools: 210s update-initramfs: Generating /boot/initrd.img-6.8.0-20-generic 210s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 213s Using config file '/etc/zipl.conf' 213s Building bootmap in '/boot' 213s Adding IPL section 'ubuntu' (default) 213s Preparing boot device for LD-IPL: vda (0000). 213s Done. 214s /etc/kernel/postinst.d/zz-zipl: 214s Using config file '/etc/zipl.conf' 214s Building bootmap in '/boot' 214s Adding IPL section 'ubuntu' (default) 214s Preparing boot device for LD-IPL: vda (0000). 214s Done. 214s Processing triggers for initramfs-tools (0.142ubuntu23) ... 214s update-initramfs: Generating /boot/initrd.img-6.8.0-20-generic 214s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 217s Using config file '/etc/zipl.conf' 217s Building bootmap in '/boot' 217s Adding IPL section 'ubuntu' (default) 217s Preparing boot device for LD-IPL: vda (0000). 217s Done. 218s Reading package lists... 218s Building dependency tree... 218s Reading state information... 219s The following packages will be REMOVED: 219s libaio1* libnetplan0* python3-distutils* python3-lib2to3* 219s 0 upgraded, 0 newly installed, 4 to remove and 1 not upgraded. 219s After this operation, 1445 kB disk space will be freed. 219s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81786 files and directories currently installed.) 219s Removing libaio1:s390x (0.3.113-5) ... 219s Removing libnetplan0:s390x (0.107.1-3) ... 219s Removing python3-distutils (3.12.2-3ubuntu1.1) ... 219s Removing python3-lib2to3 (3.12.2-3ubuntu1.1) ... 219s Processing triggers for libc-bin (2.39-0ubuntu6) ... 219s autopkgtest [13:51:38]: rebooting testbed after setup commands that affected boot 292s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 298s autopkgtest [13:52:57]: testbed running kernel: Linux 6.8.0-20-generic #20-Ubuntu SMP Mon Mar 18 10:49:25 UTC 2024 301s autopkgtest [13:53:00]: @@@@@@@@@@@@@@@@@@@@ apt-source glam2 303s Get:1 http://ftpmaster.internal/ubuntu noble/universe glam2 1064-9 (dsc) [2006 B] 303s Get:2 http://ftpmaster.internal/ubuntu noble/universe glam2 1064-9 (tar) [238 kB] 303s Get:3 http://ftpmaster.internal/ubuntu noble/universe glam2 1064-9 (diff) [12.6 kB] 303s gpgv: Signature made Mon Dec 7 21:41:36 2020 UTC 303s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 303s gpgv: issuer "tille@debian.org" 303s gpgv: Can't check signature: No public key 303s dpkg-source: warning: cannot verify inline signature for ./glam2_1064-9.dsc: no acceptable signature found 303s autopkgtest [13:53:02]: testing package glam2 version 1064-9 303s autopkgtest [13:53:02]: build not needed 303s autopkgtest [13:53:02]: test check-no-args: preparing testbed 305s Reading package lists... 305s Building dependency tree... 305s Reading state information... 305s Starting pkgProblemResolver with broken count: 0 306s Starting 2 pkgProblemResolver with broken count: 0 306s Done 306s The following additional packages will be installed: 306s glam2 libfftw3-double3 libgomp1 306s Suggested packages: 306s libfftw3-bin libfftw3-dev 306s The following NEW packages will be installed: 306s autopkgtest-satdep glam2 libfftw3-double3 libgomp1 306s 0 upgraded, 4 newly installed, 0 to remove and 1 not upgraded. 306s Need to get 909 kB/909 kB of archives. 306s After this operation, 2160 kB of additional disk space will be used. 306s Get:1 /tmp/autopkgtest.vtPzZG/1-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [700 B] 306s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libgomp1 s390x 14-20240315-1ubuntu1 [151 kB] 306s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libfftw3-double3 s390x 3.3.10-1ubuntu2 [512 kB] 307s Get:4 http://ftpmaster.internal/ubuntu noble/universe s390x glam2 s390x 1064-9 [245 kB] 307s Fetched 909 kB in 1s (852 kB/s) 307s Selecting previously unselected package libgomp1:s390x. 307s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81562 files and directories currently installed.) 307s Preparing to unpack .../libgomp1_14-20240315-1ubuntu1_s390x.deb ... 307s Unpacking libgomp1:s390x (14-20240315-1ubuntu1) ... 307s Selecting previously unselected package libfftw3-double3:s390x. 307s Preparing to unpack .../libfftw3-double3_3.3.10-1ubuntu2_s390x.deb ... 307s Unpacking libfftw3-double3:s390x (3.3.10-1ubuntu2) ... 307s Selecting previously unselected package glam2. 307s Preparing to unpack .../glam2_1064-9_s390x.deb ... 307s Unpacking glam2 (1064-9) ... 307s Selecting previously unselected package autopkgtest-satdep. 307s Preparing to unpack .../1-autopkgtest-satdep.deb ... 307s Unpacking autopkgtest-satdep (0) ... 307s Setting up libgomp1:s390x (14-20240315-1ubuntu1) ... 307s Setting up libfftw3-double3:s390x (3.3.10-1ubuntu2) ... 307s Setting up glam2 (1064-9) ... 307s Setting up autopkgtest-satdep (0) ... 307s Processing triggers for man-db (2.12.0-3build4) ... 308s Processing triggers for libc-bin (2.39-0ubuntu6) ... 310s (Reading database ... 81616 files and directories currently installed.) 310s Removing autopkgtest-satdep (0) ... 310s autopkgtest [13:53:09]: test check-no-args: [----------------------- 311s Usage: glam2 [options] alphabet my_seqs.fa 311s Alphabets: p = proteins, n = nucleotides, other = alphabet file 311s Options (default settings): 311s -h: show all options and their default settings 311s -o: output file (stdout) 311s -r: number of alignment runs (10) 311s -n: end each run after this many iterations without improvement (10000) 311s -2: examine both strands - forward and reverse complement 311s -z: minimum number of sequences in the alignment (2) 311s -a: minimum number of aligned columns (2) 311s -b: maximum number of aligned columns (50) 311s -w: initial number of aligned columns (20) 311s -d: Dirichlet mixture file 311s -D: deletion pseudocount (0.1) 311s -E: no-deletion pseudocount (2.0) 311s -I: insertion pseudocount (0.02) 311s -J: no-insertion pseudocount (1.0) 311s -q: weight for generic versus sequence-set-specific residue abundances (1e+99) 311s -t: initial temperature (1.2) 311s -c: cooling factor per n iterations (1.44) 311s -u: temperature lower bound (0.1) 311s -p: print progress information at each iteration 311s -m: column-sampling moves per site-sampling move (1.0) 311s -x: site sampling algorithm: 0=FAST 1=SLOW 2=FFT (0) 311s -s: seed for pseudo-random numbers (1) 311s SUCCESS: Help text is there! 311s autopkgtest [13:53:10]: test check-no-args: -----------------------] 311s autopkgtest [13:53:10]: test check-no-args: - - - - - - - - - - results - - - - - - - - - - 311s check-no-args PASS 312s autopkgtest [13:53:11]: test run-unit-test: preparing testbed 314s Reading package lists... 314s Building dependency tree... 314s Reading state information... 314s Starting pkgProblemResolver with broken count: 0 314s Starting 2 pkgProblemResolver with broken count: 0 314s Done 314s The following NEW packages will be installed: 314s autopkgtest-satdep 314s 0 upgraded, 1 newly installed, 0 to remove and 1 not upgraded. 314s Need to get 0 B/704 B of archives. 314s After this operation, 0 B of additional disk space will be used. 314s Get:1 /tmp/autopkgtest.vtPzZG/2-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [704 B] 315s Selecting previously unselected package autopkgtest-satdep. 315s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 81616 files and directories currently installed.) 315s Preparing to unpack .../2-autopkgtest-satdep.deb ... 315s Unpacking autopkgtest-satdep (0) ... 315s Setting up autopkgtest-satdep (0) ... 316s (Reading database ... 81616 files and directories currently installed.) 316s Removing autopkgtest-satdep (0) ... 317s autopkgtest [13:53:16]: test run-unit-test: [----------------------- 318s Run 1... 12350 iterations 320s Run 2... 17270 iterations 322s Run 3... 19781 iterations 323s Run 4... 12220 iterations 326s Run 5... 18950 iterations 327s Run 6... 15650 iterations 332s Run 7... 31104 iterations 335s Run 8... 21854 iterations 336s Run 9... 11813 iterations 337s Run 10... 11182 iterations 337s 337s GLAM2: Gapped Local Alignment of Motifs 337s Version 1064 337s 337s glam2 p lipocalin.s 337s Sequences: 5 337s Greatest sequence length: 189 337s Residue counts: A=65 C=26 D=62 E=70 F=39 G=52 H=23 I=43 K=78 L=79 M=16 N=48 P=29 Q=26 R=28 S=53 T=43 V=63 W=15 Y=45 x=0 337s 337s Score: 80.3660 Columns: 20 Sequences: 5 337s 337s ******************** 337s ICYA_MANSE 13 KPVNDFDLSAFAGAWHEIAK 32 + 33.3 337s LACB_BOVIN 21 QTMKGLDIQKVAGTWYSLAM 40 + 18.8 337s BBP_PIEBR 12 KPVDNFDWSNYHGKWWEVAK 31 + 27.9 337s RETB_BOVIN 10 RVKENFDKARFAGTWYAMAK 29 + 25.5 337s MUP2_MOUSE 23 STGRNFNVEKINGEWHTIIL 42 + 13.4 337s 337s KPVDNFDISKFAGTWHEIAK 337s QTGEDLNKAAIH A YALIL 337s RVKKG LENVN E WSM M 337s S MN VQRY K TV 337s R W 337s 337s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 337s 0 0 0 0 0 0 0 0 2 0 0 0 0 1 1 1 0 0 0 0 0 1.51 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 2 1 0 0 0 1.06 337s 0 -0.0655 337s 0 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 2 0 0 0 -2.00 337s 0 -0.0655 337s 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0.233 337s 0 -0.0655 337s 0 0 1 0 0 1 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 4.91 337s 0 -0.0655 337s 0 0 0 0 4 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 9.87 337s 0 -0.0655 337s 0 0 4 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 9.08 337s 0 -0.0655 337s 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 1 1 0 0 -1.61 337s 0 -0.0655 337s 1 0 0 1 0 0 0 0 0 0 0 0 0 1 0 2 0 0 0 0 0 -0.0557 337s 0 -0.0655 337s 1 0 0 0 0 0 0 0 2 0 0 1 0 0 1 0 0 0 0 0 0 0.836 337s 0 -0.0655 337s 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 1 0 1 0 2.40 337s 0 -0.0655 337s 3 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1.35 337s 0 -0.0655 337s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9 337s 0 -0.0655 337s 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 2 0 0 0 0 0.355 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 22.5 337s 0 -0.0655 337s 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 2 0 7.34 337s 0 -0.0655 337s 1 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 -0.00544 337s 0 -0.0655 337s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 337s 0 -0.0655 337s 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 5.12 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0 0 0 1.70 337s 337s Score: 80.3660 Columns: 20 Sequences: 5 337s 337s ******************** 337s ICYA_MANSE 13 KPVNDFDLSAFAGAWHEIAK 32 + 33.3 337s LACB_BOVIN 21 QTMKGLDIQKVAGTWYSLAM 40 + 18.8 337s BBP_PIEBR 12 KPVDNFDWSNYHGKWWEVAK 31 + 27.9 337s RETB_BOVIN 10 RVKENFDKARFAGTWYAMAK 29 + 25.5 337s MUP2_MOUSE 23 STGRNFNVEKINGEWHTIIL 42 + 13.4 337s 337s KPVDNFDISKFAGTWHEIAK 337s QTGEDLNKAAIH A YALIL 337s RVKKG LENVN E WSM M 337s S MN VQRY K TV 337s R W 337s 337s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 337s 0 0 0 0 0 0 0 0 2 0 0 0 0 1 1 1 0 0 0 0 0 1.51 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 2 1 0 0 0 1.06 337s 0 -0.0655 337s 0 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 2 0 0 0 -2.00 337s 0 -0.0655 337s 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0.233 337s 0 -0.0655 337s 0 0 1 0 0 1 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 4.91 337s 0 -0.0655 337s 0 0 0 0 4 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 9.87 337s 0 -0.0655 337s 0 0 4 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 9.08 337s 0 -0.0655 337s 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 1 1 0 0 -1.61 337s 0 -0.0655 337s 1 0 0 1 0 0 0 0 0 0 0 0 0 1 0 2 0 0 0 0 0 -0.0557 337s 0 -0.0655 337s 1 0 0 0 0 0 0 0 2 0 0 1 0 0 1 0 0 0 0 0 0 0.836 337s 0 -0.0655 337s 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 1 0 1 0 2.40 337s 0 -0.0655 337s 3 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1.35 337s 0 -0.0655 337s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9 337s 0 -0.0655 337s 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 2 0 0 0 0 0.355 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 22.5 337s 0 -0.0655 337s 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 2 0 7.34 337s 0 -0.0655 337s 1 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 -0.00544 337s 0 -0.0655 337s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 337s 0 -0.0655 337s 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 5.12 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0 0 0 1.70 337s 337s Score: 80.3660 Columns: 20 Sequences: 5 337s 337s ******************** 337s ICYA_MANSE 13 KPVNDFDLSAFAGAWHEIAK 32 + 33.3 337s LACB_BOVIN 21 QTMKGLDIQKVAGTWYSLAM 40 + 18.8 337s BBP_PIEBR 12 KPVDNFDWSNYHGKWWEVAK 31 + 27.9 337s RETB_BOVIN 10 RVKENFDKARFAGTWYAMAK 29 + 25.5 337s MUP2_MOUSE 23 STGRNFNVEKINGEWHTIIL 42 + 13.4 337s 337s KPVDNFDISKFAGTWHEIAK 337s QTGEDLNKAAIH A YALIL 337s RVKKG LENVN E WSM M 337s S MN VQRY K TV 337s R W 337s 337s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 337s 0 0 0 0 0 0 0 0 2 0 0 0 0 1 1 1 0 0 0 0 0 1.51 337s 0 -0.0655 337s 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 2 1 0 0 0 1.06 337s 0 -0.0655 338s 0 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 2 0 0 0 -2.00 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0.233 338s 0 -0.0655 338s 0 0 1 0 0 1 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 4.91 338s 0 -0.0655 338s 0 0 0 0 4 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 9.87 338s 0 -0.0655 338s 0 0 4 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 9.08 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 1 1 0 0 -1.61 338s 0 -0.0655 338s 1 0 0 1 0 0 0 0 0 0 0 0 0 1 0 2 0 0 0 0 0 -0.0557 338s 0 -0.0655 338s 1 0 0 0 0 0 0 0 2 0 0 1 0 0 1 0 0 0 0 0 0 0.836 338s 0 -0.0655 338s 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 1 0 1 0 2.40 338s 0 -0.0655 338s 3 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1.35 338s 0 -0.0655 338s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9 338s 0 -0.0655 338s 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 2 0 0 0 0 0.355 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 22.5 338s 0 -0.0655 338s 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 2 0 7.34 338s 0 -0.0655 338s 1 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 -0.00544 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 5.12 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0 0 0 1.70 338s 338s Score: 77.3362 Columns: 21 Sequences: 5 338s 338s ********************* 338s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 338s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 338s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 338s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 338s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 338s 338s NDFHWVLDTDYKNYAIAYLCN 338s KVL IIA NDKFLLFCMED 338s LDN PK ET IMGHNIK 338s T P S VN S R 338s V T Q Y 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 338s Score: 77.3362 Columns: 21 Sequences: 5 338s 338s ********************* 338s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 338s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 338s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 338s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 338s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 338s 338s NDFHWVLDTDYKNYAIAYLCN 338s KVL IIA NDKFLLFCMED 338s LDN PK ET IMGHNIK 338s T P S VN S R 338s V T Q Y 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 338s Score: 77.3362 Columns: 21 Sequences: 5 338s 338s ********************* 338s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 338s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 338s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 338s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 338s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 338s 338s NDFHWVLDTDYKNYAIAYLCN 338s KVL IIA NDKFLLFCMED 338s LDN PK ET IMGHNIK 338s T P S VN S R 338s V T Q Y 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 338s Score: 77.3362 Columns: 21 Sequences: 5 338s 338s ********************* 338s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 338s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 338s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 338s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 338s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 338s 338s NDFHWVLDTDYKNYAIAYLCN 338s KVL IIA NDKFLLFCMED 338s LDN PK ET IMGHNIK 338s T P S VN S R 338s V T Q Y 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 338s Score: 75.7471 Columns: 26 Sequences: 5 338s 338s ************************** 338s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCDYHPDK 125 + 40.6 338s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMENSAEPE 130 + 20.6 338s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCKYDEDK 121 + 32.0 338s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCRLLNLD 126 + 20.6 338s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLINEKDGE 130 + 18.1 338s 338s NDFHWVLDTDYKNYAIAYLCNYAEDE 338s KVL IIA NDKFLLFCMEDEDDGK 338s LDN PK ET IMGHNIKLHNLD 338s T P S VN S RSKPP 338s V T Q Y L 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 0 -0.0655 338s 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 -0.975 338s 0 -0.0655 338s 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 -2.88 338s 0 -0.0655 338s 0 0 1 2 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 1.18 338s 0 -0.0655 338s 0 0 2 0 0 1 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 -2.32 338s 0 -0.0655 338s 0 0 1 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 3.72 338s 338s Score: 75.7471 Columns: 26 Sequences: 5 338s 338s ************************** 338s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCDYHPDK 125 + 40.6 338s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMENSAEPE 130 + 20.6 338s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCKYDEDK 121 + 32.0 338s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCRLLNLD 126 + 20.6 338s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLINEKDGE 130 + 18.1 338s 338s NDFHWVLDTDYKNYAIAYLCNYAEDE 338s KVL IIA NDKFLLFCMEDEDDGK 338s LDN PK ET IMGHNIKLHNLD 338s T P S VN S RSKPP 338s V T Q Y L 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s Run 1... 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 0 -0.0655 338s 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 -0.975 338s 0 -0.0655 338s 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 -2.88 338s 0 -0.0655 338s 0 0 1 2 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 1.18 338s 0 -0.0655 338s 0 0 2 0 0 1 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 -2.32 338s 0 -0.0655 338s 0 0 1 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 3.72 338s 338s Score: 73.5314 Columns: 41 Sequences: 5 338s 338s ********.*******.......************************** 338s ICYA_MANSE 81 KYTKQGKY.VMTFK.FGQRVV..NLVPWVLATDYKNYAINYNCDYHPDK 125 + 38.9 338s LACB_BOVIN 91 KTKIPAVF.KIDALNE.......NKVL.VLDTDYKKYLLFCMENSAEPE 130 + 21.8 338s BBP_PIEBR 78 DSKIGKIYHKLTYGGVTKE....NVFN.VLSTDNKNYIIGYYCKYDEDK 121 + 32.8 338s RETB_BOVIN 79 DTEDPAKF.KMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLD 126 + 34.1 338s MUP2_MOUSE 91 KTEKAGEY.SVTYDGF.......NTFT.IPKTDYDNFLMAHLINEKDGE 130 + 33.6 338s 338s KTEIPAKY KMTYDGF NDFHWVLDTDYKNYAIAYLCNYAEDE 338s DSKKAGEF SIDAGNV KVL IIA NDKFLLFCMEDEDDGK 338s YTDGKI VLKFK E LDN PK ET IMGHNIKLHNLD 338s Q V V L T P S VN S RSKPP 338s W V T Q Y L 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 0 0 2 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 5.22 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 3 0 0 1 0 2.46 338s 0 -0.0655 338s 0 0 0 2 0 0 0 0 2 0 0 0 0 0 0 0 1 0 0 0 0 2.94 338s 0 -0.0655 338s 0 0 1 0 0 0 0 2 2 0 0 0 0 0 0 0 0 0 0 0 0 0.216 338s 0 -0.0655 338s 1 0 0 0 0 1 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 -1.06 338s 0 -0.0655 338s 2 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0.824 338s 0 -0.0655 338s 0 0 0 1 0 0 0 1 2 0 0 0 0 0 0 0 0 1 0 0 0 -0.808 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 1 -8.30 338s 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 1 0 1 0 0 0 1.49 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 1 2 0 0 0 0 0 0 1 0 0 0 4.57 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 0 0 0 0 0 3 0 0 0 0 2.41 338s 0 -0.0655 338s 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.65 338s 0 -0.0655 338s 0 0 1 0 0 1 0 0 1 1 0 0 0 0 0 0 0 0 1 0 0 -4.16 338s 0 -0.0655 338s 0 0 0 0 0 3 0 0 0 0 0 1 0 0 0 0 0 0 0 0 1 -1.19 338s 0 -0.0655 338s 0 0 0 1 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.743 338s 15 -23.5 338s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 338s 0 -0.0655 338s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 338s 0 -0.0655 338s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 338s 0 -0.0655 338s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 338s 0 -0.0655 338s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 338s 0 -0.0655 338s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 338s 0 -0.0655 338s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 338s 0 -0.0655 338s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 338s 0 -0.0655 338s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 338s 0 -0.0655 338s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 338s 0 -0.0655 338s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 338s 0 -0.0655 338s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 338s 0 -0.0655 338s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 338s 0 -0.0655 338s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 338s 0 -0.0655 338s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 338s 0 -0.0655 338s 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 -0.975 338s 0 -0.0655 338s 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 -2.88 338s 0 -0.0655 338s 0 0 1 2 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 1.18 338s 0 -0.0655 338s 0 0 2 0 0 1 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 -2.32 338s 0 -0.0655 338s 0 0 1 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 3.72 338s 338s 4122 iterations 338s 338s GLAM2: Gapped Local Alignment of Motifs 338s Version 1064 338s 338s glam2 -r 1 -n 1000 p crp0.s 338s Sequences: 18 338s Greatest sequence length: 105 338s Residue counts: A=572 C=345 D=0 E=0 F=0 G=395 H=0 I=0 K=0 L=0 M=0 N=0 P=0 Q=0 R=0 S=0 T=578 V=0 W=0 Y=0 x=0 338s 338s Score: 1431.87 Columns: 46 Sequences: 18 338s 338s *********.......*****.................********...............********........***.........****..********* 338s ce1cg 31 GCGAGAATAG......CGCGTGGTG.............TGAAAGACTGTTTTTTTGATCGTTTTCACAAAAA.....TGGAA.......GTCC..ACAGTCTTG 101 + 95.1 338s ara 31 TCACGGCAGAAAAGTCCACATTGATTATT.........TGCACGGCG..............TCACACTT........TGCTA.......TGCC..ATAGCATTT 94 + 114. 338s bglr1 37 ATATAACTTTATAAA.TTCCTAAAAT............TACACAAA...............GTTAATAAC.......TGTG........AGCAT.GGTCATATT 96 + 99.8 338s crp 46 ACATTGATG.......TACTGCATG.............TATGCAAAGGACG..........TCACATTACCG.....TGCAG.......TACA..GTTGATAGC 105 + 109. 338s cya 1 ACGGTGCTA.......CACTTG................TATGTAGCGCATC..........TTTCTTTACGG.....TCA.........ATCA..GCAAGGTGT 55 + 109. 338s deop2 18 AGATCGCAT.......TACAGTGATGCAAACTTG....TAAGTAGA...............TTTCCTTAAT......TGTGATGTG...TATC..GAAGTGTGT 84 + 105. 338s gale 10 AAACGGCTAAA.....TTCTTG................TGTAAACGA..............TTCCACTAATTTAT..TCCA........TGTC..ACACTTTTC 66 + 117. 338s ilv 21 TATCTGCAA.......TTCAG.................TACAAAACGTGATCA........ACCCCTCAATTT....TCCCTT......TGCT..GAAAAATTT 80 + 112. 338s lac 16 AGTTAGCTCA......CTCAT.................TAGGCACCCCAGGCT........TTACACTTTA......TGC.........TTCCG.GCTCGTATG 72 + 111. 338s male 4 TTACCGCCAA......TTCTG.................TAACAGAGA..............TCACACAAAGCGACGGTGGGGCGTAGG.GGCAA.GGAGGATGG 68 + 95.1 338s malk 22 ACACGGCTT.......CTGTGAACTAAACCGAGGTCA.TGTAAGGAA..............TTTCGTGA........TGT.........TGCTT.GCAAAAATC 85 + 109. 338s malt 50 ACAGTGCAAA......TTCAGACACA............TAAAAAAAC..............GTCATCGCT.......TGC.........ATTA..GAAAGGTTT 103 + 107. 338s ompa 30 ACAAGACTTTTTT...TTCATA................TGCCTGACGGA............GTTCACACT.......TGTAAGTT....TTCA..ACTACGTTG 89 + 113. 338s tnaa 9 ACATTAAAA.......TTCTTACGTAATTTATAATCTTTAAAAAAAGCA............TTTAATAT........TGC.........TCCCC.GAACGATTG 75 + 109. 338s uxu1 32 AACCCAATTAGAA...TTCGGGATTGACATGTCT....TACCAAAAGGTAGAACTT.....ATACGCCA........TCTC........ATCC..GATGCAAGC 105 + 101. 338s pbr322 12 ATGCGGCAT.......CAGAGCAGATTG..........TACTGAGA...............GTGCACCATA......TGCGGTGTGAAATACC..GCACAGATG 75 + 108. 338s trn9cat 11 AGATCACTT.......CGCAGAA...............TAAATAAATCCTGGT........GTCCCTGT........TGA.........TACCGGGAAGCCCTG 67 + 107. 338s tdc 47 ATAACGATA.......CTCTGGAAAG............TATTGAAA...............GTTAATTTG.......TGAGT.......GGTC..GCACATATC 100 + 107. 338s 338s ACACGGCTA TTCAG TAAAAAAA TTTCACTA TGC TGCC GCAGAATTG 338s T TCAAAT CA TT GCGCGGC GCAA TAT CT ATTA AATCGGAGT 338s T T T C A ACT C 338s 338s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 338s 14 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 37.3 338s 0 -0.100 338s 3 8 0 0 0 3 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 32.9 338s 0 -0.100 338s 12 1 0 0 0 3 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 29.5 338s 0 -0.100 338s 3 7 0 0 0 2 0 0 0 0 0 0 0 0 0 0 6 0 0 0 0 31.9 338s 0 -0.100 338s 2 5 0 0 0 6 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 26.4 338s 0 -0.100 338s 6 0 0 0 0 12 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 40.1 338s 0 -0.100 338s 5 13 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 62.9 338s 0 -0.100 338s 6 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 34.9 338s 0 -0.100 338s 8 1 0 0 0 2 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 26.2 338s 27 -51.1 338s 0 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 0 0 0 0 52.5 338s 0 -0.100 338s 5 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 32.4 338s 0 -0.100 338s 0 16 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 75.8 338s 0 -0.100 338s 8 1 0 0 0 2 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 26.2 338s 0 -0.100 338s 0 0 0 0 0 10 0 0 0 0 0 0 0 0 0 0 8 0 0 0 0 38.4 338s 102 -82.2 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18 0 0 0 0 64.5 338s 0 -0.100 338s 13 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39.7 338s 0 -0.100 338s 6 6 0 0 0 1 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 31.2 338s 0 -0.100 338s 9 3 0 0 0 4 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 26.2 338s 0 -0.100 338s 8 4 0 0 0 2 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 26.9 338s 0 -0.100 338s 13 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39.7 338s 0 -0.100 338s 11 2 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 33.5 338s 0 -0.100 338s 10 6 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39.7 338s 67 -71.8 338s 2 0 0 0 0 6 0 0 0 0 0 0 0 0 0 0 10 0 0 0 0 30.8 338s 0 -0.100 338s 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14 0 0 0 0 49.3 338s 0 -0.100 338s 5 4 0 0 0 1 0 0 0 0 0 0 0 0 0 0 8 0 0 0 0 29.1 338s 0 -0.100 338s 4 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 66.8 338s 0 -0.100 338s 11 3 0 0 0 2 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 29.8 338s 0 -0.100 338s 0 9 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9 0 0 0 0 54.3 338s 0 -0.100 338s 5 3 0 0 0 3 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 24.3 338s 0 -0.100 338s 11 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 33.0 338s 37 -57.9 338s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18 0 0 0 0 64.5 338s 0 -0.100 338s 0 4 0 0 0 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 47.7 338s 0 -0.100 338s 3 8 0 0 0 2 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 34.0 338s 42 -60.8 338s 4 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 31.4 338s 0 -0.100 338s 4 1 0 0 0 7 0 0 0 0 0 0 0 0 0 0 6 0 0 0 0 22.9 338s 0 -0.100 338s 0 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 68.5 338s 0 -0.100 338s 6 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 45.9 338s 7 -27.4 338s 4 0 0 0 0 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 43.6 338s 0 -0.100 338s 6 8 0 0 0 2 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 35.2 338s 0 -0.100 338s 13 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 39.1 338s 0 -0.100 338s 5 6 0 0 0 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 35.3 338s 0 -0.100 338s 6 4 0 0 0 5 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 24.4 338s 0 -0.100 338s 6 2 0 0 0 5 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 22.2 338s 0 -0.100 338s 7 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 0 0 0 0 33.9 338s 0 -0.100 338s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 13 0 0 0 0 40.8 338s 0 -0.100 338s 0 5 0 0 0 7 0 0 0 0 0 0 0 0 0 0 6 0 0 0 0 31.3 338s 338s PASS 338s autopkgtest [13:53:37]: test run-unit-test: -----------------------] 339s autopkgtest [13:53:38]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 339s run-unit-test PASS 339s autopkgtest [13:53:38]: @@@@@@@@@@@@@@@@@@@@ summary 339s check-no-args PASS 339s run-unit-test PASS 362s Creating nova instance adt-noble-s390x-glam2-20240327-134759-juju-7f2275-prod-proposed-migration-environment-3-07761b5a-f0e0-4499-a3df-172d60ac89a7 from image adt/ubuntu-noble-s390x-server-20240327.img (UUID 4dc0c4c2-a3ae-40cd-8411-e7fc228c10ae)...