0s autopkgtest [21:09:57]: starting date and time: 2024-03-19 21:09:57+0000 0s autopkgtest [21:09:57]: git checkout: 4a1cd702 l/adt_testbed: don't blame the testbed for unsolvable build deps 0s autopkgtest [21:09:57]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.kpia52pu/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:glib2.0,src:elfutils --apt-upgrade exonerate --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=glib2.0/2.79.3-3ubuntu5 elfutils/0.190-1.1build1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos02-s390x-12.secgroup --name adt-noble-s390x-exonerate-20240319-210957-juju-7f2275-prod-proposed-migration-environment-2 --image adt/ubuntu-noble-s390x-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 69s autopkgtest [21:11:06]: testbed dpkg architecture: s390x 70s autopkgtest [21:11:07]: testbed apt version: 2.7.12 70s autopkgtest [21:11:07]: @@@@@@@@@@@@@@@@@@@@ test bed setup 71s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 71s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [6540 B] 71s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [52.7 kB] 71s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [3757 kB] 72s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [493 kB] 73s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main s390x Packages [643 kB] 73s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main s390x c-n-f Metadata [3032 B] 73s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted s390x Packages [1372 B] 73s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted s390x c-n-f Metadata [116 B] 73s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x Packages [3984 kB] 74s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe s390x c-n-f Metadata [7292 B] 74s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse s390x Packages [34.4 kB] 74s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse s390x c-n-f Metadata [116 B] 75s Fetched 9100 kB in 4s (2365 kB/s) 75s Reading package lists... 78s Reading package lists... 78s Building dependency tree... 78s Reading state information... 78s Calculating upgrade... 78s The following packages will be REMOVED: 78s libglib2.0-0 78s The following NEW packages will be installed: 78s libglib2.0-0t64 xdg-user-dirs 78s The following packages will be upgraded: 78s gir1.2-glib-2.0 libglib2.0-data 79s 2 upgraded, 2 newly installed, 1 to remove and 0 not upgraded. 79s Need to get 1811 kB of archives. 79s After this operation, 159 kB of additional disk space will be used. 79s Get:1 http://ftpmaster.internal/ubuntu noble-proposed/main s390x gir1.2-glib-2.0 s390x 2.79.3-3ubuntu5 [180 kB] 79s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libglib2.0-0t64 s390x 2.79.3-3ubuntu5 [1566 kB] 80s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main s390x libglib2.0-data all 2.79.3-3ubuntu5 [46.6 kB] 80s Get:4 http://ftpmaster.internal/ubuntu noble/main s390x xdg-user-dirs s390x 0.18-1 [18.5 kB] 80s Fetched 1811 kB in 1s (1337 kB/s) 80s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52171 files and directories currently installed.) 80s Preparing to unpack .../gir1.2-glib-2.0_2.79.3-3ubuntu5_s390x.deb ... 80s Unpacking gir1.2-glib-2.0:s390x (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 80s dpkg: libglib2.0-0:s390x: dependency problems, but removing anyway as you requested: 80s udisks2 depends on libglib2.0-0 (>= 2.77.0). 80s shared-mime-info depends on libglib2.0-0 (>= 2.75.3). 80s s390-tools depends on libglib2.0-0 (>= 2.77.0). 80s python3-gi depends on libglib2.0-0 (>= 2.77.0). 80s python3-dbus depends on libglib2.0-0 (>= 2.16.0). 80s netplan.io depends on libglib2.0-0 (>= 2.70.0). 80s netplan-generator depends on libglib2.0-0 (>= 2.70.0). 80s libxmlb2:s390x depends on libglib2.0-0 (>= 2.54.0). 80s libvolume-key1:s390x depends on libglib2.0-0 (>= 2.18.0). 80s libudisks2-0:s390x depends on libglib2.0-0 (>= 2.75.3). 80s libqrtr-glib0:s390x depends on libglib2.0-0 (>= 2.56). 80s libqmi-proxy depends on libglib2.0-0 (>= 2.30.0). 80s libqmi-glib5:s390x depends on libglib2.0-0 (>= 2.54.0). 80s libpolkit-gobject-1-0:s390x depends on libglib2.0-0 (>= 2.38.0). 80s libpolkit-agent-1-0:s390x depends on libglib2.0-0 (>= 2.38.0). 80s libnetplan0:s390x depends on libglib2.0-0 (>= 2.75.3). 80s libmm-glib0:s390x depends on libglib2.0-0 (>= 2.62.0). 80s libmbim-proxy depends on libglib2.0-0 (>= 2.56). 80s libmbim-glib4:s390x depends on libglib2.0-0 (>= 2.56). 80s libjson-glib-1.0-0:s390x depends on libglib2.0-0 (>= 2.75.3). 80s libjcat1:s390x depends on libglib2.0-0 (>= 2.75.3). 80s libgusb2:s390x depends on libglib2.0-0 (>= 2.75.3). 80s libgudev-1.0-0:s390x depends on libglib2.0-0 (>= 2.38.0). 80s libgirepository-1.0-1:s390x depends on libglib2.0-0 (>= 2.79.0). 80s libfwupd2:s390x depends on libglib2.0-0 (>= 2.79.0). 80s libblockdev3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-utils3:s390x depends on libglib2.0-0 (>= 2.75.3). 80s libblockdev-swap3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-part3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-nvme3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-mdraid3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-loop3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-fs3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s libblockdev-crypto3:s390x depends on libglib2.0-0 (>= 2.42.2). 80s fwupd depends on libglib2.0-0 (>= 2.79.0). 80s bolt depends on libglib2.0-0 (>= 2.56.0). 80s 80s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52171 files and directories currently installed.) 80s Removing libglib2.0-0:s390x (2.79.2-1~ubuntu1) ... 80s Selecting previously unselected package libglib2.0-0t64:s390x. 80s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52146 files and directories currently installed.) 80s Preparing to unpack .../libglib2.0-0t64_2.79.3-3ubuntu5_s390x.deb ... 80s libglib2.0-0t64.preinst: Removing /var/lib/dpkg/info/libglib2.0-0:s390x.postrm to avoid loss of /usr/share/glib-2.0/schemas/gschemas.compiled... 80s removed '/var/lib/dpkg/info/libglib2.0-0:s390x.postrm' 80s Unpacking libglib2.0-0t64:s390x (2.79.3-3ubuntu5) ... 80s Preparing to unpack .../libglib2.0-data_2.79.3-3ubuntu5_all.deb ... 80s Unpacking libglib2.0-data (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 80s Selecting previously unselected package xdg-user-dirs. 80s Preparing to unpack .../xdg-user-dirs_0.18-1_s390x.deb ... 80s Unpacking xdg-user-dirs (0.18-1) ... 80s Setting up xdg-user-dirs (0.18-1) ... 80s Setting up libglib2.0-0t64:s390x (2.79.3-3ubuntu5) ... 80s No schema files found: doing nothing. 80s Setting up libglib2.0-data (2.79.3-3ubuntu5) ... 80s Setting up gir1.2-glib-2.0:s390x (2.79.3-3ubuntu5) ... 80s Processing triggers for man-db (2.12.0-3) ... 81s Processing triggers for libc-bin (2.39-0ubuntu2) ... 81s Reading package lists... 81s Building dependency tree... 81s Reading state information... 81s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 82s Hit:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease 82s Hit:2 http://ftpmaster.internal/ubuntu noble InRelease 82s Hit:3 http://ftpmaster.internal/ubuntu noble-updates InRelease 82s Hit:4 http://ftpmaster.internal/ubuntu noble-security InRelease 83s Reading package lists... 83s Reading package lists... 83s Building dependency tree... 83s Reading state information... 84s Calculating upgrade... 84s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 84s Reading package lists... 84s Building dependency tree... 84s Reading state information... 84s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 87s autopkgtest [21:11:24]: testbed running kernel: Linux 6.8.0-11-generic #11-Ubuntu SMP Tue Feb 13 23:45:46 UTC 2024 87s autopkgtest [21:11:24]: @@@@@@@@@@@@@@@@@@@@ apt-source exonerate 89s Get:1 http://ftpmaster.internal/ubuntu noble/universe exonerate 2.4.0-5 (dsc) [2109 B] 89s Get:2 http://ftpmaster.internal/ubuntu noble/universe exonerate 2.4.0-5 (tar) [521 kB] 89s Get:3 http://ftpmaster.internal/ubuntu noble/universe exonerate 2.4.0-5 (diff) [9192 B] 90s gpgv: Signature made Thu Dec 3 21:18:18 2020 UTC 90s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 90s gpgv: issuer "tille@debian.org" 90s gpgv: Can't check signature: No public key 90s dpkg-source: warning: cannot verify inline signature for ./exonerate_2.4.0-5.dsc: no acceptable signature found 90s autopkgtest [21:11:27]: testing package exonerate version 2.4.0-5 90s autopkgtest [21:11:27]: build not needed 91s autopkgtest [21:11:28]: test run-unit-test: preparing testbed 92s Reading package lists... 92s Building dependency tree... 92s Reading state information... 92s Starting pkgProblemResolver with broken count: 0 92s Starting 2 pkgProblemResolver with broken count: 0 92s Done 93s The following additional packages will be installed: 93s exonerate 93s Suggested packages: 93s wise 93s The following NEW packages will be installed: 93s autopkgtest-satdep exonerate 93s 0 upgraded, 2 newly installed, 0 to remove and 0 not upgraded. 93s Need to get 1533 kB/1533 kB of archives. 93s After this operation, 11.0 MB of additional disk space will be used. 93s Get:1 /tmp/autopkgtest.LhLvpS/1-autopkgtest-satdep.deb autopkgtest-satdep s390x 0 [704 B] 93s Get:2 http://ftpmaster.internal/ubuntu noble/universe s390x exonerate s390x 2.4.0-5 [1533 kB] 94s Fetched 1533 kB in 1s (1489 kB/s) 94s Selecting previously unselected package exonerate. 94s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 52185 files and directories currently installed.) 94s Preparing to unpack .../exonerate_2.4.0-5_s390x.deb ... 94s Unpacking exonerate (2.4.0-5) ... 94s Selecting previously unselected package autopkgtest-satdep. 94s Preparing to unpack .../1-autopkgtest-satdep.deb ... 94s Unpacking autopkgtest-satdep (0) ... 94s Setting up exonerate (2.4.0-5) ... 94s Setting up autopkgtest-satdep (0) ... 94s Processing triggers for man-db (2.12.0-3) ... 97s (Reading database ... 52283 files and directories currently installed.) 97s Removing autopkgtest-satdep (0) ... 97s autopkgtest [21:11:34]: test run-unit-test: [----------------------- 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/exonerate/exonerate.simple.test.sh 98s Exonerate simple test OK 98s Score as expected: 10875 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/ipcress/ipcress.simple.test.sh 98s ** Message: 21:11:35.091: Loaded [1] experiments 98s Ipcress run successfully 98s Found 1 product, as expected 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastarevcomp.test.sh 98s Reverse complement created : ./data/cdna/calm.human.dna.fasta 98s Reverse complement created : fastarevcomp.rc.test.fasta 98s RC length is the same 98s RC length is the same 98s 2nd reverse complement same as original 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastasoftmask.fastahardmask.test.sh 98s Softmasked OK 98s >test 98s ACGNAACCGGNNAAACCCGGGNNNAAAACCCCGGGGNNNN 98s Hardmasked OK 98s Hardmasked file is same as original masked file 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastasubseq.test.sh 98s Generated correct subseq 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastaclip.test.sh 98s Clipped OK 98s >test:subseq(0,4) 98s ACGT 98s Clipped input correctly 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastaindex.fastafetch.test.sh 98s Made index fastafetch.test.idx 98s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx CALM_HUMAN 98s expect 0 98s ** FATAL ERROR **: Could not find identifier [A_MISSING_FROM_START] (missing -F ?) 98s exiting ... 98s ** FATAL ERROR **: Could not find identifier [M_MISSING_FROM_MIDDLE] (missing -F ?) 98s exiting ... 98s ** FATAL ERROR **: Could not find identifier [z_MISSING_FROM_END] (missing -F ?) 98s exiting ... 98s >CALM_HUMAN 98s MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 98s TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 98s EFVQMMTAK 98s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx P53_HUMAN 98s expect 0 98s >P53_HUMAN 98s MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA 98s PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT 98s CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN 98s TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGR 98s DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL 98s KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD 98s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx A_MISSING_FROM_START 98s expect 1 98s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx M_MISSING_FROM_MIDDLE 98s expect 1 98s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx z_MISSING_FROM_END 98s expect 1 98s fastaindex fastafetch test OK 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastacomposition.test.sh 98s Calmodulin cDNA composition correct 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastavalidcds.test.sh 98s Validiated CDS sequences OK 98s 98s ** (process:2243): WARNING **: 21:11:35.120: odd_length length (7) not divisible by 3 98s 98s ** (process:2243): WARNING **: 21:11:35.120: too_short length (4) not divisible by 3 98s 98s ** (process:2243): WARNING **: 21:11:35.120: no_start missing start codon (has:AAA) 98s 98s ** (process:2243): WARNING **: 21:11:35.120: no_end missing stop codon (has:TTT) 98s 98s ** (process:2243): WARNING **: 21:11:35.120: in_frame_stop contains in-frame stop codon (pos:9, codon:TAG) 98s 98s ** (process:2243): WARNING **: 21:11:35.120: non_acgt_base contains non-ACGT base: [pos: 5 base: N] 98s ** FATAL ERROR **: Could not open list for removal [CALM_HUMAN] 98s exiting ... 98s >valid_seq 98s ATGAAACCCGGGTTTTAA 98s Validated correctly a single seq from input 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastarefomat.test.sh 98s Reformatted OK 98s >test 98s ACGTAACCGGTTAAACCCGGGTTTAAAACCCCGGGGTTTT 98s Reformatted length consistent 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastatranslate.test.sh 98s Extraced CDS for translation 98s Tranlated sequence 98s Tranlsated sequence correct 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastaclean.test.sh 98s >CALM_HUMAN:filter(clean) 98s MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 98s TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 98s EFVQMMTAK 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastanrdb.test.sh 98s Made input file for fastanrdb 98s Successfully ran fastanrdb on: fastanrdb.input.test.fasta 98s Expected number of seqs in output: 4 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastasort.test.sh 98s Sorted CALM_HUMAN 149 98s Sorted P53_HUMAN 393 98s Sorted TUBE_DROME 462 98s Sorted AF01595 1132 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastalength.test.sh 98s 149 CALM_HUMAN 98s Calmodulin length OK 98s Calmodulin identifier OK 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastadiff.test.sh 98s fastadiff: id mismatch: CALM_HUMAN P53_HUMAN 98s Different seqs recognised as different 98s Identity test OK 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastaoverlap.test.sh 98s /usr/bin/fastaoverlap working OK 98s Generated 15 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastaexpode.test.sh 98s Made input file for fastaexplode 98s Make output directory for fastaexplode 98s Successfully ran fastaexplode on: fastaexplode.test.fasta 98s Expected number of seqs in output: 4 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastaremove.test.sh 98s Have calmodulin in input 98s Calmodulin successfully removed 98s 98s /tmp/autopkgtest.LhLvpS/autopkgtest_tmp/util/fastasplit.test.sh 98s Split fastasplit.test.fasta OK 98s Split into two files as expected 98s Input len 2136 98s Output len 2136 98s Input and output lengths match 98s PASS 98s autopkgtest [21:11:35]: test run-unit-test: -----------------------] 99s run-unit-test PASS 99s autopkgtest [21:11:36]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 99s autopkgtest [21:11:36]: @@@@@@@@@@@@@@@@@@@@ summary 99s run-unit-test PASS 111s Creating nova instance adt-noble-s390x-exonerate-20240319-210957-juju-7f2275-prod-proposed-migration-environment-2 from image adt/ubuntu-noble-s390x-server-20240319.img (UUID e548347a-8530-49a1-9caa-86a7013f2b8b)...