0s autopkgtest [00:53:39]: starting date and time: 2024-03-14 00:53:39+0000 0s autopkgtest [00:53:39]: git checkout: b506e79c ssh-setup/nova: fix ARCH having two lines of data 0s autopkgtest [00:53:39]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.zd785lte/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:glib2.0,src:elfutils --apt-upgrade exonerate --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=glib2.0/2.79.3-3ubuntu5 elfutils/0.190-1.1build1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos01-ppc64el-10.secgroup --name adt-noble-ppc64el-exonerate-20240314-005339-juju-7f2275-prod-proposed-migration-environment-2 --image adt/ubuntu-noble-ppc64el-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://us.ports.ubuntu.com/ubuntu-ports/ 91s autopkgtest [00:55:10]: testbed dpkg architecture: ppc64el 92s autopkgtest [00:55:11]: testbed apt version: 2.7.12 92s autopkgtest [00:55:11]: @@@@@@@@@@@@@@@@@@@@ test bed setup 93s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 93s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [2862 kB] 93s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [45.5 kB] 93s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [4812 B] 93s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [449 kB] 93s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main ppc64el Packages [596 kB] 93s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main ppc64el c-n-f Metadata [3116 B] 93s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted ppc64el Packages [1372 B] 93s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted ppc64el c-n-f Metadata [116 B] 93s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe ppc64el Packages [3177 kB] 93s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe ppc64el c-n-f Metadata [8652 B] 93s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse ppc64el Packages [41.2 kB] 93s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse ppc64el c-n-f Metadata [116 B] 97s Fetched 7306 kB in 2s (3931 kB/s) 97s Reading package lists... 99s Reading package lists... 99s Building dependency tree... 99s Reading state information... 99s Calculating upgrade... 100s The following packages will be REMOVED: 100s libglib2.0-0 100s The following NEW packages will be installed: 100s libglib2.0-0t64 xdg-user-dirs 100s The following packages will be upgraded: 100s gir1.2-glib-2.0 libglib2.0-data 100s 2 upgraded, 2 newly installed, 1 to remove and 0 not upgraded. 100s Need to get 2022 kB of archives. 100s After this operation, 204 kB of additional disk space will be used. 100s Get:1 http://ftpmaster.internal/ubuntu noble-proposed/main ppc64el gir1.2-glib-2.0 ppc64el 2.79.3-3ubuntu5 [182 kB] 100s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main ppc64el libglib2.0-0t64 ppc64el 2.79.3-3ubuntu5 [1773 kB] 100s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main ppc64el libglib2.0-data all 2.79.3-3ubuntu5 [46.6 kB] 100s Get:4 http://ftpmaster.internal/ubuntu noble/main ppc64el xdg-user-dirs ppc64el 0.18-1 [20.0 kB] 101s Fetched 2022 kB in 1s (2078 kB/s) 101s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 70096 files and directories currently installed.) 101s Preparing to unpack .../gir1.2-glib-2.0_2.79.3-3ubuntu5_ppc64el.deb ... 101s Unpacking gir1.2-glib-2.0:ppc64el (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 101s dpkg: libglib2.0-0:ppc64el: dependency problems, but removing anyway as you requested: 101s udisks2 depends on libglib2.0-0 (>= 2.77.0). 101s shared-mime-info depends on libglib2.0-0 (>= 2.75.3). 101s python3-gi depends on libglib2.0-0 (>= 2.77.0). 101s python3-dbus depends on libglib2.0-0 (>= 2.16.0). 101s netplan.io depends on libglib2.0-0 (>= 2.70.0). 101s netplan-generator depends on libglib2.0-0 (>= 2.70.0). 101s libxmlb2:ppc64el depends on libglib2.0-0 (>= 2.54.0). 101s libvolume-key1:ppc64el depends on libglib2.0-0 (>= 2.18.0). 101s libudisks2-0:ppc64el depends on libglib2.0-0 (>= 2.75.3). 101s libqrtr-glib0:ppc64el depends on libglib2.0-0 (>= 2.56). 101s libqmi-proxy depends on libglib2.0-0 (>= 2.30.0). 101s libqmi-glib5:ppc64el depends on libglib2.0-0 (>= 2.54.0). 101s libpolkit-gobject-1-0:ppc64el depends on libglib2.0-0 (>= 2.38.0). 101s libpolkit-agent-1-0:ppc64el depends on libglib2.0-0 (>= 2.38.0). 101s libnetplan0:ppc64el depends on libglib2.0-0 (>= 2.75.3). 101s libmm-glib0:ppc64el depends on libglib2.0-0 (>= 2.62.0). 101s libmbim-proxy depends on libglib2.0-0 (>= 2.56). 101s libmbim-glib4:ppc64el depends on libglib2.0-0 (>= 2.56). 101s libjson-glib-1.0-0:ppc64el depends on libglib2.0-0 (>= 2.75.3). 101s libjcat1:ppc64el depends on libglib2.0-0 (>= 2.75.3). 101s libgusb2:ppc64el depends on libglib2.0-0 (>= 2.75.3). 101s libgudev-1.0-0:ppc64el depends on libglib2.0-0 (>= 2.38.0). 101s libgirepository-1.0-1:ppc64el depends on libglib2.0-0 (>= 2.79.0). 101s libfwupd2:ppc64el depends on libglib2.0-0 (>= 2.79.0). 101s libblockdev3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-utils3:ppc64el depends on libglib2.0-0 (>= 2.75.3). 101s libblockdev-swap3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-part3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-nvme3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-mdraid3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-loop3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-fs3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s libblockdev-crypto3:ppc64el depends on libglib2.0-0 (>= 2.42.2). 101s fwupd depends on libglib2.0-0 (>= 2.79.0). 101s bolt depends on libglib2.0-0 (>= 2.56.0). 101s 101s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 70096 files and directories currently installed.) 101s Removing libglib2.0-0:ppc64el (2.79.2-1~ubuntu1) ... 101s Selecting previously unselected package libglib2.0-0t64:ppc64el. 101s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 70071 files and directories currently installed.) 101s Preparing to unpack .../libglib2.0-0t64_2.79.3-3ubuntu5_ppc64el.deb ... 101s libglib2.0-0t64.preinst: Removing /var/lib/dpkg/info/libglib2.0-0:ppc64el.postrm to avoid loss of /usr/share/glib-2.0/schemas/gschemas.compiled... 101s removed '/var/lib/dpkg/info/libglib2.0-0:ppc64el.postrm' 101s Unpacking libglib2.0-0t64:ppc64el (2.79.3-3ubuntu5) ... 101s Preparing to unpack .../libglib2.0-data_2.79.3-3ubuntu5_all.deb ... 101s Unpacking libglib2.0-data (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 101s Selecting previously unselected package xdg-user-dirs. 101s Preparing to unpack .../xdg-user-dirs_0.18-1_ppc64el.deb ... 101s Unpacking xdg-user-dirs (0.18-1) ... 101s Setting up xdg-user-dirs (0.18-1) ... 101s Setting up libglib2.0-0t64:ppc64el (2.79.3-3ubuntu5) ... 101s No schema files found: doing nothing. 101s Setting up libglib2.0-data (2.79.3-3ubuntu5) ... 101s Setting up gir1.2-glib-2.0:ppc64el (2.79.3-3ubuntu5) ... 101s Processing triggers for man-db (2.12.0-3) ... 102s Processing triggers for libc-bin (2.39-0ubuntu2) ... 102s Reading package lists... 102s Building dependency tree... 102s Reading state information... 102s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 103s Hit:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease 103s Hit:2 http://ftpmaster.internal/ubuntu noble InRelease 103s Hit:3 http://ftpmaster.internal/ubuntu noble-updates InRelease 103s Hit:4 http://ftpmaster.internal/ubuntu noble-security InRelease 104s Reading package lists... 104s Reading package lists... 104s Building dependency tree... 104s Reading state information... 104s Calculating upgrade... 104s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 104s Reading package lists... 105s Building dependency tree... 105s Reading state information... 105s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 107s autopkgtest [00:55:26]: testbed running kernel: Linux 6.8.0-11-generic #11-Ubuntu SMP Wed Feb 14 00:33:03 UTC 2024 107s autopkgtest [00:55:26]: @@@@@@@@@@@@@@@@@@@@ apt-source exonerate 109s Get:1 http://ftpmaster.internal/ubuntu noble/universe exonerate 2.4.0-5 (dsc) [2109 B] 109s Get:2 http://ftpmaster.internal/ubuntu noble/universe exonerate 2.4.0-5 (tar) [521 kB] 109s Get:3 http://ftpmaster.internal/ubuntu noble/universe exonerate 2.4.0-5 (diff) [9192 B] 109s gpgv: Signature made Thu Dec 3 21:18:18 2020 UTC 109s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 109s gpgv: issuer "tille@debian.org" 109s gpgv: Can't check signature: No public key 109s dpkg-source: warning: cannot verify inline signature for ./exonerate_2.4.0-5.dsc: no acceptable signature found 109s autopkgtest [00:55:28]: testing package exonerate version 2.4.0-5 110s autopkgtest [00:55:29]: build not needed 118s autopkgtest [00:55:37]: test run-unit-test: preparing testbed 119s Reading package lists... 119s Building dependency tree... 119s Reading state information... 119s Starting pkgProblemResolver with broken count: 0 119s Starting 2 pkgProblemResolver with broken count: 0 119s Done 120s The following additional packages will be installed: 120s exonerate 120s Suggested packages: 120s wise 120s The following NEW packages will be installed: 120s autopkgtest-satdep exonerate 120s 0 upgraded, 2 newly installed, 0 to remove and 0 not upgraded. 120s Need to get 1521 kB/1522 kB of archives. 120s After this operation, 11.5 MB of additional disk space will be used. 120s Get:1 /tmp/autopkgtest.Uuggbh/1-autopkgtest-satdep.deb autopkgtest-satdep ppc64el 0 [704 B] 120s Get:2 http://ftpmaster.internal/ubuntu noble/universe ppc64el exonerate ppc64el 2.4.0-5 [1521 kB] 121s Fetched 1521 kB in 1s (1878 kB/s) 121s Selecting previously unselected package exonerate. 121s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 70110 files and directories currently installed.) 121s Preparing to unpack .../exonerate_2.4.0-5_ppc64el.deb ... 121s Unpacking exonerate (2.4.0-5) ... 121s Selecting previously unselected package autopkgtest-satdep. 121s Preparing to unpack .../1-autopkgtest-satdep.deb ... 121s Unpacking autopkgtest-satdep (0) ... 121s Setting up exonerate (2.4.0-5) ... 121s Setting up autopkgtest-satdep (0) ... 121s Processing triggers for man-db (2.12.0-3) ... 123s (Reading database ... 70208 files and directories currently installed.) 123s Removing autopkgtest-satdep (0) ... 124s autopkgtest [00:55:43]: test run-unit-test: [----------------------- 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/ipcress/ipcress.simple.test.sh 124s ** Message: 00:55:43.423: Loaded [1] experiments 124s Ipcress run successfully 124s Found 1 product, as expected 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastaindex.fastafetch.test.sh 124s Made index fastafetch.test.idx 124s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx CALM_HUMAN 124s expect 0 124s >CALM_HUMAN 124s MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 124s TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 124s EFVQMMTAK 124s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx P53_HUMAN 124s expect 0 124s >P53_HUMAN 124s MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA 124s PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT 124s CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN 124s TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGR 124s DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL 124s KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD 124s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx A_MISSING_FROM_START 124s expect 1 124s ** FATAL ERROR **: Could not find identifier [A_MISSING_FROM_START] (missing -F ?) 124s exiting ... 124s ** FATAL ERROR **: Could not find identifier [M_MISSING_FROM_MIDDLE] (missing -F ?) 124s exiting ... 124s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx M_MISSING_FROM_MIDDLE 124s expect 1 124s /usr/bin/fastafetch fastafetch.test.fasta fastafetch.test.idx z_MISSING_FROM_END 124s expect 1 124s ** FATAL ERROR **: Could not find identifier [z_MISSING_FROM_END] (missing -F ?) 124s fastaindex fastafetch test OK 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastaexpode.test.sh 124s Made input file for fastaexplode 124s Make output directory for fastaexplode 124s exiting ... 124s Successfully ran fastaexplode on: fastaexplode.test.fasta 124s Expected number of seqs in output: 4 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastarefomat.test.sh 124s Reformatted OK 124s >test 124s ACGTAACCGGTTAAACCCGGGTTTAAAACCCCGGGGTTTT 124s Reformatted length consistent 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastatranslate.test.sh 124s Extraced CDS for translation 124s Tranlated sequence 124s Tranlsated sequence correct 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastacomposition.test.sh 124s Calmodulin cDNA composition correct 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastasplit.test.sh 124s Split fastasplit.test.fasta OK 124s Split into two files as expected 124s Input len 2136 124s Output len 2136 124s Input and output lengths match 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastaoverlap.test.sh 124s /usr/bin/fastaoverlap working OK 124s Generated 15 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastaclip.test.sh 124s Clipped OK 124s >test:subseq(0,4) 124s ACGT 124s Clipped input correctly 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastasoftmask.fastahardmask.test.sh 124s Softmasked OK 124s >test 124s ACGNAACCGGNNAAACCCGGGNNNAAAACCCCGGGGNNNN 124s Hardmasked OK 124s Hardmasked file is same as original masked file 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastaremove.test.sh 124s Have calmodulin in input 124s Calmodulin successfully removed 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastasubseq.test.sh 124s ** FATAL ERROR **: Could not open list for removal [CALM_HUMAN] 124s exiting ... 124s Generated correct subseq 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastaclean.test.sh 124s >CALM_HUMAN:filter(clean) 124s MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 124s TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 124s EFVQMMTAK 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastarevcomp.test.sh 124s Reverse complement created : ./data/cdna/calm.human.dna.fasta 124s Reverse complement created : fastarevcomp.rc.test.fasta 124s RC length is the same 124s RC length is the same 124s 2nd reverse complement same as original 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastadiff.test.sh 124s fastadiff: id mismatch: CALM_HUMAN P53_HUMAN 124s Different seqs recognised as different 124s Identity test OK 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastasort.test.sh 124s Sorted CALM_HUMAN 149 124s Sorted P53_HUMAN 393 124s Sorted TUBE_DROME 462 124s Sorted AF01595 1132 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastavalidcds.test.sh 124s Validiated CDS sequences OK 124s >valid_seq 124s ATGAAACCCGGGTTTTAA 124s Validated correctly a single seq from input 124s 124s 124s ** (process:2400): WARNING **: 00:55:43.511: odd_length length (7) not divisible by 3 124s 124s ** (process:2400): WARNING **: 00:55:43.511: too_short length (4) not divisible by 3 124s 124s ** (process:2400): WARNING **: 00:55:43.511: no_start missing start codon (has:AAA) 124s 124s ** (process:2400): WARNING **: 00:55:43.511: no_end missing stop codon (has:TTT) 124s 124s ** (process:2400): WARNING **: 00:55:43.511: in_frame_stop contains in-frame stop codon (pos:9, codon:TAG) 124s 124s ** (process:2400): WARNING **: 00:55:43.511: non_acgt_base contains non-ACGT base: [pos: 5 base: N] 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastalength.test.sh 124s 149 CALM_HUMAN 124s Calmodulin length OK 124s Calmodulin identifier OK 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/util/fastanrdb.test.sh 124s Made input file for fastanrdb 124s Successfully ran fastanrdb on: fastanrdb.input.test.fasta 124s Expected number of seqs in output: 4 124s 124s /tmp/autopkgtest.Uuggbh/autopkgtest_tmp/exonerate/exonerate.simple.test.sh 124s Exonerate simple test OK 124s Score as expected: 10875 124s PASS 124s autopkgtest [00:55:43]: test run-unit-test: -----------------------] 125s autopkgtest [00:55:44]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 125s run-unit-test PASS 125s autopkgtest [00:55:44]: @@@@@@@@@@@@@@@@@@@@ summary 125s run-unit-test PASS 138s Creating nova instance adt-noble-ppc64el-exonerate-20240314-005339-juju-7f2275-prod-proposed-migration-environment-2 from image adt/ubuntu-noble-ppc64el-server-20240314.img (UUID 438daa89-732e-4eab-98ca-4d7eade8166d)...