0s autopkgtest [19:07:05]: starting date and time: 2024-03-24 19:07:05+0000 0s autopkgtest [19:07:05]: git checkout: 4a1cd702 l/adt_testbed: don't blame the testbed for unsolvable build deps 0s autopkgtest [19:07:05]: host juju-7f2275-prod-proposed-migration-environment-4; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.xt699brc/out --timeout-copy=6000 --setup-commands 'ln -s /dev/null /etc/systemd/system/bluetooth.service; printf "http_proxy=http://squid.internal:3128\nhttps_proxy=http://squid.internal:3128\nno_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com\n" >> /etc/environment' --apt-pocket=proposed --apt-upgrade pyfastx --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=sqlite3/3.45.1-1ubuntu1 python3-defaults/3.12.2-0ubuntu1' -- lxd -r lxd-armhf-10.145.243.59 lxd-armhf-10.145.243.59:autopkgtest/ubuntu/noble/armhf 22s autopkgtest [19:07:27]: testbed dpkg architecture: armhf 24s autopkgtest [19:07:29]: testbed apt version: 2.7.12 24s autopkgtest [19:07:29]: @@@@@@@@@@@@@@@@@@@@ test bed setup 32s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 32s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [496 kB] 32s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [3986 kB] 32s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [57.3 kB] 32s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [6540 B] 32s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main armhf Packages [672 kB] 33s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main armhf c-n-f Metadata [2492 B] 33s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted armhf Packages [1372 B] 33s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted armhf c-n-f Metadata [116 B] 33s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe armhf Packages [4099 kB] 33s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe armhf c-n-f Metadata [7776 B] 33s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse armhf Packages [48.7 kB] 33s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse armhf c-n-f Metadata [116 B] 35s Fetched 9494 kB in 2s (4853 kB/s) 36s Reading package lists... 44s tee: /proc/self/fd/2: Permission denied 66s Hit:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease 66s Hit:2 http://ftpmaster.internal/ubuntu noble InRelease 66s Hit:3 http://ftpmaster.internal/ubuntu noble-updates InRelease 66s Hit:4 http://ftpmaster.internal/ubuntu noble-security InRelease 68s Reading package lists... 68s Reading package lists... 68s Building dependency tree... 68s Reading state information... 69s Calculating upgrade... 69s The following packages were automatically installed and are no longer required: 69s linux-headers-6.8.0-11 python3-distutils python3-lib2to3 69s Use 'apt autoremove' to remove them. 69s The following packages will be REMOVED: 69s libapt-pkg6.0 libarchive13 libatm1 libcurl3-gnutls libcurl4 libdb5.3 libelf1 69s libext2fs2 libgdbm-compat4 libgdbm6 libglib2.0-0 libgnutls30 libgpgme11 69s libhogweed6 libmagic1 libnetplan0 libnettle8 libnpth0 libnvme1 libparted2 69s libpcap0.8 libperl5.38 libpng16-16 libpsl5 libreadline8 libreiserfscore0 69s libssl3 libtirpc3 libuv1 linux-headers-6.8.0-11-generic 69s The following NEW packages will be installed: 69s libapt-pkg6.0t64 libarchive13t64 libatm1t64 libcurl3t64-gnutls libcurl4t64 69s libdb5.3t64 libelf1t64 libext2fs2t64 libgdbm-compat4t64 libgdbm6t64 69s libglib2.0-0t64 libgnutls30t64 libgpgme11t64 libhogweed6t64 libmagic1t64 69s libnetplan1 libnettle8t64 libnpth0t64 libnvme1t64 libparted2t64 69s libpcap0.8t64 libperl5.38t64 libpng16-16t64 libpsl5t64 libreadline8t64 69s libreiserfscore0t64 libssl3t64 libtirpc3t64 libuv1t64 linux-headers-6.8.0-20 69s linux-headers-6.8.0-20-generic xdg-user-dirs 69s The following packages have been kept back: 69s multipath-tools 69s The following packages will be upgraded: 69s apparmor apt apt-utils bind9-dnsutils bind9-host bind9-libs binutils 69s binutils-arm-linux-gnueabihf binutils-common bolt bsdextrautils bsdutils 69s btrfs-progs coreutils cryptsetup-bin curl dbus dbus-bin dbus-daemon 69s dbus-session-bus-common dbus-system-bus-common dbus-user-session dhcpcd-base 69s dirmngr dmsetup dpkg dpkg-dev e2fsprogs e2fsprogs-l10n eject fdisk file ftp 69s fwupd gawk gcc-13-base gcc-14-base gir1.2-girepository-2.0 gir1.2-glib-2.0 69s gnupg gnupg-l10n gnupg-utils gpg gpg-agent gpg-wks-client gpgconf gpgsm gpgv 69s groff-base ibverbs-providers inetutils-telnet info initramfs-tools 69s initramfs-tools-bin initramfs-tools-core install-info iproute2 jq keyboxd 69s kmod kpartx krb5-locales libapparmor1 libaudit-common libaudit1 libbinutils 69s libblkid1 libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 69s libblockdev-mdraid3 libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 69s libblockdev-utils3 libblockdev3 libbpf1 libbrotli1 libcap-ng0 libcom-err2 69s libcryptsetup12 libctf-nobfd0 libctf0 libdbus-1-3 libdebconfclient0 69s libdevmapper1.02.1 libdpkg-perl libevent-core-2.1-7 libexpat1 libfdisk1 69s libfido2-1 libftdi1-2 libfwupd2 libgcc-s1 libgirepository-1.0-1 69s libglib2.0-data libgssapi-krb5-2 libgudev-1.0-0 libgusb2 libibverbs1 69s libjcat1 libjq1 libjson-glib-1.0-0 libjson-glib-1.0-common libk5crypto3 69s libkmod2 libkrb5-3 libkrb5support0 libldap-common libldap2 69s liblocale-gettext-perl liblzma5 libmagic-mgc libmbim-glib4 libmbim-proxy 69s libmm-glib0 libmount1 libnghttp2-14 libnsl2 libnss-systemd libpam-modules 69s libpam-modules-bin libpam-runtime libpam-systemd libpam0g libplymouth5 69s libpolkit-agent-1-0 libpolkit-gobject-1-0 libproc2-0 libprotobuf-c1 69s libpython3-stdlib libpython3.11-minimal libpython3.11-stdlib 69s libpython3.12-minimal libpython3.12-stdlib libqmi-glib5 libqmi-proxy 69s libqrtr-glib0 librtmp1 libsasl2-2 libsasl2-modules libsasl2-modules-db 69s libseccomp2 libselinux1 libsemanage-common libsemanage2 libsframe1 libslang2 69s libsmartcols1 libsqlite3-0 libss2 libssh-4 libstdc++6 libsystemd-shared 69s libsystemd0 libtext-charwidth-perl libtext-iconv-perl libtirpc-common 69s libudev1 libudisks2-0 libusb-1.0-0 libuuid1 libvolume-key1 libxml2 libxmlb2 69s libxmuu1 linux-headers-generic logsave lshw lsof man-db mount mtr-tiny 69s netplan-generator netplan.io openssh-client openssh-server 69s openssh-sftp-server openssl parted perl perl-base perl-modules-5.38 69s pinentry-curses plymouth plymouth-theme-ubuntu-text procps psmisc 69s python-apt-common python3 python3-apt python3-cryptography python3-dbus 69s python3-distutils python3-gdbm python3-gi python3-lib2to3 python3-minimal 69s python3-netplan python3-pkg-resources python3-pyrsistent python3-setuptools 69s python3-typing-extensions python3-yaml python3.11 python3.11-minimal 69s python3.12 python3.12-minimal readline-common rsync rsyslog shared-mime-info 69s sudo systemd systemd-dev systemd-resolved systemd-sysv systemd-timesyncd 69s tcpdump telnet tnftp ubuntu-pro-client ubuntu-pro-client-l10n udev udisks2 69s usb.ids util-linux uuid-runtime vim-common vim-tiny wget xxd xz-utils zlib1g 69s 234 upgraded, 32 newly installed, 30 to remove and 1 not upgraded. 69s Need to get 100 MB of archives. 69s After this operation, 85.0 MB of additional disk space will be used. 69s Get:1 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bsdutils armhf 1:2.39.3-9ubuntu2 [102 kB] 70s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libbrotli1 armhf 1.1.0-2build1 [319 kB] 70s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgssapi-krb5-2 armhf 1.20.1-6ubuntu1 [119 kB] 70s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libkrb5-3 armhf 1.20.1-6ubuntu1 [320 kB] 70s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libkrb5support0 armhf 1.20.1-6ubuntu1 [31.5 kB] 70s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libk5crypto3 armhf 1.20.1-6ubuntu1 [78.6 kB] 70s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcom-err2 armhf 1.47.0-2.4~exp1ubuntu2 [21.9 kB] 70s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/main armhf zlib1g armhf 1:1.3.dfsg-3.1ubuntu1 [49.2 kB] 70s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2build6 [51.3 kB] 70s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/main armhf udisks2 armhf 2.10.1-6 [276 kB] 70s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libudisks2-0 armhf 2.10.1-6 [143 kB] 70s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblkid1 armhf 2.39.3-9ubuntu2 [160 kB] 70s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/main armhf liblzma5 armhf 5.6.0-0.2 [117 kB] 70s Get:14 http://ftpmaster.internal/ubuntu noble-proposed/main armhf kmod armhf 31+20240202-2ubuntu4 [91.8 kB] 70s Get:15 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libkmod2 armhf 31+20240202-2ubuntu4 [44.9 kB] 70s Get:16 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-dev all 255.4-1ubuntu5 [103 kB] 70s Get:17 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-timesyncd armhf 255.4-1ubuntu5 [36.0 kB] 70s Get:18 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-session-bus-common all 1.14.10-4ubuntu2 [80.3 kB] 70s Get:19 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libaudit-common all 1:3.1.2-2.1 [5674 B] 70s Get:20 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcap-ng0 armhf 0.8.4-2build1 [13.5 kB] 70s Get:21 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libaudit1 armhf 1:3.1.2-2.1 [44.3 kB] 70s Get:22 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam0g armhf 1.5.3-5ubuntu3 [62.0 kB] 70s Get:23 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libselinux1 armhf 3.5-2ubuntu1 [70.9 kB] 70s Get:24 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcurl4t64 armhf 8.5.0-2ubuntu8 [296 kB] 70s Get:25 http://ftpmaster.internal/ubuntu noble-proposed/main armhf curl armhf 8.5.0-2ubuntu8 [219 kB] 70s Get:26 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpsl5t64 armhf 0.21.2-1.1 [55.7 kB] 70s Get:27 http://ftpmaster.internal/ubuntu noble-proposed/main armhf wget armhf 1.21.4-1ubuntu2 [317 kB] 70s Get:28 http://ftpmaster.internal/ubuntu noble-proposed/main armhf tnftp armhf 20230507-2build1 [98.6 kB] 70s Get:29 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpcap0.8t64 armhf 1.10.4-4.1ubuntu2 [137 kB] 70s Get:30 http://ftpmaster.internal/ubuntu noble-proposed/main armhf tcpdump armhf 4.99.4-3ubuntu2 [425 kB] 70s Get:31 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsystemd-shared armhf 255.4-1ubuntu5 [2009 kB] 70s Get:32 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-resolved armhf 255.4-1ubuntu5 [289 kB] 70s Get:33 http://ftpmaster.internal/ubuntu noble-proposed/main armhf sudo armhf 1.9.15p5-3ubuntu3 [936 kB] 70s Get:34 http://ftpmaster.internal/ubuntu noble-proposed/main armhf rsync armhf 3.2.7-1build1 [413 kB] 70s Get:35 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-cryptography armhf 41.0.7-4build2 [788 kB] 70s Get:36 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssl armhf 3.0.13-0ubuntu2 [975 kB] 70s Get:37 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssh-sftp-server armhf 1:9.6p1-3ubuntu11 [35.5 kB] 70s Get:38 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssh-client armhf 1:9.6p1-3ubuntu11 [890 kB] 70s Get:39 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssh-server armhf 1:9.6p1-3ubuntu11 [503 kB] 70s Get:40 http://ftpmaster.internal/ubuntu noble-proposed/main armhf linux-headers-6.8.0-20 all 6.8.0-20.20 [13.6 MB] 71s Get:41 http://ftpmaster.internal/ubuntu noble-proposed/main armhf linux-headers-6.8.0-20-generic armhf 6.8.0-20.20 [1287 kB] 71s Get:42 http://ftpmaster.internal/ubuntu noble-proposed/main armhf linux-headers-generic armhf 6.8.0-20.20+1 [9610 B] 71s Get:43 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libssl3t64 armhf 3.0.13-0ubuntu2 [1558 kB] 71s Get:44 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnss-systemd armhf 255.4-1ubuntu5 [148 kB] 71s Get:45 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libudev1 armhf 255.4-1ubuntu5 [166 kB] 71s Get:46 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd armhf 255.4-1ubuntu5 [3502 kB] 71s Get:47 http://ftpmaster.internal/ubuntu noble-proposed/main armhf udev armhf 255.4-1ubuntu5 [1852 kB] 71s Get:48 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-sysv armhf 255.4-1ubuntu5 [11.9 kB] 71s Get:49 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-systemd armhf 255.4-1ubuntu5 [216 kB] 71s Get:50 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsystemd0 armhf 255.4-1ubuntu5 [410 kB] 71s Get:51 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-modules-bin armhf 1.5.3-5ubuntu3 [47.0 kB] 71s Get:52 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-modules armhf 1.5.3-5ubuntu3 [261 kB] 71s Get:53 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-runtime all 1.5.3-5ubuntu3 [40.8 kB] 71s Get:54 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-user-session armhf 1.14.10-4ubuntu2 [9962 B] 71s Get:55 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libapparmor1 armhf 4.0.0-beta3-0ubuntu2 [45.0 kB] 71s Get:56 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gcc-14-base armhf 14-20240315-1ubuntu1 [47.0 kB] 71s Get:57 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgcc-s1 armhf 14-20240315-1ubuntu1 [41.5 kB] 71s Get:58 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libstdc++6 armhf 14-20240315-1ubuntu1 [714 kB] 71s Get:59 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libexpat1 armhf 2.6.1-2 [65.9 kB] 71s Get:60 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-system-bus-common all 1.14.10-4ubuntu2 [81.5 kB] 71s Get:61 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-bin armhf 1.14.10-4ubuntu2 [37.1 kB] 71s Get:62 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus armhf 1.14.10-4ubuntu2 [28.1 kB] 71s Get:63 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-daemon armhf 1.14.10-4ubuntu2 [109 kB] 71s Get:64 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdbus-1-3 armhf 1.14.10-4ubuntu2 [190 kB] 71s Get:65 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmount1 armhf 2.39.3-9ubuntu2 [171 kB] 71s Get:66 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libseccomp2 armhf 2.5.5-1ubuntu2 [49.5 kB] 71s Get:67 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdevmapper1.02.1 armhf 2:1.02.185-3ubuntu2 [135 kB] 71s Get:68 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libuuid1 armhf 2.39.3-9ubuntu2 [34.4 kB] 71s Get:69 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcryptsetup12 armhf 2:2.7.0-1ubuntu2 [238 kB] 71s Get:70 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libfdisk1 armhf 2.39.3-9ubuntu2 [196 kB] 71s Get:71 http://ftpmaster.internal/ubuntu noble-proposed/main armhf mount armhf 2.39.3-9ubuntu2 [134 kB] 71s Get:72 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-utils3 armhf 3.1.0-1build1 [16.9 kB] 71s Get:73 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libvolume-key1 armhf 0.3.12-7build1 [38.4 kB] 71s Get:74 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjcat1 armhf 0.2.0-2build2 [30.4 kB] 71s Get:75 http://ftpmaster.internal/ubuntu noble-proposed/main armhf parted armhf 3.6-3.1build2 [39.4 kB] 71s Get:76 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libparted2t64 armhf 3.6-3.1build2 [143 kB] 71s Get:77 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.12 armhf 3.12.2-4build3 [645 kB] 71s Get:78 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.12-minimal armhf 3.12.2-4build3 [1942 kB] 71s Get:79 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.12-stdlib armhf 3.12.2-4build3 [1906 kB] 71s Get:80 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.12-minimal armhf 3.12.2-4build3 [816 kB] 71s Get:81 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-5ubuntu1 [19.0 kB] 71s Get:82 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.11 armhf 3.11.8-1build4 [589 kB] 71s Get:83 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.11-minimal armhf 3.11.8-1build4 [1795 kB] 71s Get:84 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.11-stdlib armhf 3.11.8-1build4 [1810 kB] 71s Get:85 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.11-minimal armhf 3.11.8-1build4 [826 kB] 71s Get:86 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsqlite3-0 armhf 3.45.1-1ubuntu1 [599 kB] 71s Get:87 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtext-iconv-perl armhf 1.7-8build2 [12.7 kB] 71s Get:88 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtext-charwidth-perl armhf 0.04-11build2 [8962 B] 71s Get:89 http://ftpmaster.internal/ubuntu noble-proposed/main armhf perl-modules-5.38 all 5.38.2-3.2 [3110 kB] 72s Get:90 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdb5.3t64 armhf 5.3.28+dfsg2-6 [661 kB] 72s Get:91 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-gdbm armhf 3.12.2-3ubuntu1.1 [17.1 kB] 72s Get:92 http://ftpmaster.internal/ubuntu noble-proposed/main armhf man-db armhf 2.12.0-3build4 [1196 kB] 72s Get:93 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgdbm6t64 armhf 1.23-5.1 [30.3 kB] 72s Get:94 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgdbm-compat4t64 armhf 1.23-5.1 [6208 B] 72s Get:95 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libperl5.38t64 armhf 5.38.2-3.2 [4101 kB] 72s Get:96 http://ftpmaster.internal/ubuntu noble-proposed/main armhf perl armhf 5.38.2-3.2 [231 kB] 72s Get:97 http://ftpmaster.internal/ubuntu noble-proposed/main armhf perl-base armhf 5.38.2-3.2 [1671 kB] 72s Get:98 http://ftpmaster.internal/ubuntu noble-proposed/main armhf liblocale-gettext-perl armhf 1.07-6ubuntu4 [15.0 kB] 72s Get:99 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnettle8t64 armhf 3.9.1-2.2 [187 kB] 72s Get:100 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libhogweed6t64 armhf 3.9.1-2.2 [187 kB] 72s Get:101 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgnutls30t64 armhf 3.8.3-1.1ubuntu2 [1046 kB] 72s Get:102 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libldap2 armhf 2.6.7+dfsg-1~exp1ubuntu6 [172 kB] 72s Get:103 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcurl3t64-gnutls armhf 8.5.0-2ubuntu8 [290 kB] 72s Get:104 http://ftpmaster.internal/ubuntu noble-proposed/main armhf shared-mime-info armhf 2.4-1build1 [470 kB] 73s Get:105 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gir1.2-girepository-2.0 armhf 1.79.1-1ubuntu6 [24.8 kB] 73s Get:106 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gir1.2-glib-2.0 armhf 2.79.3-3ubuntu5 [182 kB] 73s Get:107 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgirepository-1.0-1 armhf 1.79.1-1ubuntu6 [106 kB] 73s Get:108 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-gi armhf 3.47.0-3build1 [219 kB] 73s Get:109 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-dbus armhf 1.3.2-5build2 [94.7 kB] 73s Get:110 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnetplan1 armhf 1.0-1 [113 kB] 73s Get:111 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-netplan armhf 1.0-1 [22.5 kB] 73s Get:112 http://ftpmaster.internal/ubuntu noble-proposed/main armhf netplan-generator armhf 1.0-1 [58.7 kB] 73s Get:113 http://ftpmaster.internal/ubuntu noble-proposed/main armhf initramfs-tools-bin armhf 0.142ubuntu23 [20.3 kB] 73s Get:114 http://ftpmaster.internal/ubuntu noble-proposed/main armhf initramfs-tools-core all 0.142ubuntu23 [50.1 kB] 73s Get:115 http://ftpmaster.internal/ubuntu noble-proposed/main armhf initramfs-tools all 0.142ubuntu23 [9058 B] 73s Get:116 http://ftpmaster.internal/ubuntu noble-proposed/main armhf netplan.io armhf 1.0-1 [64.3 kB] 73s Get:117 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libxmlb2 armhf 0.3.15-1build1 [57.0 kB] 73s Get:118 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libqrtr-glib0 armhf 1.2.2-1ubuntu3 [15.4 kB] 73s Get:119 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libqmi-glib5 armhf 1.35.2-0ubuntu1 [908 kB] 74s Get:120 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libqmi-proxy armhf 1.35.2-0ubuntu1 [5732 B] 74s Get:121 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpolkit-agent-1-0 armhf 124-1ubuntu1 [15.3 kB] 74s Get:122 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpolkit-gobject-1-0 armhf 124-1ubuntu1 [44.1 kB] 74s Get:123 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libglib2.0-0t64 armhf 2.79.3-3ubuntu5 [1414 kB] 74s Get:124 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libfwupd2 armhf 1.9.15-2 [123 kB] 74s Get:125 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libarchive13t64 armhf 3.7.2-1.1ubuntu2 [330 kB] 74s Get:126 http://ftpmaster.internal/ubuntu noble-proposed/main armhf fwupd armhf 1.9.15-2 [4350 kB] 75s Get:127 http://ftpmaster.internal/ubuntu noble-proposed/main armhf apt-utils armhf 2.7.14 [210 kB] 75s Get:128 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libapt-pkg6.0t64 armhf 2.7.14 [986 kB] 75s Get:129 http://ftpmaster.internal/ubuntu noble-proposed/main armhf apt armhf 2.7.14 [1368 kB] 75s Get:130 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ubuntu-pro-client-l10n armhf 31.2.1 [19.4 kB] 75s Get:131 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ubuntu-pro-client armhf 31.2.1 [216 kB] 75s Get:132 http://ftpmaster.internal/ubuntu noble-proposed/main armhf keyboxd armhf 2.4.4-2ubuntu15 [111 kB] 75s Get:133 http://ftpmaster.internal/ubuntu noble/main armhf libnpth0t64 armhf 1.6-3.1 [6940 B] 75s Get:134 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpgv armhf 2.4.4-2ubuntu15 [224 kB] 75s Get:135 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpg armhf 2.4.4-2ubuntu15 [524 kB] 75s Get:136 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpg-wks-client armhf 2.4.4-2ubuntu15 [87.4 kB] 76s Get:137 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gnupg-utils armhf 2.4.4-2ubuntu15 [158 kB] 76s Get:138 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpg-agent armhf 2.4.4-2ubuntu15 [235 kB] 76s Get:139 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpgsm armhf 2.4.4-2ubuntu15 [241 kB] 76s Get:140 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libreadline8t64 armhf 8.2-4 [129 kB] 76s Get:141 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gawk armhf 1:5.2.1-2build2 [415 kB] 76s Get:142 http://ftpmaster.internal/ubuntu noble-proposed/main armhf fdisk armhf 2.39.3-9ubuntu2 [135 kB] 76s Get:143 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpgconf armhf 2.4.4-2ubuntu15 [115 kB] 76s Get:144 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dirmngr armhf 2.4.4-2ubuntu15 [346 kB] 76s Get:145 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gnupg all 2.4.4-2ubuntu15 [359 kB] 76s Get:146 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-apt armhf 2.7.7 [162 kB] 76s Get:147 http://ftpmaster.internal/ubuntu noble-proposed/main armhf pinentry-curses armhf 1.2.1-3ubuntu4 [36.7 kB] 76s Get:148 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-yaml armhf 6.0.1-2build1 [117 kB] 76s Get:149 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python-apt-common all 2.7.7 [19.8 kB] 76s Get:150 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-setuptools all 68.1.2-2ubuntu1 [396 kB] 76s Get:151 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-pkg-resources all 68.1.2-2ubuntu1 [168 kB] 76s Get:152 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dpkg armhf 1.22.6ubuntu4 [1229 kB] 76s Get:153 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-minimal armhf 3.12.2-0ubuntu1 [27.1 kB] 76s Get:154 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3 armhf 3.12.2-0ubuntu1 [24.1 kB] 76s Get:155 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3-stdlib armhf 3.12.2-0ubuntu1 [9802 B] 76s Get:156 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsmartcols1 armhf 2.39.3-9ubuntu2 [117 kB] 76s Get:157 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bsdextrautils armhf 2.39.3-9ubuntu2 [78.7 kB] 76s Get:158 http://ftpmaster.internal/ubuntu noble-proposed/main armhf groff-base armhf 1.23.0-3build1 [946 kB] 76s Get:159 http://ftpmaster.internal/ubuntu noble-proposed/main armhf readline-common all 8.2-4 [56.4 kB] 76s Get:160 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgpgme11t64 armhf 1.18.0-4.1ubuntu3 [120 kB] 76s Get:161 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-crypto3 armhf 3.1.0-1build1 [20.3 kB] 76s Get:162 http://ftpmaster.internal/ubuntu noble-proposed/main armhf e2fsprogs-l10n all 1.47.0-2.4~exp1ubuntu2 [5996 B] 76s Get:163 http://ftpmaster.internal/ubuntu noble-proposed/main armhf logsave armhf 1.47.0-2.4~exp1ubuntu2 [21.9 kB] 76s Get:164 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dhcpcd-base armhf 1:10.0.6-1ubuntu2 [186 kB] 76s Get:165 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-fs3 armhf 3.1.0-1build1 [34.4 kB] 76s Get:166 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libreiserfscore0t64 armhf 1:3.6.27-7.1 [66.2 kB] 76s Get:167 http://ftpmaster.internal/ubuntu noble-proposed/main armhf btrfs-progs armhf 6.6.3-1.1build1 [852 kB] 76s Get:168 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libext2fs2t64 armhf 1.47.0-2.4~exp1ubuntu2 [201 kB] 76s Get:169 http://ftpmaster.internal/ubuntu noble-proposed/main armhf e2fsprogs armhf 1.47.0-2.4~exp1ubuntu2 [571 kB] 76s Get:170 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-loop3 armhf 3.1.0-1build1 [6502 B] 76s Get:171 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-mdraid3 armhf 3.1.0-1build1 [13.3 kB] 76s Get:172 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-nvme3 armhf 3.1.0-1build1 [17.5 kB] 76s Get:173 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnvme1t64 armhf 1.8-3 [67.5 kB] 76s Get:174 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-part3 armhf 3.1.0-1build1 [16.4 kB] 76s Get:175 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-swap3 armhf 3.1.0-1build1 [8894 B] 76s Get:176 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev3 armhf 3.1.0-1build1 [42.9 kB] 76s Get:177 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgudev-1.0-0 armhf 1:238-3ubuntu2 [13.6 kB] 76s Get:178 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libxml2 armhf 2.9.14+dfsg-1.3ubuntu2 [595 kB] 76s Get:179 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libbpf1 armhf 1:1.3.0-2build1 [146 kB] 76s Get:180 http://ftpmaster.internal/ubuntu noble-proposed/main armhf iproute2 armhf 6.1.0-1ubuntu5 [1060 kB] 76s Get:181 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libelf1t64 armhf 0.190-1.1build2 [49.9 kB] 76s Get:182 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtirpc-common all 1.3.4+ds-1.1 [8018 B] 76s Get:183 http://ftpmaster.internal/ubuntu noble-proposed/main armhf lsof armhf 4.95.0-1build2 [248 kB] 76s Get:184 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnsl2 armhf 1.3.0-3build2 [36.5 kB] 76s Get:185 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtirpc3t64 armhf 1.3.4+ds-1.1 [73.2 kB] 76s Get:186 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmbim-proxy armhf 1.31.2-0ubuntu2 [5748 B] 76s Get:187 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmbim-glib4 armhf 1.31.2-0ubuntu2 [216 kB] 76s Get:188 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjson-glib-1.0-common all 1.8.0-2build1 [4210 B] 76s Get:189 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjson-glib-1.0-0 armhf 1.8.0-2build1 [61.2 kB] 76s Get:190 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnghttp2-14 armhf 1.59.0-1build1 [68.1 kB] 76s Get:191 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libssh-4 armhf 0.10.6-2build1 [169 kB] 76s Get:192 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libusb-1.0-0 armhf 2:1.0.27-1 [48.7 kB] 76s Get:193 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgusb2 armhf 0.4.8-1build1 [34.6 kB] 76s Get:194 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmm-glib0 armhf 1.23.4-0ubuntu1 [214 kB] 77s Get:195 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libprotobuf-c1 armhf 1.4.1-1ubuntu3 [17.7 kB] 77s Get:196 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsasl2-2 armhf 2.1.28+dfsg1-5ubuntu1 [49.7 kB] 77s Get:197 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libibverbs1 armhf 50.0-2build1 [57.9 kB] 77s Get:198 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libfido2-1 armhf 1.14.0-1build1 [75.8 kB] 77s Get:199 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libproc2-0 armhf 2:4.0.4-4ubuntu2 [49.0 kB] 77s Get:200 http://ftpmaster.internal/ubuntu noble-proposed/main armhf procps armhf 2:4.0.4-4ubuntu2 [700 kB] 77s Get:201 http://ftpmaster.internal/ubuntu noble-proposed/main armhf coreutils armhf 9.4-3ubuntu3 [1280 kB] 77s Get:202 http://ftpmaster.internal/ubuntu noble-proposed/main armhf util-linux armhf 2.39.3-9ubuntu2 [1216 kB] 77s Get:203 http://ftpmaster.internal/ubuntu noble-proposed/main armhf file armhf 1:5.45-3 [21.1 kB] 77s Get:204 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmagic-mgc armhf 1:5.45-3 [307 kB] 77s Get:205 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmagic1t64 armhf 1:5.45-3 [81.4 kB] 77s Get:206 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libplymouth5 armhf 24.004.60-1ubuntu6 [140 kB] 77s Get:207 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpng16-16t64 armhf 1.6.43-3 [166 kB] 77s Get:208 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bind9-host armhf 1:9.18.24-0ubuntu3 [47.4 kB] 77s Get:209 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bind9-dnsutils armhf 1:9.18.24-0ubuntu3 [149 kB] 77s Get:210 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bind9-libs armhf 1:9.18.24-0ubuntu3 [1148 kB] 77s Get:211 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libuv1t64 armhf 1.48.0-1.1 [82.9 kB] 77s Get:212 http://ftpmaster.internal/ubuntu noble-proposed/main armhf uuid-runtime armhf 2.39.3-9ubuntu2 [41.7 kB] 77s Get:213 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdebconfclient0 armhf 0.271ubuntu2 [10.8 kB] 77s Get:214 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsemanage-common all 3.5-1build4 [10.1 kB] 77s Get:215 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsemanage2 armhf 3.5-1build4 [84.5 kB] 77s Get:216 http://ftpmaster.internal/ubuntu noble-proposed/main armhf install-info armhf 7.1-3build1 [60.5 kB] 77s Get:217 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gcc-13-base armhf 13.2.0-21ubuntu1 [48.3 kB] 77s Get:218 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libss2 armhf 1.47.0-2.4~exp1ubuntu2 [14.7 kB] 77s Get:219 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dmsetup armhf 2:1.02.185-3ubuntu2 [81.1 kB] 77s Get:220 http://ftpmaster.internal/ubuntu noble-proposed/main armhf eject armhf 2.39.3-9ubuntu2 [43.2 kB] 78s Get:221 http://ftpmaster.internal/ubuntu noble-proposed/main armhf krb5-locales all 1.20.1-6ubuntu1 [13.8 kB] 78s Get:222 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libglib2.0-data all 2.79.3-3ubuntu5 [46.6 kB] 78s Get:223 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libslang2 armhf 2.3.3-3build1 [478 kB] 78s Get:224 http://ftpmaster.internal/ubuntu noble-proposed/main armhf rsyslog armhf 8.2312.0-3ubuntu7 [460 kB] 78s Get:225 http://ftpmaster.internal/ubuntu noble-proposed/main armhf vim-tiny armhf 2:9.1.0016-1ubuntu6 [665 kB] 78s Get:226 http://ftpmaster.internal/ubuntu noble-proposed/main armhf vim-common all 2:9.1.0016-1ubuntu6 [385 kB] 78s Get:227 http://ftpmaster.internal/ubuntu noble/main armhf xdg-user-dirs armhf 0.18-1 [17.3 kB] 78s Get:228 http://ftpmaster.internal/ubuntu noble-proposed/main armhf xxd armhf 2:9.1.0016-1ubuntu6 [62.5 kB] 78s Get:229 http://ftpmaster.internal/ubuntu noble-proposed/main armhf apparmor armhf 4.0.0-beta3-0ubuntu2 [562 kB] 78s Get:230 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ftp all 20230507-2build1 [4724 B] 78s Get:231 http://ftpmaster.internal/ubuntu noble-proposed/main armhf inetutils-telnet armhf 2:2.5-3ubuntu3 [90.7 kB] 78s Get:232 http://ftpmaster.internal/ubuntu noble-proposed/main armhf info armhf 7.1-3build1 [127 kB] 78s Get:233 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libxmuu1 armhf 2:1.1.3-3build1 [8004 B] 78s Get:234 http://ftpmaster.internal/ubuntu noble-proposed/main armhf lshw armhf 02.19.git.2021.06.19.996aaad9c7-2build2 [310 kB] 78s Get:235 http://ftpmaster.internal/ubuntu noble-proposed/main armhf mtr-tiny armhf 0.95-1.1build1 [51.7 kB] 78s Get:236 http://ftpmaster.internal/ubuntu noble-proposed/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-1ubuntu6 [9818 B] 78s Get:237 http://ftpmaster.internal/ubuntu noble-proposed/main armhf plymouth armhf 24.004.60-1ubuntu6 [142 kB] 78s Get:238 http://ftpmaster.internal/ubuntu noble-proposed/main armhf psmisc armhf 23.7-1 [176 kB] 78s Get:239 http://ftpmaster.internal/ubuntu noble-proposed/main armhf telnet all 0.17+2.5-3ubuntu3 [3682 B] 78s Get:240 http://ftpmaster.internal/ubuntu noble-proposed/main armhf usb.ids all 2024.03.18-1 [223 kB] 78s Get:241 http://ftpmaster.internal/ubuntu noble-proposed/main armhf xz-utils armhf 5.6.0-0.2 [271 kB] 78s Get:242 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libctf0 armhf 2.42-4ubuntu1 [87.7 kB] 78s Get:243 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libctf-nobfd0 armhf 2.42-4ubuntu1 [88.0 kB] 78s Get:244 http://ftpmaster.internal/ubuntu noble-proposed/main armhf binutils-arm-linux-gnueabihf armhf 2.42-4ubuntu1 [2925 kB] 78s Get:245 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libbinutils armhf 2.42-4ubuntu1 [464 kB] 78s Get:246 http://ftpmaster.internal/ubuntu noble-proposed/main armhf binutils armhf 2.42-4ubuntu1 [3078 B] 78s Get:247 http://ftpmaster.internal/ubuntu noble-proposed/main armhf binutils-common armhf 2.42-4ubuntu1 [217 kB] 78s Get:248 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsframe1 armhf 2.42-4ubuntu1 [13.1 kB] 78s Get:249 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bolt armhf 0.9.6-2build1 [138 kB] 78s Get:250 http://ftpmaster.internal/ubuntu noble-proposed/main armhf cryptsetup-bin armhf 2:2.7.0-1ubuntu2 [214 kB] 78s Get:251 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dpkg-dev all 1.22.6ubuntu4 [1074 kB] 78s Get:252 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdpkg-perl all 1.22.6ubuntu4 [268 kB] 78s Get:253 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gnupg-l10n all 2.4.4-2ubuntu15 [65.8 kB] 78s Get:254 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ibverbs-providers armhf 50.0-2build1 [27.4 kB] 78s Get:255 http://ftpmaster.internal/ubuntu noble-proposed/main armhf jq armhf 1.7.1-3 [65.2 kB] 78s Get:256 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjq1 armhf 1.7.1-3 [156 kB] 78s Get:257 http://ftpmaster.internal/ubuntu noble/main armhf libatm1t64 armhf 1:2.5.1-5.1 [20.0 kB] 78s Get:258 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libevent-core-2.1-7 armhf 2.1.12-stable-9build1 [82.3 kB] 78s Get:259 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libftdi1-2 armhf 1.5-6build4 [25.7 kB] 78s Get:260 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libldap-common all 2.6.7+dfsg-1~exp1ubuntu6 [31.3 kB] 78s Get:261 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsasl2-modules armhf 2.1.28+dfsg1-5ubuntu1 [61.3 kB] 78s Get:262 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-distutils all 3.12.2-3ubuntu1.1 [133 kB] 78s Get:263 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-lib2to3 all 3.12.2-3ubuntu1.1 [79.1 kB] 78s Get:264 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-pyrsistent armhf 0.20.0-1build1 [53.0 kB] 78s Get:265 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-typing-extensions all 4.10.0-1 [60.7 kB] 78s Get:266 http://ftpmaster.internal/ubuntu noble-proposed/main armhf kpartx armhf 0.9.4-5ubuntu6 [31.5 kB] 80s Preconfiguring packages ... 80s Fetched 100 MB in 9s (11.0 MB/s) 81s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 81s Preparing to unpack .../bsdutils_1%3a2.39.3-9ubuntu2_armhf.deb ... 81s Unpacking bsdutils (1:2.39.3-9ubuntu2) over (1:2.39.3-6ubuntu2) ... 81s Setting up bsdutils (1:2.39.3-9ubuntu2) ... 81s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 81s Preparing to unpack .../0-libbrotli1_1.1.0-2build1_armhf.deb ... 81s Unpacking libbrotli1:armhf (1.1.0-2build1) over (1.1.0-2) ... 81s Preparing to unpack .../1-libgssapi-krb5-2_1.20.1-6ubuntu1_armhf.deb ... 81s Unpacking libgssapi-krb5-2:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 81s Preparing to unpack .../2-libkrb5-3_1.20.1-6ubuntu1_armhf.deb ... 81s Unpacking libkrb5-3:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 81s Preparing to unpack .../3-libkrb5support0_1.20.1-6ubuntu1_armhf.deb ... 81s Unpacking libkrb5support0:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 82s Preparing to unpack .../4-libk5crypto3_1.20.1-6ubuntu1_armhf.deb ... 82s Unpacking libk5crypto3:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 82s Preparing to unpack .../5-libcom-err2_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 82s Unpacking libcom-err2:armhf (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 82s Preparing to unpack .../6-zlib1g_1%3a1.3.dfsg-3.1ubuntu1_armhf.deb ... 82s Unpacking zlib1g:armhf (1:1.3.dfsg-3.1ubuntu1) over (1:1.3.dfsg-3ubuntu1) ... 82s Setting up zlib1g:armhf (1:1.3.dfsg-3.1ubuntu1) ... 82s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 82s Preparing to unpack .../librtmp1_2.4+20151223.gitfa8646d.1-2build6_armhf.deb ... 82s Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2build6) over (2.4+20151223.gitfa8646d.1-2build4) ... 82s Preparing to unpack .../udisks2_2.10.1-6_armhf.deb ... 82s Unpacking udisks2 (2.10.1-6) over (2.10.1-1ubuntu2) ... 82s Preparing to unpack .../libudisks2-0_2.10.1-6_armhf.deb ... 82s Unpacking libudisks2-0:armhf (2.10.1-6) over (2.10.1-1ubuntu2) ... 82s Preparing to unpack .../libblkid1_2.39.3-9ubuntu2_armhf.deb ... 82s Unpacking libblkid1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 83s Setting up libblkid1:armhf (2.39.3-9ubuntu2) ... 83s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 83s Preparing to unpack .../liblzma5_5.6.0-0.2_armhf.deb ... 83s Unpacking liblzma5:armhf (5.6.0-0.2) over (5.4.5-0.3) ... 83s Setting up liblzma5:armhf (5.6.0-0.2) ... 83s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 83s Preparing to unpack .../0-kmod_31+20240202-2ubuntu4_armhf.deb ... 83s Unpacking kmod (31+20240202-2ubuntu4) over (30+20230601-2ubuntu1) ... 83s dpkg: warning: unable to delete old directory '/lib/modprobe.d': Directory not empty 83s Preparing to unpack .../1-libkmod2_31+20240202-2ubuntu4_armhf.deb ... 83s Unpacking libkmod2:armhf (31+20240202-2ubuntu4) over (30+20230601-2ubuntu1) ... 83s Preparing to unpack .../2-systemd-dev_255.4-1ubuntu5_all.deb ... 83s Unpacking systemd-dev (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 83s Preparing to unpack .../3-systemd-timesyncd_255.4-1ubuntu5_armhf.deb ... 83s Unpacking systemd-timesyncd (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 83s Preparing to unpack .../4-dbus-session-bus-common_1.14.10-4ubuntu2_all.deb ... 83s Unpacking dbus-session-bus-common (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 83s Preparing to unpack .../5-libaudit-common_1%3a3.1.2-2.1_all.deb ... 83s Unpacking libaudit-common (1:3.1.2-2.1) over (1:3.1.2-2) ... 84s Setting up libaudit-common (1:3.1.2-2.1) ... 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 84s Preparing to unpack .../libcap-ng0_0.8.4-2build1_armhf.deb ... 84s Unpacking libcap-ng0:armhf (0.8.4-2build1) over (0.8.4-2) ... 84s Setting up libcap-ng0:armhf (0.8.4-2build1) ... 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 84s Preparing to unpack .../libaudit1_1%3a3.1.2-2.1_armhf.deb ... 84s Unpacking libaudit1:armhf (1:3.1.2-2.1) over (1:3.1.2-2) ... 84s Setting up libaudit1:armhf (1:3.1.2-2.1) ... 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 84s Preparing to unpack .../libpam0g_1.5.3-5ubuntu3_armhf.deb ... 84s Unpacking libpam0g:armhf (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 84s Setting up libpam0g:armhf (1.5.3-5ubuntu3) ... 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 84s Preparing to unpack .../libselinux1_3.5-2ubuntu1_armhf.deb ... 84s Unpacking libselinux1:armhf (3.5-2ubuntu1) over (3.5-2build1) ... 84s Setting up libselinux1:armhf (3.5-2ubuntu1) ... 84s dpkg: libcurl4:armhf: dependency problems, but removing anyway as you requested: 84s curl depends on libcurl4 (= 8.5.0-2ubuntu2). 84s 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 84s Removing libcurl4:armhf (8.5.0-2ubuntu2) ... 84s Selecting previously unselected package libcurl4t64:armhf. 84s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58613 files and directories currently installed.) 84s Preparing to unpack .../libcurl4t64_8.5.0-2ubuntu8_armhf.deb ... 84s Unpacking libcurl4t64:armhf (8.5.0-2ubuntu8) ... 84s Preparing to unpack .../curl_8.5.0-2ubuntu8_armhf.deb ... 84s Unpacking curl (8.5.0-2ubuntu8) over (8.5.0-2ubuntu2) ... 85s dpkg: libpsl5:armhf: dependency problems, but removing anyway as you requested: 85s wget depends on libpsl5 (>= 0.16.0). 85s libcurl3-gnutls:armhf depends on libpsl5 (>= 0.16.0). 85s 85s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 85s Removing libpsl5:armhf (0.21.2-1build1) ... 85s Selecting previously unselected package libpsl5t64:armhf. 85s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58614 files and directories currently installed.) 85s Preparing to unpack .../libpsl5t64_0.21.2-1.1_armhf.deb ... 85s Unpacking libpsl5t64:armhf (0.21.2-1.1) ... 85s Preparing to unpack .../wget_1.21.4-1ubuntu2_armhf.deb ... 85s Unpacking wget (1.21.4-1ubuntu2) over (1.21.4-1ubuntu1) ... 85s Preparing to unpack .../tnftp_20230507-2build1_armhf.deb ... 85s Unpacking tnftp (20230507-2build1) over (20230507-2) ... 85s dpkg: libpcap0.8:armhf: dependency problems, but removing anyway as you requested: 85s tcpdump depends on libpcap0.8 (>= 1.9.1). 85s 85s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58620 files and directories currently installed.) 85s Removing libpcap0.8:armhf (1.10.4-4ubuntu3) ... 85s Selecting previously unselected package libpcap0.8t64:armhf. 85s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58609 files and directories currently installed.) 85s Preparing to unpack .../00-libpcap0.8t64_1.10.4-4.1ubuntu2_armhf.deb ... 85s Unpacking libpcap0.8t64:armhf (1.10.4-4.1ubuntu2) ... 85s Preparing to unpack .../01-tcpdump_4.99.4-3ubuntu2_armhf.deb ... 85s Unpacking tcpdump (4.99.4-3ubuntu2) over (4.99.4-3ubuntu1) ... 85s Preparing to unpack .../02-libsystemd-shared_255.4-1ubuntu5_armhf.deb ... 85s Unpacking libsystemd-shared:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 85s Preparing to unpack .../03-systemd-resolved_255.4-1ubuntu5_armhf.deb ... 85s Unpacking systemd-resolved (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 85s Preparing to unpack .../04-sudo_1.9.15p5-3ubuntu3_armhf.deb ... 85s Unpacking sudo (1.9.15p5-3ubuntu3) over (1.9.15p5-3ubuntu1) ... 85s Preparing to unpack .../05-rsync_3.2.7-1build1_armhf.deb ... 85s Unpacking rsync (3.2.7-1build1) over (3.2.7-1) ... 85s Preparing to unpack .../06-python3-cryptography_41.0.7-4build2_armhf.deb ... 85s Unpacking python3-cryptography (41.0.7-4build2) over (41.0.7-3) ... 86s Preparing to unpack .../07-openssl_3.0.13-0ubuntu2_armhf.deb ... 86s Unpacking openssl (3.0.13-0ubuntu2) over (3.0.10-1ubuntu4) ... 86s Preparing to unpack .../08-openssh-sftp-server_1%3a9.6p1-3ubuntu11_armhf.deb ... 86s Unpacking openssh-sftp-server (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 86s Preparing to unpack .../09-openssh-client_1%3a9.6p1-3ubuntu11_armhf.deb ... 86s Unpacking openssh-client (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 86s Preparing to unpack .../10-openssh-server_1%3a9.6p1-3ubuntu11_armhf.deb ... 86s Unpacking openssh-server (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 86s Selecting previously unselected package linux-headers-6.8.0-20. 86s Preparing to unpack .../11-linux-headers-6.8.0-20_6.8.0-20.20_all.deb ... 86s Unpacking linux-headers-6.8.0-20 (6.8.0-20.20) ... 89s Selecting previously unselected package linux-headers-6.8.0-20-generic. 89s Preparing to unpack .../12-linux-headers-6.8.0-20-generic_6.8.0-20.20_armhf.deb ... 89s Unpacking linux-headers-6.8.0-20-generic (6.8.0-20.20) ... 91s Preparing to unpack .../13-linux-headers-generic_6.8.0-20.20+1_armhf.deb ... 91s Unpacking linux-headers-generic (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 91s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 89772 files and directories currently installed.) 91s Removing linux-headers-6.8.0-11-generic (6.8.0-11.11) ... 91s dpkg: libssl3:armhf: dependency problems, but removing anyway as you requested: 91s systemd depends on libssl3 (>= 3.0.0). 91s libssh-4:armhf depends on libssl3 (>= 3.0.0). 91s libsasl2-modules:armhf depends on libssl3 (>= 3.0.0). 91s libsasl2-2:armhf depends on libssl3 (>= 3.0.0). 91s libpython3.12-minimal:armhf depends on libssl3 (>= 3.0.0). 91s libpython3.11-minimal:armhf depends on libssl3 (>= 3.0.0). 91s libnvme1 depends on libssl3 (>= 3.0.0). 91s libfido2-1:armhf depends on libssl3 (>= 3.0.0). 91s libcryptsetup12:armhf depends on libssl3 (>= 3.0.0). 91s dhcpcd-base depends on libssl3 (>= 3.0.0). 91s bind9-libs:armhf depends on libssl3 (>= 3.0.0). 91s 91s Removing libssl3:armhf (3.0.10-1ubuntu4) ... 91s Selecting previously unselected package libssl3t64:armhf. 91s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78622 files and directories currently installed.) 91s Preparing to unpack .../libssl3t64_3.0.13-0ubuntu2_armhf.deb ... 91s Unpacking libssl3t64:armhf (3.0.13-0ubuntu2) ... 91s Setting up libssl3t64:armhf (3.0.13-0ubuntu2) ... 91s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 91s Preparing to unpack .../libnss-systemd_255.4-1ubuntu5_armhf.deb ... 91s Unpacking libnss-systemd:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 91s Preparing to unpack .../libudev1_255.4-1ubuntu5_armhf.deb ... 91s Unpacking libudev1:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 91s Setting up libudev1:armhf (255.4-1ubuntu5) ... 91s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 91s Preparing to unpack .../systemd_255.4-1ubuntu5_armhf.deb ... 91s Unpacking systemd (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 92s Preparing to unpack .../udev_255.4-1ubuntu5_armhf.deb ... 92s Unpacking udev (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 93s Preparing to unpack .../libsystemd0_255.4-1ubuntu5_armhf.deb ... 93s Unpacking libsystemd0:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 93s Setting up libsystemd0:armhf (255.4-1ubuntu5) ... 93s Setting up libkmod2:armhf (31+20240202-2ubuntu4) ... 93s Setting up libsystemd-shared:armhf (255.4-1ubuntu5) ... 93s Setting up systemd-dev (255.4-1ubuntu5) ... 93s Setting up systemd (255.4-1ubuntu5) ... 93s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 93s Preparing to unpack .../systemd-sysv_255.4-1ubuntu5_armhf.deb ... 93s Unpacking systemd-sysv (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 93s Preparing to unpack .../libpam-systemd_255.4-1ubuntu5_armhf.deb ... 93s Unpacking libpam-systemd:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 93s Preparing to unpack .../libpam-modules-bin_1.5.3-5ubuntu3_armhf.deb ... 93s Unpacking libpam-modules-bin (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 94s Setting up libpam-modules-bin (1.5.3-5ubuntu3) ... 94s pam_namespace.service is a disabled or a static unit not running, not starting it. 94s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 94s Preparing to unpack .../libpam-modules_1.5.3-5ubuntu3_armhf.deb ... 94s Unpacking libpam-modules:armhf (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 94s Setting up libpam-modules:armhf (1.5.3-5ubuntu3) ... 94s Installing new version of config file /etc/security/namespace.init ... 94s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 94s Preparing to unpack .../libpam-runtime_1.5.3-5ubuntu3_all.deb ... 94s Unpacking libpam-runtime (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 94s Setting up libpam-runtime (1.5.3-5ubuntu3) ... 94s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 94s Preparing to unpack .../dbus-user-session_1.14.10-4ubuntu2_armhf.deb ... 94s Unpacking dbus-user-session (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 94s Preparing to unpack .../libapparmor1_4.0.0-beta3-0ubuntu2_armhf.deb ... 94s Unpacking libapparmor1:armhf (4.0.0-beta3-0ubuntu2) over (4.0.0~alpha4-0ubuntu1) ... 95s Preparing to unpack .../gcc-14-base_14-20240315-1ubuntu1_armhf.deb ... 95s Unpacking gcc-14-base:armhf (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 95s Setting up gcc-14-base:armhf (14-20240315-1ubuntu1) ... 95s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 95s Preparing to unpack .../libgcc-s1_14-20240315-1ubuntu1_armhf.deb ... 95s Unpacking libgcc-s1:armhf (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 95s Setting up libgcc-s1:armhf (14-20240315-1ubuntu1) ... 95s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 95s Preparing to unpack .../libstdc++6_14-20240315-1ubuntu1_armhf.deb ... 95s Unpacking libstdc++6:armhf (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 95s Setting up libstdc++6:armhf (14-20240315-1ubuntu1) ... 95s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 95s Preparing to unpack .../0-libexpat1_2.6.1-2_armhf.deb ... 95s Unpacking libexpat1:armhf (2.6.1-2) over (2.6.0-1) ... 95s Preparing to unpack .../1-dbus-system-bus-common_1.14.10-4ubuntu2_all.deb ... 95s Unpacking dbus-system-bus-common (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 95s Preparing to unpack .../2-dbus-bin_1.14.10-4ubuntu2_armhf.deb ... 95s Unpacking dbus-bin (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 95s Preparing to unpack .../3-dbus_1.14.10-4ubuntu2_armhf.deb ... 95s Unpacking dbus (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 95s Preparing to unpack .../4-dbus-daemon_1.14.10-4ubuntu2_armhf.deb ... 95s Unpacking dbus-daemon (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 95s Preparing to unpack .../5-libdbus-1-3_1.14.10-4ubuntu2_armhf.deb ... 95s Unpacking libdbus-1-3:armhf (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 95s Preparing to unpack .../6-libmount1_2.39.3-9ubuntu2_armhf.deb ... 95s Unpacking libmount1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 95s Setting up libmount1:armhf (2.39.3-9ubuntu2) ... 95s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 95s Preparing to unpack .../libseccomp2_2.5.5-1ubuntu2_armhf.deb ... 95s Unpacking libseccomp2:armhf (2.5.5-1ubuntu2) over (2.5.5-1ubuntu1) ... 95s Setting up libseccomp2:armhf (2.5.5-1ubuntu2) ... 95s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 95s Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.185-3ubuntu2_armhf.deb ... 95s Unpacking libdevmapper1.02.1:armhf (2:1.02.185-3ubuntu2) over (2:1.02.185-3ubuntu1) ... 95s Preparing to unpack .../libuuid1_2.39.3-9ubuntu2_armhf.deb ... 95s Unpacking libuuid1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 95s Setting up libuuid1:armhf (2.39.3-9ubuntu2) ... 95s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 95s Preparing to unpack .../0-libcryptsetup12_2%3a2.7.0-1ubuntu2_armhf.deb ... 95s Unpacking libcryptsetup12:armhf (2:2.7.0-1ubuntu2) over (2:2.7.0-1ubuntu1) ... 95s Preparing to unpack .../1-libfdisk1_2.39.3-9ubuntu2_armhf.deb ... 95s Unpacking libfdisk1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 96s Preparing to unpack .../2-mount_2.39.3-9ubuntu2_armhf.deb ... 96s Unpacking mount (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 96s Preparing to unpack .../3-libblockdev-utils3_3.1.0-1build1_armhf.deb ... 96s Unpacking libblockdev-utils3:armhf (3.1.0-1build1) over (3.1.0-1) ... 96s Preparing to unpack .../4-libvolume-key1_0.3.12-7build1_armhf.deb ... 96s Unpacking libvolume-key1:armhf (0.3.12-7build1) over (0.3.12-5build2) ... 96s Preparing to unpack .../5-libjcat1_0.2.0-2build2_armhf.deb ... 96s Unpacking libjcat1:armhf (0.2.0-2build2) over (0.2.0-2) ... 96s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 96s Removing libgpgme11:armhf (1.18.0-4ubuntu1) ... 96s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78627 files and directories currently installed.) 96s Preparing to unpack .../parted_3.6-3.1build2_armhf.deb ... 96s Unpacking parted (3.6-3.1build2) over (3.6-3) ... 96s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78627 files and directories currently installed.) 96s Removing libparted2:armhf (3.6-3) ... 96s Selecting previously unselected package libparted2t64:armhf. 96s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78621 files and directories currently installed.) 96s Preparing to unpack .../00-libparted2t64_3.6-3.1build2_armhf.deb ... 96s Unpacking libparted2t64:armhf (3.6-3.1build2) ... 96s Preparing to unpack .../01-python3.12_3.12.2-4build3_armhf.deb ... 96s Unpacking python3.12 (3.12.2-4build3) over (3.12.2-1) ... 96s Preparing to unpack .../02-python3.12-minimal_3.12.2-4build3_armhf.deb ... 96s Unpacking python3.12-minimal (3.12.2-4build3) over (3.12.2-1) ... 96s Preparing to unpack .../03-libpython3.12-stdlib_3.12.2-4build3_armhf.deb ... 96s Unpacking libpython3.12-stdlib:armhf (3.12.2-4build3) over (3.12.2-1) ... 97s Preparing to unpack .../04-libpython3.12-minimal_3.12.2-4build3_armhf.deb ... 97s Unpacking libpython3.12-minimal:armhf (3.12.2-4build3) over (3.12.2-1) ... 97s Preparing to unpack .../05-libsasl2-modules-db_2.1.28+dfsg1-5ubuntu1_armhf.deb ... 97s Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 97s Preparing to unpack .../06-python3.11_3.11.8-1build4_armhf.deb ... 97s Unpacking python3.11 (3.11.8-1build4) over (3.11.8-1) ... 97s Preparing to unpack .../07-python3.11-minimal_3.11.8-1build4_armhf.deb ... 97s Unpacking python3.11-minimal (3.11.8-1build4) over (3.11.8-1) ... 97s Preparing to unpack .../08-libpython3.11-stdlib_3.11.8-1build4_armhf.deb ... 98s Unpacking libpython3.11-stdlib:armhf (3.11.8-1build4) over (3.11.8-1) ... 98s Preparing to unpack .../09-libpython3.11-minimal_3.11.8-1build4_armhf.deb ... 98s Unpacking libpython3.11-minimal:armhf (3.11.8-1build4) over (3.11.8-1) ... 99s Preparing to unpack .../10-libsqlite3-0_3.45.1-1ubuntu1_armhf.deb ... 99s Unpacking libsqlite3-0:armhf (3.45.1-1ubuntu1) over (3.45.1-1) ... 99s Preparing to unpack .../11-libtext-iconv-perl_1.7-8build2_armhf.deb ... 99s Unpacking libtext-iconv-perl:armhf (1.7-8build2) over (1.7-8build1) ... 99s Preparing to unpack .../12-libtext-charwidth-perl_0.04-11build2_armhf.deb ... 99s Unpacking libtext-charwidth-perl:armhf (0.04-11build2) over (0.04-11build1) ... 99s Preparing to unpack .../13-perl-modules-5.38_5.38.2-3.2_all.deb ... 99s Unpacking perl-modules-5.38 (5.38.2-3.2) over (5.38.2-3) ... 100s dpkg: libperl5.38:armhf: dependency problems, but removing anyway as you requested: 100s perl depends on libperl5.38 (= 5.38.2-3). 100s 100s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78624 files and directories currently installed.) 100s Removing libperl5.38:armhf (5.38.2-3) ... 100s dpkg: libdb5.3:armhf: dependency problems, but removing anyway as you requested: 100s iproute2 depends on libdb5.3. 100s apt-utils depends on libdb5.3. 100s 100s Removing libdb5.3:armhf (5.3.28+dfsg2-4) ... 100s Selecting previously unselected package libdb5.3t64:armhf. 100s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78099 files and directories currently installed.) 100s Preparing to unpack .../libdb5.3t64_5.3.28+dfsg2-6_armhf.deb ... 100s Unpacking libdb5.3t64:armhf (5.3.28+dfsg2-6) ... 100s Preparing to unpack .../python3-gdbm_3.12.2-3ubuntu1.1_armhf.deb ... 100s Unpacking python3-gdbm:armhf (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 100s Preparing to unpack .../man-db_2.12.0-3build4_armhf.deb ... 100s Unpacking man-db (2.12.0-3build4) over (2.12.0-3) ... 100s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78105 files and directories currently installed.) 100s Removing libgdbm-compat4:armhf (1.23-5) ... 100s Removing libgdbm6:armhf (1.23-5) ... 100s Selecting previously unselected package libgdbm6t64:armhf. 100s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78095 files and directories currently installed.) 100s Preparing to unpack .../libgdbm6t64_1.23-5.1_armhf.deb ... 100s Unpacking libgdbm6t64:armhf (1.23-5.1) ... 100s Selecting previously unselected package libgdbm-compat4t64:armhf. 100s Preparing to unpack .../libgdbm-compat4t64_1.23-5.1_armhf.deb ... 100s Unpacking libgdbm-compat4t64:armhf (1.23-5.1) ... 100s Selecting previously unselected package libperl5.38t64:armhf. 100s Preparing to unpack .../libperl5.38t64_5.38.2-3.2_armhf.deb ... 100s Unpacking libperl5.38t64:armhf (5.38.2-3.2) ... 101s Preparing to unpack .../perl_5.38.2-3.2_armhf.deb ... 101s Unpacking perl (5.38.2-3.2) over (5.38.2-3) ... 101s Preparing to unpack .../perl-base_5.38.2-3.2_armhf.deb ... 101s Unpacking perl-base (5.38.2-3.2) over (5.38.2-3) ... 102s Setting up perl-base (5.38.2-3.2) ... 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78626 files and directories currently installed.) 102s Preparing to unpack .../liblocale-gettext-perl_1.07-6ubuntu4_armhf.deb ... 102s Unpacking liblocale-gettext-perl (1.07-6ubuntu4) over (1.07-6build1) ... 102s dpkg: libnettle8:armhf: dependency problems, but removing anyway as you requested: 102s libhogweed6:armhf depends on libnettle8. 102s libgnutls30:armhf depends on libnettle8 (>= 3.9~). 102s libcurl3-gnutls:armhf depends on libnettle8. 102s libarchive13:armhf depends on libnettle8. 102s 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78626 files and directories currently installed.) 102s Removing libnettle8:armhf (3.9.1-2) ... 102s Selecting previously unselected package libnettle8t64:armhf. 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78619 files and directories currently installed.) 102s Preparing to unpack .../libnettle8t64_3.9.1-2.2_armhf.deb ... 102s Unpacking libnettle8t64:armhf (3.9.1-2.2) ... 102s Setting up libnettle8t64:armhf (3.9.1-2.2) ... 102s dpkg: libhogweed6:armhf: dependency problems, but removing anyway as you requested: 102s libgnutls30:armhf depends on libhogweed6 (>= 3.6). 102s 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78627 files and directories currently installed.) 102s Removing libhogweed6:armhf (3.9.1-2) ... 102s Selecting previously unselected package libhogweed6t64:armhf. 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78622 files and directories currently installed.) 102s Preparing to unpack .../libhogweed6t64_3.9.1-2.2_armhf.deb ... 102s Unpacking libhogweed6t64:armhf (3.9.1-2.2) ... 102s Setting up libhogweed6t64:armhf (3.9.1-2.2) ... 102s dpkg: libgnutls30:armhf: dependency problems, but removing anyway as you requested: 102s libldap2:armhf depends on libgnutls30 (>= 3.8.2). 102s libcurl3-gnutls:armhf depends on libgnutls30 (>= 3.8.2). 102s fwupd depends on libgnutls30 (>= 3.7.3). 102s dirmngr depends on libgnutls30 (>= 3.8.1). 102s apt depends on libgnutls30 (>= 3.8.1). 102s 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78628 files and directories currently installed.) 102s Removing libgnutls30:armhf (3.8.3-1ubuntu1) ... 102s Selecting previously unselected package libgnutls30t64:armhf. 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78619 files and directories currently installed.) 102s Preparing to unpack .../libgnutls30t64_3.8.3-1.1ubuntu2_armhf.deb ... 102s Unpacking libgnutls30t64:armhf (3.8.3-1.1ubuntu2) ... 102s Setting up libgnutls30t64:armhf (3.8.3-1.1ubuntu2) ... 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 102s Preparing to unpack .../libldap2_2.6.7+dfsg-1~exp1ubuntu6_armhf.deb ... 102s Unpacking libldap2:armhf (2.6.7+dfsg-1~exp1ubuntu6) over (2.6.7+dfsg-1~exp1ubuntu1) ... 102s dpkg: libcurl3-gnutls:armhf: dependency problems, but removing anyway as you requested: 102s libfwupd2:armhf depends on libcurl3-gnutls (>= 7.63.0). 102s fwupd depends on libcurl3-gnutls (>= 7.63.0). 102s 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 102s Removing libcurl3-gnutls:armhf (8.5.0-2ubuntu2) ... 102s Selecting previously unselected package libcurl3t64-gnutls:armhf. 102s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78640 files and directories currently installed.) 102s Preparing to unpack .../00-libcurl3t64-gnutls_8.5.0-2ubuntu8_armhf.deb ... 102s Unpacking libcurl3t64-gnutls:armhf (8.5.0-2ubuntu8) ... 102s Preparing to unpack .../01-shared-mime-info_2.4-1build1_armhf.deb ... 102s Unpacking shared-mime-info (2.4-1build1) over (2.4-1) ... 103s Preparing to unpack .../02-gir1.2-girepository-2.0_1.79.1-1ubuntu6_armhf.deb ... 103s Unpacking gir1.2-girepository-2.0:armhf (1.79.1-1ubuntu6) over (1.79.1-1) ... 103s Preparing to unpack .../03-gir1.2-glib-2.0_2.79.3-3ubuntu5_armhf.deb ... 103s Unpacking gir1.2-glib-2.0:armhf (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 103s Preparing to unpack .../04-libgirepository-1.0-1_1.79.1-1ubuntu6_armhf.deb ... 103s Unpacking libgirepository-1.0-1:armhf (1.79.1-1ubuntu6) over (1.79.1-1) ... 103s Preparing to unpack .../05-python3-gi_3.47.0-3build1_armhf.deb ... 103s Unpacking python3-gi (3.47.0-3build1) over (3.47.0-3) ... 103s Preparing to unpack .../06-python3-dbus_1.3.2-5build2_armhf.deb ... 103s Unpacking python3-dbus (1.3.2-5build2) over (1.3.2-5build1) ... 103s Selecting previously unselected package libnetplan1:armhf. 103s Preparing to unpack .../07-libnetplan1_1.0-1_armhf.deb ... 103s Unpacking libnetplan1:armhf (1.0-1) ... 103s Preparing to unpack .../08-python3-netplan_1.0-1_armhf.deb ... 103s Unpacking python3-netplan (1.0-1) over (0.107.1-3) ... 103s Preparing to unpack .../09-netplan-generator_1.0-1_armhf.deb ... 103s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 103s Unpacking netplan-generator (1.0-1) over (0.107.1-3) ... 103s Preparing to unpack .../10-initramfs-tools-bin_0.142ubuntu23_armhf.deb ... 103s Unpacking initramfs-tools-bin (0.142ubuntu23) over (0.142ubuntu20) ... 103s Preparing to unpack .../11-initramfs-tools-core_0.142ubuntu23_all.deb ... 103s Unpacking initramfs-tools-core (0.142ubuntu23) over (0.142ubuntu20) ... 103s Preparing to unpack .../12-initramfs-tools_0.142ubuntu23_all.deb ... 103s Unpacking initramfs-tools (0.142ubuntu23) over (0.142ubuntu20) ... 103s Preparing to unpack .../13-netplan.io_1.0-1_armhf.deb ... 103s Unpacking netplan.io (1.0-1) over (0.107.1-3) ... 104s Preparing to unpack .../14-libxmlb2_0.3.15-1build1_armhf.deb ... 104s Unpacking libxmlb2:armhf (0.3.15-1build1) over (0.3.15-1) ... 104s Preparing to unpack .../15-libqrtr-glib0_1.2.2-1ubuntu3_armhf.deb ... 104s Unpacking libqrtr-glib0:armhf (1.2.2-1ubuntu3) over (1.2.2-1ubuntu2) ... 104s Preparing to unpack .../16-libqmi-glib5_1.35.2-0ubuntu1_armhf.deb ... 104s Unpacking libqmi-glib5:armhf (1.35.2-0ubuntu1) over (1.34.0-2) ... 104s Preparing to unpack .../17-libqmi-proxy_1.35.2-0ubuntu1_armhf.deb ... 104s Unpacking libqmi-proxy (1.35.2-0ubuntu1) over (1.34.0-2) ... 104s Preparing to unpack .../18-libpolkit-agent-1-0_124-1ubuntu1_armhf.deb ... 104s Unpacking libpolkit-agent-1-0:armhf (124-1ubuntu1) over (124-1) ... 104s Preparing to unpack .../19-libpolkit-gobject-1-0_124-1ubuntu1_armhf.deb ... 104s Unpacking libpolkit-gobject-1-0:armhf (124-1ubuntu1) over (124-1) ... 104s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78651 files and directories currently installed.) 104s Removing libnetplan0:armhf (0.107.1-3) ... 104s dpkg: libglib2.0-0:armhf: dependency problems, but removing anyway as you requested: 104s libmm-glib0:armhf depends on libglib2.0-0 (>= 2.62.0). 104s libmbim-proxy depends on libglib2.0-0 (>= 2.56). 104s libmbim-glib4:armhf depends on libglib2.0-0 (>= 2.56). 104s libjson-glib-1.0-0:armhf depends on libglib2.0-0 (>= 2.75.3). 104s libgusb2:armhf depends on libglib2.0-0 (>= 2.75.3). 104s libgudev-1.0-0:armhf depends on libglib2.0-0 (>= 2.38.0). 104s libfwupd2:armhf depends on libglib2.0-0 (>= 2.79.0). 104s libblockdev3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-swap3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-part3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-nvme3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-mdraid3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-loop3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-fs3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s libblockdev-crypto3:armhf depends on libglib2.0-0 (>= 2.42.2). 104s fwupd depends on libglib2.0-0 (>= 2.79.0). 104s bolt depends on libglib2.0-0 (>= 2.56.0). 104s 104s Removing libglib2.0-0:armhf (2.79.2-1~ubuntu1) ... 104s Selecting previously unselected package libglib2.0-0t64:armhf. 104s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78622 files and directories currently installed.) 104s Preparing to unpack .../libglib2.0-0t64_2.79.3-3ubuntu5_armhf.deb ... 104s libglib2.0-0t64.preinst: Removing /var/lib/dpkg/info/libglib2.0-0:armhf.postrm to avoid loss of /usr/share/glib-2.0/schemas/gschemas.compiled... 104s removed '/var/lib/dpkg/info/libglib2.0-0:armhf.postrm' 104s Unpacking libglib2.0-0t64:armhf (2.79.3-3ubuntu5) ... 104s Preparing to unpack .../libfwupd2_1.9.15-2_armhf.deb ... 104s Unpacking libfwupd2:armhf (1.9.15-2) over (1.9.14-1) ... 104s dpkg: libarchive13:armhf: dependency problems, but removing anyway as you requested: 104s fwupd depends on libarchive13 (>= 3.2.1). 104s 104s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 104s Removing libarchive13:armhf (3.7.2-1ubuntu2) ... 104s Selecting previously unselected package libarchive13t64:armhf. 104s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78641 files and directories currently installed.) 104s Preparing to unpack .../libarchive13t64_3.7.2-1.1ubuntu2_armhf.deb ... 104s Unpacking libarchive13t64:armhf (3.7.2-1.1ubuntu2) ... 104s Preparing to unpack .../fwupd_1.9.15-2_armhf.deb ... 104s Unpacking fwupd (1.9.15-2) over (1.9.14-1) ... 104s Preparing to unpack .../apt-utils_2.7.14_armhf.deb ... 104s Unpacking apt-utils (2.7.14) over (2.7.12) ... 105s dpkg: libapt-pkg6.0:armhf: dependency problems, but removing anyway as you requested: 105s ubuntu-pro-client depends on libapt-pkg6.0 (>= 1.9~). 105s python3-apt depends on libapt-pkg6.0 (>= 2.7.11). 105s apt depends on libapt-pkg6.0 (>= 2.7.12). 105s 105s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78648 files and directories currently installed.) 105s Removing libapt-pkg6.0:armhf (2.7.12) ... 105s Selecting previously unselected package libapt-pkg6.0t64:armhf. 105s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78599 files and directories currently installed.) 105s Preparing to unpack .../libapt-pkg6.0t64_2.7.14_armhf.deb ... 105s Unpacking libapt-pkg6.0t64:armhf (2.7.14) ... 105s Setting up libapt-pkg6.0t64:armhf (2.7.14) ... 105s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78649 files and directories currently installed.) 105s Preparing to unpack .../archives/apt_2.7.14_armhf.deb ... 105s Unpacking apt (2.7.14) over (2.7.12) ... 105s Setting up apt (2.7.14) ... 106s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78649 files and directories currently installed.) 106s Preparing to unpack .../ubuntu-pro-client-l10n_31.2.1_armhf.deb ... 106s Unpacking ubuntu-pro-client-l10n (31.2.1) over (31.1) ... 106s Preparing to unpack .../ubuntu-pro-client_31.2.1_armhf.deb ... 106s Unpacking ubuntu-pro-client (31.2.1) over (31.1) ... 106s Preparing to unpack .../keyboxd_2.4.4-2ubuntu15_armhf.deb ... 106s Unpacking keyboxd (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 106s dpkg: libnpth0:armhf: dependency problems, but removing anyway as you requested: 106s gpgv depends on libnpth0 (>= 0.90). 106s gpgsm depends on libnpth0 (>= 0.90). 106s gpg-agent depends on libnpth0 (>= 0.90). 106s gpg depends on libnpth0 (>= 0.90). 106s dirmngr depends on libnpth0 (>= 0.90). 106s 106s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78649 files and directories currently installed.) 106s Removing libnpth0:armhf (1.6-3build2) ... 106s Selecting previously unselected package libnpth0t64:armhf. 106s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78644 files and directories currently installed.) 106s Preparing to unpack .../libnpth0t64_1.6-3.1_armhf.deb ... 106s Unpacking libnpth0t64:armhf (1.6-3.1) ... 106s Setting up libnpth0t64:armhf (1.6-3.1) ... 106s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78650 files and directories currently installed.) 106s Preparing to unpack .../gpgv_2.4.4-2ubuntu15_armhf.deb ... 106s Unpacking gpgv (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 106s Setting up gpgv (2.4.4-2ubuntu15) ... 106s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78650 files and directories currently installed.) 106s Preparing to unpack .../gpg_2.4.4-2ubuntu15_armhf.deb ... 106s Unpacking gpg (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 106s Preparing to unpack .../gpg-wks-client_2.4.4-2ubuntu15_armhf.deb ... 106s Unpacking gpg-wks-client (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s Preparing to unpack .../gnupg-utils_2.4.4-2ubuntu15_armhf.deb ... 107s Unpacking gnupg-utils (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s Preparing to unpack .../gpg-agent_2.4.4-2ubuntu15_armhf.deb ... 107s Unpacking gpg-agent (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s Preparing to unpack .../gpgsm_2.4.4-2ubuntu15_armhf.deb ... 107s Unpacking gpgsm (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s dpkg: libreadline8:armhf: dependency problems, but removing anyway as you requested: 107s gpgconf depends on libreadline8 (>= 6.0). 107s gawk depends on libreadline8 (>= 6.0). 107s fdisk depends on libreadline8 (>= 6.0). 107s 107s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78650 files and directories currently installed.) 107s Removing libreadline8:armhf (8.2-3) ... 107s Selecting previously unselected package libreadline8t64:armhf. 107s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78638 files and directories currently installed.) 107s Preparing to unpack .../libreadline8t64_8.2-4_armhf.deb ... 107s Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64' 107s Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64' 107s Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64' 107s Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64' 107s Unpacking libreadline8t64:armhf (8.2-4) ... 107s Setting up libreadline8t64:armhf (8.2-4) ... 107s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78658 files and directories currently installed.) 107s Preparing to unpack .../00-gawk_1%3a5.2.1-2build2_armhf.deb ... 107s Unpacking gawk (1:5.2.1-2build2) over (1:5.2.1-2) ... 107s Preparing to unpack .../01-fdisk_2.39.3-9ubuntu2_armhf.deb ... 107s Unpacking fdisk (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 107s Preparing to unpack .../02-gpgconf_2.4.4-2ubuntu15_armhf.deb ... 107s Unpacking gpgconf (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s Preparing to unpack .../03-dirmngr_2.4.4-2ubuntu15_armhf.deb ... 107s Unpacking dirmngr (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s Preparing to unpack .../04-gnupg_2.4.4-2ubuntu15_all.deb ... 107s Unpacking gnupg (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 107s Preparing to unpack .../05-python3-apt_2.7.7_armhf.deb ... 107s Unpacking python3-apt (2.7.7) over (2.7.6) ... 107s Preparing to unpack .../06-pinentry-curses_1.2.1-3ubuntu4_armhf.deb ... 107s Unpacking pinentry-curses (1.2.1-3ubuntu4) over (1.2.1-3ubuntu1) ... 107s Preparing to unpack .../07-python3-yaml_6.0.1-2build1_armhf.deb ... 108s Unpacking python3-yaml (6.0.1-2build1) over (6.0.1-2) ... 108s Preparing to unpack .../08-python-apt-common_2.7.7_all.deb ... 108s Unpacking python-apt-common (2.7.7) over (2.7.6) ... 108s Preparing to unpack .../09-python3-setuptools_68.1.2-2ubuntu1_all.deb ... 108s Unpacking python3-setuptools (68.1.2-2ubuntu1) over (68.1.2-2) ... 108s Preparing to unpack .../10-python3-pkg-resources_68.1.2-2ubuntu1_all.deb ... 108s Unpacking python3-pkg-resources (68.1.2-2ubuntu1) over (68.1.2-2) ... 108s Preparing to unpack .../11-dpkg_1.22.6ubuntu4_armhf.deb ... 108s Unpacking dpkg (1.22.6ubuntu4) over (1.22.4ubuntu5) ... 108s Setting up dpkg (1.22.6ubuntu4) ... 109s Setting up libpython3.12-minimal:armhf (3.12.2-4build3) ... 109s Setting up libexpat1:armhf (2.6.1-2) ... 109s Setting up python3.12-minimal (3.12.2-4build3) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78655 files and directories currently installed.) 110s Preparing to unpack .../python3-minimal_3.12.2-0ubuntu1_armhf.deb ... 110s Unpacking python3-minimal (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 110s Setting up python3-minimal (3.12.2-0ubuntu1) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78655 files and directories currently installed.) 110s Preparing to unpack .../python3_3.12.2-0ubuntu1_armhf.deb ... 110s Unpacking python3 (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 110s Preparing to unpack .../libpython3-stdlib_3.12.2-0ubuntu1_armhf.deb ... 110s Unpacking libpython3-stdlib:armhf (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 110s Preparing to unpack .../libsmartcols1_2.39.3-9ubuntu2_armhf.deb ... 110s Unpacking libsmartcols1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 110s Setting up libsmartcols1:armhf (2.39.3-9ubuntu2) ... 110s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78655 files and directories currently installed.) 110s Preparing to unpack .../0-bsdextrautils_2.39.3-9ubuntu2_armhf.deb ... 110s Unpacking bsdextrautils (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 110s Preparing to unpack .../1-groff-base_1.23.0-3build1_armhf.deb ... 110s Unpacking groff-base (1.23.0-3build1) over (1.23.0-3) ... 111s Preparing to unpack .../2-readline-common_8.2-4_all.deb ... 111s Unpacking readline-common (8.2-4) over (8.2-3) ... 111s Selecting previously unselected package libgpgme11t64:armhf. 111s Preparing to unpack .../3-libgpgme11t64_1.18.0-4.1ubuntu3_armhf.deb ... 111s Unpacking libgpgme11t64:armhf (1.18.0-4.1ubuntu3) ... 111s Preparing to unpack .../4-libblockdev-crypto3_3.1.0-1build1_armhf.deb ... 111s Unpacking libblockdev-crypto3:armhf (3.1.0-1build1) over (3.1.0-1) ... 111s Preparing to unpack .../5-e2fsprogs-l10n_1.47.0-2.4~exp1ubuntu2_all.deb ... 111s Unpacking e2fsprogs-l10n (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 111s Preparing to unpack .../6-logsave_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 111s Unpacking logsave (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 111s Preparing to unpack .../7-dhcpcd-base_1%3a10.0.6-1ubuntu2_armhf.deb ... 111s Unpacking dhcpcd-base (1:10.0.6-1ubuntu2) over (1:10.0.6-1ubuntu1) ... 111s Preparing to unpack .../8-libblockdev-fs3_3.1.0-1build1_armhf.deb ... 111s Unpacking libblockdev-fs3:armhf (3.1.0-1build1) over (3.1.0-1) ... 111s dpkg: libreiserfscore0: dependency problems, but removing anyway as you requested: 111s btrfs-progs depends on libreiserfscore0 (>= 1:3.6.27). 111s 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78662 files and directories currently installed.) 111s Removing libreiserfscore0 (1:3.6.27-7) ... 111s Selecting previously unselected package libreiserfscore0t64. 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78657 files and directories currently installed.) 111s Preparing to unpack .../libreiserfscore0t64_1%3a3.6.27-7.1_armhf.deb ... 111s Unpacking libreiserfscore0t64 (1:3.6.27-7.1) ... 111s Preparing to unpack .../btrfs-progs_6.6.3-1.1build1_armhf.deb ... 111s Unpacking btrfs-progs (6.6.3-1.1build1) over (6.6.3-1.1) ... 111s dpkg: libext2fs2:armhf: dependency problems, but removing anyway as you requested: 111s e2fsprogs depends on libext2fs2 (= 1.47.0-2ubuntu1). 111s 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78663 files and directories currently installed.) 111s Removing libext2fs2:armhf (1.47.0-2ubuntu1) ... 111s Selecting previously unselected package libext2fs2t64:armhf. 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78656 files and directories currently installed.) 111s Preparing to unpack .../libext2fs2t64_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 111s Adding 'diversion of /lib/arm-linux-gnueabihf/libe2p.so.2 to /lib/arm-linux-gnueabihf/libe2p.so.2.usr-is-merged by libext2fs2t64' 111s Adding 'diversion of /lib/arm-linux-gnueabihf/libe2p.so.2.3 to /lib/arm-linux-gnueabihf/libe2p.so.2.3.usr-is-merged by libext2fs2t64' 111s Adding 'diversion of /lib/arm-linux-gnueabihf/libext2fs.so.2 to /lib/arm-linux-gnueabihf/libext2fs.so.2.usr-is-merged by libext2fs2t64' 111s Adding 'diversion of /lib/arm-linux-gnueabihf/libext2fs.so.2.4 to /lib/arm-linux-gnueabihf/libext2fs.so.2.4.usr-is-merged by libext2fs2t64' 111s Unpacking libext2fs2t64:armhf (1.47.0-2.4~exp1ubuntu2) ... 111s Setting up libcom-err2:armhf (1.47.0-2.4~exp1ubuntu2) ... 111s Setting up libext2fs2t64:armhf (1.47.0-2.4~exp1ubuntu2) ... 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78672 files and directories currently installed.) 111s Preparing to unpack .../e2fsprogs_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 111s Unpacking e2fsprogs (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 111s Preparing to unpack .../libblockdev-loop3_3.1.0-1build1_armhf.deb ... 111s Unpacking libblockdev-loop3:armhf (3.1.0-1build1) over (3.1.0-1) ... 111s Preparing to unpack .../libblockdev-mdraid3_3.1.0-1build1_armhf.deb ... 111s Unpacking libblockdev-mdraid3:armhf (3.1.0-1build1) over (3.1.0-1) ... 111s Preparing to unpack .../libblockdev-nvme3_3.1.0-1build1_armhf.deb ... 111s Unpacking libblockdev-nvme3:armhf (3.1.0-1build1) over (3.1.0-1) ... 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78672 files and directories currently installed.) 111s Removing libnvme1 (1.8-2) ... 111s Selecting previously unselected package libnvme1t64. 111s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78665 files and directories currently installed.) 111s Preparing to unpack .../0-libnvme1t64_1.8-3_armhf.deb ... 111s Unpacking libnvme1t64 (1.8-3) ... 111s Preparing to unpack .../1-libblockdev-part3_3.1.0-1build1_armhf.deb ... 111s Unpacking libblockdev-part3:armhf (3.1.0-1build1) over (3.1.0-1) ... 112s Preparing to unpack .../2-libblockdev-swap3_3.1.0-1build1_armhf.deb ... 112s Unpacking libblockdev-swap3:armhf (3.1.0-1build1) over (3.1.0-1) ... 112s Preparing to unpack .../3-libblockdev3_3.1.0-1build1_armhf.deb ... 112s Unpacking libblockdev3:armhf (3.1.0-1build1) over (3.1.0-1) ... 112s Preparing to unpack .../4-libgudev-1.0-0_1%3a238-3ubuntu2_armhf.deb ... 112s Unpacking libgudev-1.0-0:armhf (1:238-3ubuntu2) over (1:238-3) ... 112s Preparing to unpack .../5-libxml2_2.9.14+dfsg-1.3ubuntu2_armhf.deb ... 112s Unpacking libxml2:armhf (2.9.14+dfsg-1.3ubuntu2) over (2.9.14+dfsg-1.3ubuntu1) ... 112s Preparing to unpack .../6-libbpf1_1%3a1.3.0-2build1_armhf.deb ... 112s Unpacking libbpf1:armhf (1:1.3.0-2build1) over (1:1.3.0-2) ... 112s Preparing to unpack .../7-iproute2_6.1.0-1ubuntu5_armhf.deb ... 112s Unpacking iproute2 (6.1.0-1ubuntu5) over (6.1.0-1ubuntu2) ... 112s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78673 files and directories currently installed.) 112s Removing libelf1:armhf (0.190-1) ... 112s Selecting previously unselected package libelf1t64:armhf. 112s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78668 files and directories currently installed.) 112s Preparing to unpack .../libelf1t64_0.190-1.1build2_armhf.deb ... 112s Unpacking libelf1t64:armhf (0.190-1.1build2) ... 112s Preparing to unpack .../libtirpc-common_1.3.4+ds-1.1_all.deb ... 112s Unpacking libtirpc-common (1.3.4+ds-1.1) over (1.3.4+ds-1build1) ... 112s Preparing to unpack .../lsof_4.95.0-1build2_armhf.deb ... 112s Unpacking lsof (4.95.0-1build2) over (4.95.0-1build1) ... 112s Preparing to unpack .../libnsl2_1.3.0-3build2_armhf.deb ... 112s Unpacking libnsl2:armhf (1.3.0-3build2) over (1.3.0-3) ... 112s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78673 files and directories currently installed.) 112s Removing libtirpc3:armhf (1.3.4+ds-1build1) ... 112s Selecting previously unselected package libtirpc3t64:armhf. 112s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78667 files and directories currently installed.) 112s Preparing to unpack .../00-libtirpc3t64_1.3.4+ds-1.1_armhf.deb ... 112s Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3 to /lib/arm-linux-gnueabihf/libtirpc.so.3.usr-is-merged by libtirpc3t64' 112s Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0 to /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0.usr-is-merged by libtirpc3t64' 112s Unpacking libtirpc3t64:armhf (1.3.4+ds-1.1) ... 113s Preparing to unpack .../01-libmbim-proxy_1.31.2-0ubuntu2_armhf.deb ... 113s Unpacking libmbim-proxy (1.31.2-0ubuntu2) over (1.30.0-1) ... 113s Preparing to unpack .../02-libmbim-glib4_1.31.2-0ubuntu2_armhf.deb ... 113s Unpacking libmbim-glib4:armhf (1.31.2-0ubuntu2) over (1.30.0-1) ... 113s Preparing to unpack .../03-libjson-glib-1.0-common_1.8.0-2build1_all.deb ... 113s Unpacking libjson-glib-1.0-common (1.8.0-2build1) over (1.8.0-2) ... 113s Preparing to unpack .../04-libjson-glib-1.0-0_1.8.0-2build1_armhf.deb ... 113s Unpacking libjson-glib-1.0-0:armhf (1.8.0-2build1) over (1.8.0-2) ... 113s Preparing to unpack .../05-libnghttp2-14_1.59.0-1build1_armhf.deb ... 113s Unpacking libnghttp2-14:armhf (1.59.0-1build1) over (1.59.0-1) ... 113s Preparing to unpack .../06-libssh-4_0.10.6-2build1_armhf.deb ... 113s Unpacking libssh-4:armhf (0.10.6-2build1) over (0.10.6-2) ... 113s Preparing to unpack .../07-libusb-1.0-0_2%3a1.0.27-1_armhf.deb ... 113s Unpacking libusb-1.0-0:armhf (2:1.0.27-1) over (2:1.0.26-1) ... 113s Preparing to unpack .../08-libgusb2_0.4.8-1build1_armhf.deb ... 113s Unpacking libgusb2:armhf (0.4.8-1build1) over (0.4.8-1) ... 113s Preparing to unpack .../09-libmm-glib0_1.23.4-0ubuntu1_armhf.deb ... 113s Unpacking libmm-glib0:armhf (1.23.4-0ubuntu1) over (1.22.0-3) ... 113s Preparing to unpack .../10-libprotobuf-c1_1.4.1-1ubuntu3_armhf.deb ... 113s Unpacking libprotobuf-c1:armhf (1.4.1-1ubuntu3) over (1.4.1-1ubuntu2) ... 113s Preparing to unpack .../11-libsasl2-2_2.1.28+dfsg1-5ubuntu1_armhf.deb ... 113s Unpacking libsasl2-2:armhf (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 113s Preparing to unpack .../12-libibverbs1_50.0-2build1_armhf.deb ... 113s Unpacking libibverbs1:armhf (50.0-2build1) over (50.0-2) ... 113s Preparing to unpack .../13-libfido2-1_1.14.0-1build1_armhf.deb ... 113s Unpacking libfido2-1:armhf (1.14.0-1build1) over (1.14.0-1) ... 113s Preparing to unpack .../14-libproc2-0_2%3a4.0.4-4ubuntu2_armhf.deb ... 113s Unpacking libproc2-0:armhf (2:4.0.4-4ubuntu2) over (2:4.0.4-4ubuntu1) ... 113s Preparing to unpack .../15-procps_2%3a4.0.4-4ubuntu2_armhf.deb ... 113s Unpacking procps (2:4.0.4-4ubuntu2) over (2:4.0.4-4ubuntu1) ... 113s Preparing to unpack .../16-coreutils_9.4-3ubuntu3_armhf.deb ... 113s Unpacking coreutils (9.4-3ubuntu3) over (9.4-2ubuntu4) ... 113s Setting up coreutils (9.4-3ubuntu3) ... 113s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78679 files and directories currently installed.) 113s Preparing to unpack .../util-linux_2.39.3-9ubuntu2_armhf.deb ... 113s Unpacking util-linux (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 114s Setting up util-linux (2.39.3-9ubuntu2) ... 114s fstrim.service is a disabled or a static unit not running, not starting it. 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78679 files and directories currently installed.) 114s Removing libatm1:armhf (1:2.5.1-5) ... 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78674 files and directories currently installed.) 114s Preparing to unpack .../file_1%3a5.45-3_armhf.deb ... 114s Unpacking file (1:5.45-3) over (1:5.45-2) ... 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78674 files and directories currently installed.) 114s Removing libmagic1:armhf (1:5.45-2) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78664 files and directories currently installed.) 115s Preparing to unpack .../libmagic-mgc_1%3a5.45-3_armhf.deb ... 115s Unpacking libmagic-mgc (1:5.45-3) over (1:5.45-2) ... 115s Selecting previously unselected package libmagic1t64:armhf. 115s Preparing to unpack .../libmagic1t64_1%3a5.45-3_armhf.deb ... 115s Unpacking libmagic1t64:armhf (1:5.45-3) ... 115s Preparing to unpack .../libplymouth5_24.004.60-1ubuntu6_armhf.deb ... 115s Unpacking libplymouth5:armhf (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78675 files and directories currently installed.) 115s Removing libpng16-16:armhf (1.6.43-1) ... 115s Selecting previously unselected package libpng16-16t64:armhf. 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78665 files and directories currently installed.) 115s Preparing to unpack .../libpng16-16t64_1.6.43-3_armhf.deb ... 115s Unpacking libpng16-16t64:armhf (1.6.43-3) ... 115s Preparing to unpack .../bind9-host_1%3a9.18.24-0ubuntu3_armhf.deb ... 115s Unpacking bind9-host (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 115s Preparing to unpack .../bind9-dnsutils_1%3a9.18.24-0ubuntu3_armhf.deb ... 115s Unpacking bind9-dnsutils (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 115s Preparing to unpack .../bind9-libs_1%3a9.18.24-0ubuntu3_armhf.deb ... 115s Unpacking bind9-libs:armhf (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78676 files and directories currently installed.) 115s Removing libuv1:armhf (1.48.0-1) ... 115s Selecting previously unselected package libuv1t64:armhf. 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78671 files and directories currently installed.) 115s Preparing to unpack .../libuv1t64_1.48.0-1.1_armhf.deb ... 115s Unpacking libuv1t64:armhf (1.48.0-1.1) ... 115s Preparing to unpack .../uuid-runtime_2.39.3-9ubuntu2_armhf.deb ... 115s Unpacking uuid-runtime (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 115s Preparing to unpack .../libdebconfclient0_0.271ubuntu2_armhf.deb ... 115s Unpacking libdebconfclient0:armhf (0.271ubuntu2) over (0.271ubuntu1) ... 115s Setting up libdebconfclient0:armhf (0.271ubuntu2) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 115s Preparing to unpack .../libsemanage-common_3.5-1build4_all.deb ... 115s Unpacking libsemanage-common (3.5-1build4) over (3.5-1build2) ... 115s Setting up libsemanage-common (3.5-1build4) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 115s Preparing to unpack .../libsemanage2_3.5-1build4_armhf.deb ... 115s Unpacking libsemanage2:armhf (3.5-1build4) over (3.5-1build2) ... 115s Setting up libsemanage2:armhf (3.5-1build4) ... 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 115s Preparing to unpack .../install-info_7.1-3build1_armhf.deb ... 115s Unpacking install-info (7.1-3build1) over (7.1-3) ... 115s Setting up install-info (7.1-3build1) ... 116s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 116s Preparing to unpack .../00-gcc-13-base_13.2.0-21ubuntu1_armhf.deb ... 116s Unpacking gcc-13-base:armhf (13.2.0-21ubuntu1) over (13.2.0-17ubuntu2) ... 116s Preparing to unpack .../01-libss2_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 116s Unpacking libss2:armhf (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 116s Preparing to unpack .../02-dmsetup_2%3a1.02.185-3ubuntu2_armhf.deb ... 116s Unpacking dmsetup (2:1.02.185-3ubuntu2) over (2:1.02.185-3ubuntu1) ... 116s Preparing to unpack .../03-eject_2.39.3-9ubuntu2_armhf.deb ... 116s Unpacking eject (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 116s Preparing to unpack .../04-krb5-locales_1.20.1-6ubuntu1_all.deb ... 116s Unpacking krb5-locales (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 116s Preparing to unpack .../05-libglib2.0-data_2.79.3-3ubuntu5_all.deb ... 116s Unpacking libglib2.0-data (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 116s Preparing to unpack .../06-libslang2_2.3.3-3build1_armhf.deb ... 116s Unpacking libslang2:armhf (2.3.3-3build1) over (2.3.3-3) ... 116s Preparing to unpack .../07-rsyslog_8.2312.0-3ubuntu7_armhf.deb ... 116s Unpacking rsyslog (8.2312.0-3ubuntu7) over (8.2312.0-3ubuntu3) ... 116s Preparing to unpack .../08-vim-tiny_2%3a9.1.0016-1ubuntu6_armhf.deb ... 116s Unpacking vim-tiny (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 116s Preparing to unpack .../09-vim-common_2%3a9.1.0016-1ubuntu6_all.deb ... 116s Unpacking vim-common (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 116s Selecting previously unselected package xdg-user-dirs. 116s Preparing to unpack .../10-xdg-user-dirs_0.18-1_armhf.deb ... 116s Unpacking xdg-user-dirs (0.18-1) ... 116s Preparing to unpack .../11-xxd_2%3a9.1.0016-1ubuntu6_armhf.deb ... 116s Unpacking xxd (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 116s Preparing to unpack .../12-apparmor_4.0.0-beta3-0ubuntu2_armhf.deb ... 117s Unpacking apparmor (4.0.0-beta3-0ubuntu2) over (4.0.0~alpha4-0ubuntu1) ... 117s Preparing to unpack .../13-ftp_20230507-2build1_all.deb ... 117s Unpacking ftp (20230507-2build1) over (20230507-2) ... 117s Preparing to unpack .../14-inetutils-telnet_2%3a2.5-3ubuntu3_armhf.deb ... 117s Unpacking inetutils-telnet (2:2.5-3ubuntu3) over (2:2.5-3ubuntu1) ... 117s Preparing to unpack .../15-info_7.1-3build1_armhf.deb ... 117s Unpacking info (7.1-3build1) over (7.1-3) ... 117s Preparing to unpack .../16-libxmuu1_2%3a1.1.3-3build1_armhf.deb ... 117s Unpacking libxmuu1:armhf (2:1.1.3-3build1) over (2:1.1.3-3) ... 117s Preparing to unpack .../17-lshw_02.19.git.2021.06.19.996aaad9c7-2build2_armhf.deb ... 117s Unpacking lshw (02.19.git.2021.06.19.996aaad9c7-2build2) over (02.19.git.2021.06.19.996aaad9c7-2build1) ... 117s Preparing to unpack .../18-mtr-tiny_0.95-1.1build1_armhf.deb ... 117s Unpacking mtr-tiny (0.95-1.1build1) over (0.95-1.1) ... 117s Preparing to unpack .../19-plymouth-theme-ubuntu-text_24.004.60-1ubuntu6_armhf.deb ... 117s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 118s Preparing to unpack .../20-plymouth_24.004.60-1ubuntu6_armhf.deb ... 118s Unpacking plymouth (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 118s Preparing to unpack .../21-psmisc_23.7-1_armhf.deb ... 118s Unpacking psmisc (23.7-1) over (23.6-2) ... 118s Preparing to unpack .../22-telnet_0.17+2.5-3ubuntu3_all.deb ... 118s Unpacking telnet (0.17+2.5-3ubuntu3) over (0.17+2.5-3ubuntu1) ... 118s Preparing to unpack .../23-usb.ids_2024.03.18-1_all.deb ... 118s Unpacking usb.ids (2024.03.18-1) over (2024.01.30-1) ... 118s Preparing to unpack .../24-xz-utils_5.6.0-0.2_armhf.deb ... 118s Unpacking xz-utils (5.6.0-0.2) over (5.4.5-0.3) ... 118s Preparing to unpack .../25-libctf0_2.42-4ubuntu1_armhf.deb ... 118s Unpacking libctf0:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../26-libctf-nobfd0_2.42-4ubuntu1_armhf.deb ... 118s Unpacking libctf-nobfd0:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../27-binutils-arm-linux-gnueabihf_2.42-4ubuntu1_armhf.deb ... 118s Unpacking binutils-arm-linux-gnueabihf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../28-libbinutils_2.42-4ubuntu1_armhf.deb ... 118s Unpacking libbinutils:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../29-binutils_2.42-4ubuntu1_armhf.deb ... 118s Unpacking binutils (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../30-binutils-common_2.42-4ubuntu1_armhf.deb ... 118s Unpacking binutils-common:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../31-libsframe1_2.42-4ubuntu1_armhf.deb ... 118s Unpacking libsframe1:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 118s Preparing to unpack .../32-bolt_0.9.6-2build1_armhf.deb ... 118s Unpacking bolt (0.9.6-2build1) over (0.9.6-2) ... 118s Preparing to unpack .../33-cryptsetup-bin_2%3a2.7.0-1ubuntu2_armhf.deb ... 118s Unpacking cryptsetup-bin (2:2.7.0-1ubuntu2) over (2:2.7.0-1ubuntu1) ... 118s Preparing to unpack .../34-dpkg-dev_1.22.6ubuntu4_all.deb ... 118s Unpacking dpkg-dev (1.22.6ubuntu4) over (1.22.4ubuntu5) ... 118s Preparing to unpack .../35-libdpkg-perl_1.22.6ubuntu4_all.deb ... 118s Unpacking libdpkg-perl (1.22.6ubuntu4) over (1.22.4ubuntu5) ... 119s Preparing to unpack .../36-gnupg-l10n_2.4.4-2ubuntu15_all.deb ... 119s Unpacking gnupg-l10n (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 119s Preparing to unpack .../37-ibverbs-providers_50.0-2build1_armhf.deb ... 119s Unpacking ibverbs-providers:armhf (50.0-2build1) over (50.0-2) ... 119s Preparing to unpack .../38-jq_1.7.1-3_armhf.deb ... 119s Unpacking jq (1.7.1-3) over (1.7.1-2) ... 119s Preparing to unpack .../39-libjq1_1.7.1-3_armhf.deb ... 119s Unpacking libjq1:armhf (1.7.1-3) over (1.7.1-2) ... 119s Selecting previously unselected package libatm1t64:armhf. 119s Preparing to unpack .../40-libatm1t64_1%3a2.5.1-5.1_armhf.deb ... 119s Unpacking libatm1t64:armhf (1:2.5.1-5.1) ... 119s Preparing to unpack .../41-libevent-core-2.1-7_2.1.12-stable-9build1_armhf.deb ... 119s Unpacking libevent-core-2.1-7:armhf (2.1.12-stable-9build1) over (2.1.12-stable-9) ... 119s Preparing to unpack .../42-libftdi1-2_1.5-6build4_armhf.deb ... 119s Unpacking libftdi1-2:armhf (1.5-6build4) over (1.5-6build3) ... 119s Preparing to unpack .../43-libldap-common_2.6.7+dfsg-1~exp1ubuntu6_all.deb ... 119s Unpacking libldap-common (2.6.7+dfsg-1~exp1ubuntu6) over (2.6.7+dfsg-1~exp1ubuntu1) ... 119s Preparing to unpack .../44-libsasl2-modules_2.1.28+dfsg1-5ubuntu1_armhf.deb ... 119s Unpacking libsasl2-modules:armhf (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 119s Preparing to unpack .../45-python3-distutils_3.12.2-3ubuntu1.1_all.deb ... 119s Unpacking python3-distutils (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 119s Preparing to unpack .../46-python3-lib2to3_3.12.2-3ubuntu1.1_all.deb ... 119s Unpacking python3-lib2to3 (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 119s Preparing to unpack .../47-python3-pyrsistent_0.20.0-1build1_armhf.deb ... 119s Unpacking python3-pyrsistent:armhf (0.20.0-1build1) over (0.20.0-1) ... 119s Preparing to unpack .../48-python3-typing-extensions_4.10.0-1_all.deb ... 119s Unpacking python3-typing-extensions (4.10.0-1) over (4.9.0-1) ... 119s Preparing to unpack .../49-kpartx_0.9.4-5ubuntu6_armhf.deb ... 119s Unpacking kpartx (0.9.4-5ubuntu6) over (0.9.4-5ubuntu3) ... 119s Setting up pinentry-curses (1.2.1-3ubuntu4) ... 119s Setting up libtext-iconv-perl:armhf (1.7-8build2) ... 119s Setting up libtext-charwidth-perl:armhf (0.04-11build2) ... 119s Setting up libibverbs1:armhf (50.0-2build1) ... 119s Setting up systemd-sysv (255.4-1ubuntu5) ... 120s Setting up libapparmor1:armhf (4.0.0-beta3-0ubuntu2) ... 120s Setting up libatm1t64:armhf (1:2.5.1-5.1) ... 120s Setting up libgdbm6t64:armhf (1.23-5.1) ... 120s Setting up bsdextrautils (2.39.3-9ubuntu2) ... 120s Setting up libgdbm-compat4t64:armhf (1.23-5.1) ... 120s Setting up xdg-user-dirs (0.18-1) ... 120s Setting up ibverbs-providers:armhf (50.0-2build1) ... 120s Setting up linux-headers-6.8.0-20 (6.8.0-20.20) ... 120s Setting up libmagic-mgc (1:5.45-3) ... 120s Setting up gawk (1:5.2.1-2build2) ... 120s Setting up psmisc (23.7-1) ... 120s Setting up libjq1:armhf (1.7.1-3) ... 120s Setting up libtirpc-common (1.3.4+ds-1.1) ... 120s Setting up libbrotli1:armhf (1.1.0-2build1) ... 120s Setting up libsqlite3-0:armhf (3.45.1-1ubuntu1) ... 120s Setting up libsasl2-modules:armhf (2.1.28+dfsg1-5ubuntu1) ... 120s Setting up libuv1t64:armhf (1.48.0-1.1) ... 120s Setting up libmagic1t64:armhf (1:5.45-3) ... 120s Setting up rsyslog (8.2312.0-3ubuntu7) ... 120s info: The user `syslog' is already a member of `adm'. 120s apparmor_parser: Unable to replace "rsyslogd". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 120s 121s Setting up binutils-common:armhf (2.42-4ubuntu1) ... 121s Setting up libpsl5t64:armhf (0.21.2-1.1) ... 121s Setting up libnghttp2-14:armhf (1.59.0-1build1) ... 121s Setting up libreiserfscore0t64 (1:3.6.27-7.1) ... 121s Setting up libctf-nobfd0:armhf (2.42-4ubuntu1) ... 121s Setting up libnss-systemd:armhf (255.4-1ubuntu5) ... 121s Setting up krb5-locales (1.20.1-6ubuntu1) ... 121s Setting up file (1:5.45-3) ... 121s Setting up kmod (31+20240202-2ubuntu4) ... 121s Setting up lshw (02.19.git.2021.06.19.996aaad9c7-2build2) ... 121s Setting up libldap-common (2.6.7+dfsg-1~exp1ubuntu6) ... 121s Setting up libprotobuf-c1:armhf (1.4.1-1ubuntu3) ... 121s Setting up xxd (2:9.1.0016-1ubuntu6) ... 121s Setting up libsframe1:armhf (2.42-4ubuntu1) ... 121s Setting up libelf1t64:armhf (0.190-1.1build2) ... 121s Setting up libkrb5support0:armhf (1.20.1-6ubuntu1) ... 121s Setting up linux-headers-6.8.0-20-generic (6.8.0-20.20) ... 121s Setting up eject (2.39.3-9ubuntu2) ... 121s Setting up apparmor (4.0.0-beta3-0ubuntu2) ... 121s Installing new version of config file /etc/apparmor.d/abstractions/authentication ... 121s Installing new version of config file /etc/apparmor.d/abstractions/crypto ... 121s Installing new version of config file /etc/apparmor.d/abstractions/kde-open5 ... 121s Installing new version of config file /etc/apparmor.d/abstractions/openssl ... 121s Installing new version of config file /etc/apparmor.d/code ... 121s Installing new version of config file /etc/apparmor.d/firefox ... 121s apparmor_parser: Unable to replace "lsb_release". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 121s 121s apparmor_parser: Unable to replace "kmod". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 121s 121s apparmor_parser: Unable to replace "nvidia_modprobe". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 121s 122s sysctl: cannot stat /proc/sys/kernel/apparmor_restrict_unprivileged_userns: No such file or directory 122s Reloading AppArmor profiles 122s /sbin/apparmor_parser: Unable to replace "1password". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "Discord". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "MongoDB Compass". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "QtWebEngineProcess". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "brave". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "buildah". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "busybox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 122s /sbin/apparmor_parser: Unable to replace "cam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 122s 123s /sbin/apparmor_parser: Unable to replace "ch-checkns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "ch-run". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "vscode". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "crun". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "chrome". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "devhelp". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "epiphany". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "element-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "evolution". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "flatpak". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "firefox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "geary". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "github-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "goldendict". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "ipa_verify". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "keybase". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "kchmviewer". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lc-compliance". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "libcamerify". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "loupe". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "linux-sandbox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lxc-attach". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lxc-create". /sbin/apparmor_parser: Unable to replace "lxc-destroy". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lxc-execute". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lxc-stop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lxc-usernsexec". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "mmdebstrap". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "nautilus". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "notepadqq". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "msedge". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lxc-unshare". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "obsidian". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "opera". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "opam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "pageedit". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "podman". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "polypane". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "privacybrowser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "qmapshack". /sbin/apparmor_parser: Unable to replace "qutebrowser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "rootlesskit". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "rpm". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "rssguard". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-abort". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "runc". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-adduser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-apt". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "qcam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-clean". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-destroychroot". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-checkpackages". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-createchroot". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-hold". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-shell". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-unhold". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-update". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-distupgrade". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "sbuild-upgrade". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "scide". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "slack". /sbin/apparmor_parser: Unable to replace "slirp4netns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "stress-ng". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "steam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "signal-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "surfshark". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "thunderbird". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "systemd-coredump". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "tuxedo-control-center". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "tup". /sbin/apparmor_parser: Unable to replace "QtWebEngineProcess". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "plasmashell". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "trinity". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "toybox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "userbindmount". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "lsb_release". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "uwsgi-core". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "kmod". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "nvidia_modprobe". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "vdens". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "virtiofsd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "vivaldi-bin". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "vpnns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "wpcom". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "unprivileged_userns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "unix-chkpwd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "rsyslogd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "/usr/bin/man". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "ubuntu_pro_apt_news". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s /sbin/apparmor_parser: Unable to replace "tcpdump". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 123s 123s Error: At least one profile failed to load 123s Setting up libglib2.0-0t64:armhf (2.79.3-3ubuntu5) ... 123s No schema files found: doing nothing. 123s Setting up libglib2.0-data (2.79.3-3ubuntu5) ... 123s Setting up vim-common (2:9.1.0016-1ubuntu6) ... 123s Setting up gcc-13-base:armhf (13.2.0-21ubuntu1) ... 123s Setting up libqrtr-glib0:armhf (1.2.2-1ubuntu3) ... 123s Setting up libslang2:armhf (2.3.3-3build1) ... 123s Setting up libnvme1t64 (1.8-3) ... 123s Setting up mtr-tiny (0.95-1.1build1) ... 123s Setting up gnupg-l10n (2.4.4-2ubuntu15) ... 123s Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2build6) ... 123s Setting up libdbus-1-3:armhf (1.14.10-4ubuntu2) ... 123s Setting up xz-utils (5.6.0-0.2) ... 123s Setting up perl-modules-5.38 (5.38.2-3.2) ... 123s Setting up libproc2-0:armhf (2:4.0.4-4ubuntu2) ... 123s Setting up libblockdev-utils3:armhf (3.1.0-1build1) ... 123s Setting up libpng16-16t64:armhf (1.6.43-3) ... 123s Setting up systemd-timesyncd (255.4-1ubuntu5) ... 123s Setting up libevent-core-2.1-7:armhf (2.1.12-stable-9build1) ... 123s Setting up udev (255.4-1ubuntu5) ... 124s Setting up libss2:armhf (1.47.0-2.4~exp1ubuntu2) ... 124s Setting up usb.ids (2024.03.18-1) ... 124s Setting up sudo (1.9.15p5-3ubuntu3) ... 124s Setting up dhcpcd-base (1:10.0.6-1ubuntu2) ... 124s Setting up gir1.2-glib-2.0:armhf (2.79.3-3ubuntu5) ... 124s Setting up libk5crypto3:armhf (1.20.1-6ubuntu1) ... 124s Setting up logsave (1.47.0-2.4~exp1ubuntu2) ... 124s Setting up libfdisk1:armhf (2.39.3-9ubuntu2) ... 124s Setting up libdb5.3t64:armhf (5.3.28+dfsg2-6) ... 124s Setting up libblockdev-nvme3:armhf (3.1.0-1build1) ... 124s Setting up libdevmapper1.02.1:armhf (2:1.02.185-3ubuntu2) ... 124s Setting up libblockdev-fs3:armhf (3.1.0-1build1) ... 124s Setting up python-apt-common (2.7.7) ... 124s Setting up mount (2.39.3-9ubuntu2) ... 124s Setting up dmsetup (2:1.02.185-3ubuntu2) ... 124s Setting up uuid-runtime (2.39.3-9ubuntu2) ... 125s uuidd.service is a disabled or a static unit not running, not starting it. 125s Setting up libmm-glib0:armhf (1.23.4-0ubuntu1) ... 125s Setting up groff-base (1.23.0-3build1) ... 125s Setting up libplymouth5:armhf (24.004.60-1ubuntu6) ... 125s Setting up dbus-session-bus-common (1.14.10-4ubuntu2) ... 125s Setting up kpartx (0.9.4-5ubuntu6) ... 125s Setting up jq (1.7.1-3) ... 125s Setting up procps (2:4.0.4-4ubuntu2) ... 125s Setting up gpgconf (2.4.4-2ubuntu15) ... 125s Setting up libpcap0.8t64:armhf (1.10.4-4.1ubuntu2) ... 125s Setting up libcryptsetup12:armhf (2:2.7.0-1ubuntu2) ... 125s Setting up libgirepository-1.0-1:armhf (1.79.1-1ubuntu6) ... 125s Setting up libjson-glib-1.0-common (1.8.0-2build1) ... 125s Setting up libkrb5-3:armhf (1.20.1-6ubuntu1) ... 125s Setting up libpython3.11-minimal:armhf (3.11.8-1build4) ... 125s Setting up libusb-1.0-0:armhf (2:1.0.27-1) ... 125s Setting up libperl5.38t64:armhf (5.38.2-3.2) ... 125s Setting up tnftp (20230507-2build1) ... 125s Setting up libbinutils:armhf (2.42-4ubuntu1) ... 125s Setting up dbus-system-bus-common (1.14.10-4ubuntu2) ... 125s Setting up libfido2-1:armhf (1.14.0-1build1) ... 125s Setting up openssl (3.0.13-0ubuntu2) ... 125s Setting up readline-common (8.2-4) ... 125s Setting up libxml2:armhf (2.9.14+dfsg-1.3ubuntu2) ... 125s Setting up libxmuu1:armhf (2:1.1.3-3build1) ... 125s Setting up dbus-bin (1.14.10-4ubuntu2) ... 125s Setting up info (7.1-3build1) ... 125s Setting up liblocale-gettext-perl (1.07-6ubuntu4) ... 125s Setting up gpg (2.4.4-2ubuntu15) ... 125s Setting up libgudev-1.0-0:armhf (1:238-3ubuntu2) ... 125s Setting up libpolkit-gobject-1-0:armhf (124-1ubuntu1) ... 125s Setting up libbpf1:armhf (1:1.3.0-2build1) ... 125s Setting up libmbim-glib4:armhf (1.31.2-0ubuntu2) ... 125s Setting up rsync (3.2.7-1build1) ... 126s rsync.service is a disabled or a static unit not running, not starting it. 126s Setting up libudisks2-0:armhf (2.10.1-6) ... 126s Setting up bolt (0.9.6-2build1) ... 126s bolt.service is a disabled or a static unit not running, not starting it. 126s Setting up gnupg-utils (2.4.4-2ubuntu15) ... 126s Setting up initramfs-tools-bin (0.142ubuntu23) ... 126s Setting up libctf0:armhf (2.42-4ubuntu1) ... 126s Setting up cryptsetup-bin (2:2.7.0-1ubuntu2) ... 126s Setting up python3.11-minimal (3.11.8-1build4) ... 127s Setting up tcpdump (4.99.4-3ubuntu2) ... 128s apparmor_parser: Unable to replace "tcpdump". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 128s 128s Setting up apt-utils (2.7.14) ... 128s Setting up gpg-agent (2.4.4-2ubuntu15) ... 128s Setting up libpython3.12-stdlib:armhf (3.12.2-4build3) ... 128s Setting up libblockdev-mdraid3:armhf (3.1.0-1build1) ... 128s Setting up wget (1.21.4-1ubuntu2) ... 128s Setting up libblockdev-swap3:armhf (3.1.0-1build1) ... 128s Setting up plymouth (24.004.60-1ubuntu6) ... 128s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 128s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 129s Setting up libxmlb2:armhf (0.3.15-1build1) ... 129s Setting up btrfs-progs (6.6.3-1.1build1) ... 129s Setting up libpython3.11-stdlib:armhf (3.11.8-1build4) ... 129s Setting up python3.12 (3.12.2-4build3) ... 130s Setting up libblockdev-loop3:armhf (3.1.0-1build1) ... 130s Setting up gpgsm (2.4.4-2ubuntu15) ... 130s Setting up inetutils-telnet (2:2.5-3ubuntu3) ... 130s Setting up e2fsprogs (1.47.0-2.4~exp1ubuntu2) ... 130s update-initramfs: deferring update (trigger activated) 130s e2scrub_all.service is a disabled or a static unit not running, not starting it. 130s Setting up libparted2t64:armhf (3.6-3.1build2) ... 130s Setting up linux-headers-generic (6.8.0-20.20+1) ... 130s Setting up dbus-daemon (1.14.10-4ubuntu2) ... 131s Setting up libmbim-proxy (1.31.2-0ubuntu2) ... 131s Setting up vim-tiny (2:9.1.0016-1ubuntu6) ... 131s Setting up libnetplan1:armhf (1.0-1) ... 131s Setting up man-db (2.12.0-3build4) ... 131s Updating database of manual pages ... 132s apparmor_parser: Unable to replace "/usr/bin/man". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 132s 132s man-db.service is a disabled or a static unit not running, not starting it. 132s Setting up libblockdev3:armhf (3.1.0-1build1) ... 132s Setting up fdisk (2.39.3-9ubuntu2) ... 132s Setting up libjson-glib-1.0-0:armhf (1.8.0-2build1) ... 132s Setting up libblockdev-part3:armhf (3.1.0-1build1) ... 132s Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-5ubuntu1) ... 132s Setting up libftdi1-2:armhf (1.5-6build4) ... 132s Setting up perl (5.38.2-3.2) ... 132s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu6) ... 132s update-initramfs: deferring update (trigger activated) 132s Setting up gir1.2-girepository-2.0:armhf (1.79.1-1ubuntu6) ... 132s Setting up dbus (1.14.10-4ubuntu2) ... 132s A reboot is required to replace the running dbus-daemon. 132s Please reboot the system when convenient. 133s Setting up shared-mime-info (2.4-1build1) ... 133s Setting up libgssapi-krb5-2:armhf (1.20.1-6ubuntu1) ... 133s Setting up ftp (20230507-2build1) ... 133s Setting up keyboxd (2.4.4-2ubuntu15) ... 133s Setting up libdpkg-perl (1.22.6ubuntu4) ... 133s Setting up libsasl2-2:armhf (2.1.28+dfsg1-5ubuntu1) ... 133s Setting up libssh-4:armhf (0.10.6-2build1) ... 133s Setting up libpam-systemd:armhf (255.4-1ubuntu5) ... 133s Setting up libpolkit-agent-1-0:armhf (124-1ubuntu1) ... 133s Setting up libgpgme11t64:armhf (1.18.0-4.1ubuntu3) ... 133s Setting up netplan-generator (1.0-1) ... 133s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 133s Setting up initramfs-tools-core (0.142ubuntu23) ... 134s Setting up binutils-arm-linux-gnueabihf (2.42-4ubuntu1) ... 134s Setting up libarchive13t64:armhf (3.7.2-1.1ubuntu2) ... 134s Setting up libldap2:armhf (2.6.7+dfsg-1~exp1ubuntu6) ... 134s Setting up libpython3-stdlib:armhf (3.12.2-0ubuntu1) ... 134s Setting up systemd-resolved (255.4-1ubuntu5) ... 134s Setting up python3.11 (3.11.8-1build4) ... 135s Setting up telnet (0.17+2.5-3ubuntu3) ... 135s Setting up initramfs-tools (0.142ubuntu23) ... 135s update-initramfs: deferring update (trigger activated) 135s Setting up libcurl4t64:armhf (8.5.0-2ubuntu8) ... 135s Setting up bind9-libs:armhf (1:9.18.24-0ubuntu3) ... 135s Setting up libtirpc3t64:armhf (1.3.4+ds-1.1) ... 135s Setting up e2fsprogs-l10n (1.47.0-2.4~exp1ubuntu2) ... 135s Setting up iproute2 (6.1.0-1ubuntu5) ... 135s Setting up openssh-client (1:9.6p1-3ubuntu11) ... 135s Setting up libgusb2:armhf (0.4.8-1build1) ... 135s Setting up libcurl3t64-gnutls:armhf (8.5.0-2ubuntu8) ... 135s Setting up parted (3.6-3.1build2) ... 135s Setting up libqmi-glib5:armhf (1.35.2-0ubuntu1) ... 135s Setting up python3 (3.12.2-0ubuntu1) ... 136s Setting up binutils (2.42-4ubuntu1) ... 136s Setting up libjcat1:armhf (0.2.0-2build2) ... 136s Setting up dpkg-dev (1.22.6ubuntu4) ... 136s Setting up dirmngr (2.4.4-2ubuntu15) ... 136s Setting up dbus-user-session (1.14.10-4ubuntu2) ... 136s Setting up python3-cryptography (41.0.7-4build2) ... 136s Setting up python3-gi (3.47.0-3build1) ... 136s Setting up python3-typing-extensions (4.10.0-1) ... 136s Setting up lsof (4.95.0-1build2) ... 136s Setting up python3-pyrsistent:armhf (0.20.0-1build1) ... 137s Setting up libnsl2:armhf (1.3.0-3build2) ... 137s Setting up gnupg (2.4.4-2ubuntu15) ... 137s Setting up python3-netplan (1.0-1) ... 137s Setting up curl (8.5.0-2ubuntu8) ... 137s Setting up libvolume-key1:armhf (0.3.12-7build1) ... 137s Setting up bind9-host (1:9.18.24-0ubuntu3) ... 137s Setting up python3-lib2to3 (3.12.2-3ubuntu1.1) ... 137s Setting up python3-pkg-resources (68.1.2-2ubuntu1) ... 137s Setting up python3-distutils (3.12.2-3ubuntu1.1) ... 137s python3.12: can't get files for byte-compilation 137s Setting up openssh-sftp-server (1:9.6p1-3ubuntu11) ... 137s Setting up python3-dbus (1.3.2-5build2) ... 138s Setting up python3-setuptools (68.1.2-2ubuntu1) ... 138s Setting up gpg-wks-client (2.4.4-2ubuntu15) ... 138s Setting up openssh-server (1:9.6p1-3ubuntu11) ... 138s Replacing config file /etc/ssh/sshd_config with new version 140s Created symlink /etc/systemd/system/ssh.service.requires/ssh.socket → /usr/lib/systemd/system/ssh.socket. 141s Setting up libblockdev-crypto3:armhf (3.1.0-1build1) ... 141s Setting up python3-gdbm:armhf (3.12.2-3ubuntu1.1) ... 141s Setting up python3-apt (2.7.7) ... 141s Setting up libfwupd2:armhf (1.9.15-2) ... 141s Setting up python3-yaml (6.0.1-2build1) ... 141s Setting up libqmi-proxy (1.35.2-0ubuntu1) ... 141s Setting up netplan.io (1.0-1) ... 141s Setting up bind9-dnsutils (1:9.18.24-0ubuntu3) ... 141s Setting up ubuntu-pro-client (31.2.1) ... 141s apparmor_parser: Unable to replace "ubuntu_pro_apt_news". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 141s 143s Setting up fwupd (1.9.15-2) ... 143s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 143s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 143s fwupd.service is a disabled or a static unit not running, not starting it. 143s Setting up ubuntu-pro-client-l10n (31.2.1) ... 143s Setting up udisks2 (2.10.1-6) ... 143s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 143s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 143s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 143s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 143s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 143s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 143s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 143s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 143s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 143s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 143s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 143s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 144s Processing triggers for ufw (0.36.2-5) ... 144s Processing triggers for systemd (255.4-1ubuntu5) ... 144s Processing triggers for install-info (7.1-3build1) ... 144s Processing triggers for libc-bin (2.39-0ubuntu6) ... 144s Processing triggers for initramfs-tools (0.142ubuntu23) ... 145s Reading package lists... 146s Building dependency tree... 146s Reading state information... 146s The following packages will be REMOVED: 146s linux-headers-6.8.0-11* python3-distutils* python3-lib2to3* 147s 0 upgraded, 0 newly installed, 3 to remove and 1 not upgraded. 147s After this operation, 86.5 MB disk space will be freed. 147s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 147s Removing linux-headers-6.8.0-11 (6.8.0-11.11) ... 148s Removing python3-distutils (3.12.2-3ubuntu1.1) ... 148s Removing python3-lib2to3 (3.12.2-3ubuntu1.1) ... 150s autopkgtest [19:09:35]: rebooting testbed after setup commands that affected boot 187s autopkgtest [19:10:12]: testbed running kernel: Linux 5.15.0-101-generic #111-Ubuntu SMP Wed Mar 6 18:01:01 UTC 2024 211s autopkgtest [19:10:36]: @@@@@@@@@@@@@@@@@@@@ apt-source pyfastx 224s Get:1 http://ftpmaster.internal/ubuntu noble/universe pyfastx 2.0.2-2 (dsc) [2292 B] 224s Get:2 http://ftpmaster.internal/ubuntu noble/universe pyfastx 2.0.2-2 (tar) [230 kB] 224s Get:3 http://ftpmaster.internal/ubuntu noble/universe pyfastx 2.0.2-2 (diff) [33.6 kB] 224s gpgv: Signature made Wed Dec 13 10:25:09 2023 UTC 224s gpgv: using RSA key 8F91B227C7D6F2B1948C8236793CF67E8F0D11DA 224s gpgv: issuer "emollier@debian.org" 224s gpgv: Can't check signature: No public key 224s dpkg-source: warning: cannot verify inline signature for ./pyfastx_2.0.2-2.dsc: no acceptable signature found 224s autopkgtest [19:10:49]: testing package pyfastx version 2.0.2-2 226s autopkgtest [19:10:51]: build not needed 228s autopkgtest [19:10:53]: test run-unit-test: preparing testbed 236s Reading package lists... 237s Building dependency tree... 237s Reading state information... 237s Starting pkgProblemResolver with broken count: 0 237s Starting 2 pkgProblemResolver with broken count: 0 237s Done 238s The following additional packages will be installed: 238s pyfastx python3-all python3-importlib-metadata python3-more-itertools 238s python3-pyfaidx python3-pyfastx python3-zipp 238s Recommended packages: 238s python3-biopython 238s The following NEW packages will be installed: 238s autopkgtest-satdep pyfastx python3-all python3-importlib-metadata 238s python3-more-itertools python3-pyfaidx python3-pyfastx python3-zipp 238s 0 upgraded, 8 newly installed, 0 to remove and 1 not upgraded. 238s Need to get 293 kB/294 kB of archives. 238s After this operation, 887 kB of additional disk space will be used. 238s Get:1 /tmp/autopkgtest.1a9z0X/1-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [712 B] 238s Get:2 http://ftpmaster.internal/ubuntu noble/main armhf python3-more-itertools all 10.2.0-1 [52.9 kB] 239s Get:3 http://ftpmaster.internal/ubuntu noble/main armhf python3-zipp all 1.0.0-6 [6090 B] 239s Get:4 http://ftpmaster.internal/ubuntu noble/main armhf python3-importlib-metadata all 4.12.0-1 [17.8 kB] 239s Get:5 http://ftpmaster.internal/ubuntu noble/universe armhf python3-pyfaidx all 0.8.1.1-1 [29.6 kB] 239s Get:6 http://ftpmaster.internal/ubuntu noble/universe armhf python3-pyfastx armhf 2.0.2-2 [63.5 kB] 239s Get:7 http://ftpmaster.internal/ubuntu noble/universe armhf pyfastx armhf 2.0.2-2 [123 kB] 239s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-all armhf 3.12.2-0ubuntu1 [886 B] 239s Fetched 293 kB in 0s (598 kB/s) 239s Selecting previously unselected package python3-more-itertools. 239s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58436 files and directories currently installed.) 239s Preparing to unpack .../0-python3-more-itertools_10.2.0-1_all.deb ... 239s Unpacking python3-more-itertools (10.2.0-1) ... 239s Selecting previously unselected package python3-zipp. 239s Preparing to unpack .../1-python3-zipp_1.0.0-6_all.deb ... 239s Unpacking python3-zipp (1.0.0-6) ... 239s Selecting previously unselected package python3-importlib-metadata. 239s Preparing to unpack .../2-python3-importlib-metadata_4.12.0-1_all.deb ... 239s Unpacking python3-importlib-metadata (4.12.0-1) ... 239s Selecting previously unselected package python3-pyfaidx. 239s Preparing to unpack .../3-python3-pyfaidx_0.8.1.1-1_all.deb ... 239s Unpacking python3-pyfaidx (0.8.1.1-1) ... 239s Selecting previously unselected package python3-pyfastx. 239s Preparing to unpack .../4-python3-pyfastx_2.0.2-2_armhf.deb ... 239s Unpacking python3-pyfastx (2.0.2-2) ... 239s Selecting previously unselected package pyfastx. 239s Preparing to unpack .../5-pyfastx_2.0.2-2_armhf.deb ... 239s Unpacking pyfastx (2.0.2-2) ... 239s Selecting previously unselected package python3-all. 239s Preparing to unpack .../6-python3-all_3.12.2-0ubuntu1_armhf.deb ... 239s Unpacking python3-all (3.12.2-0ubuntu1) ... 239s Selecting previously unselected package autopkgtest-satdep. 239s Preparing to unpack .../7-1-autopkgtest-satdep.deb ... 239s Unpacking autopkgtest-satdep (0) ... 239s Setting up python3-more-itertools (10.2.0-1) ... 240s Setting up python3-all (3.12.2-0ubuntu1) ... 240s Setting up python3-zipp (1.0.0-6) ... 240s Setting up python3-importlib-metadata (4.12.0-1) ... 240s Setting up python3-pyfaidx (0.8.1.1-1) ... 240s Setting up python3-pyfastx (2.0.2-2) ... 240s Setting up pyfastx (2.0.2-2) ... 240s Setting up autopkgtest-satdep (0) ... 240s Processing triggers for man-db (2.12.0-3build4) ... 253s (Reading database ... 58533 files and directories currently installed.) 253s Removing autopkgtest-satdep (0) ... 258s autopkgtest [19:11:23]: test run-unit-test: [----------------------- 260s test_id_exception (tests.test_fakeys.IdentifierTest.test_id_exception) ... ok 260s test_key_identifier (tests.test_fakeys.IdentifierTest.test_key_identifier) ... ok 260s test_key_repr (tests.test_fakeys.IdentifierTest.test_key_repr) ... ok 260s test_key_slice (tests.test_fakeys.IdentifierTest.test_key_slice) ... ok 260s test_keys_filter (tests.test_fakeys.IdentifierTest.test_keys_filter) ... ok 260s test_keys_sort (tests.test_fakeys.IdentifierTest.test_keys_sort) ... ok 260s test_build (tests.test_fasta.FastaTest.test_build) ... ok 260s test_exception (tests.test_fasta.FastaTest.test_exception) ... ok 260s test_fasta (tests.test_fasta.FastaTest.test_fasta) ... ok 260s test_iter_full_name (tests.test_fasta.FastaTest.test_iter_full_name) ... ok 260s test_iter_object (tests.test_fasta.FastaTest.test_iter_object) ... ok 260s test_iter_tuple (tests.test_fasta.FastaTest.test_iter_tuple) ... ok 260s test_iter_upper (tests.test_fasta.FastaTest.test_iter_upper) ... ok 261s test_iter_upper_full_name (tests.test_fasta.FastaTest.test_iter_upper_full_name) ... ok 261s test_key_func (tests.test_fasta.FastaTest.test_key_func) ... ok 261s test_module (tests.test_fasta.FastaTest.test_module) ... ok 261s test_no_upper (tests.test_fasta.FastaTest.test_no_upper) ... ok 261s test_repr (tests.test_fasta.FastaTest.test_repr) ... ok 261s test_seq_fetch (tests.test_fasta.FastaTest.test_seq_fetch) ... ok 261s test_seq_flank (tests.test_fasta.FastaTest.test_seq_flank) ... ok 261s test_seq_type (tests.test_fasta.FastaTest.test_seq_type) ... ok 261s test_statistics (tests.test_fasta.FastaTest.test_statistics) ... ok 261s test_build (tests.test_fastq.FastqTest.test_build) ... ok 261s test_exception (tests.test_fastq.FastqTest.test_exception) ... ok 261s test_fastq (tests.test_fastq.FastqTest.test_fastq) ... ok 262s test_full_name (tests.test_fastq.FastqTest.test_full_name) ... ok 262s test_iter_object (tests.test_fastq.FastqTest.test_iter_object) ... ok 262s test_iter_tuple (tests.test_fastq.FastqTest.test_iter_tuple) ... ok 262s test_negative (tests.test_fastq.FastqTest.test_negative) ... ok 262s test_platform (tests.test_fastq.FastqTest.test_platform) ... ok 262s test_read_len (tests.test_fastq.FastqTest.test_read_len) ... ok 262s test_repr (tests.test_fastq.FastqTest.test_repr) ... ok 262s test_exception (tests.test_fastx.FastxTest.test_exception) ... ok 262s test_fasta_iter (tests.test_fastx.FastxTest.test_fasta_iter) ... ok 262s test_fasta_upper (tests.test_fastx.FastxTest.test_fasta_upper) ... ok 262s test_fastq_iter (tests.test_fastx.FastxTest.test_fastq_iter) ... ok 262s test_fastx_repr (tests.test_fastx.FastxTest.test_fastx_repr) ... ok 262s test_exception (tests.test_fqkeys.FastxTest.test_exception) ... ok 262s test_fastq_key (tests.test_fqkeys.FastxTest.test_fastq_key) ... ok 262s test_read (tests.test_read.ReadTest.test_read) ... ok 262s test_read_description (tests.test_read.ReadTest.test_read_description) ... ok 263s test_read_raw (tests.test_read.ReadTest.test_read_raw) ... ok 263s test_read_seq (tests.test_read.ReadTest.test_read_seq) ... ok 263s test_repr (tests.test_read.ReadTest.test_repr) ... ok 263s test_full_compo (tests.test_sequence.SequenceTest.test_full_compo) ... ok 263s test_seq_by_index (tests.test_sequence.SequenceTest.test_seq_by_index) ... ok 263s test_seq_by_key (tests.test_sequence.SequenceTest.test_seq_by_key) ... ok 263s test_seq_content (tests.test_sequence.SequenceTest.test_seq_content) ... ok 263s test_seq_exception (tests.test_sequence.SequenceTest.test_seq_exception) ... ok 263s test_seq_iter (tests.test_sequence.SequenceTest.test_seq_iter) ... ok 263s test_seq_raw (tests.test_sequence.SequenceTest.test_seq_raw) ... ok 263s test_seq_repr (tests.test_sequence.SequenceTest.test_seq_repr) ... ok 263s test_seq_reverse_complement (tests.test_sequence.SequenceTest.test_seq_reverse_complement) ... ok 263s test_seq_slice (tests.test_sequence.SequenceTest.test_seq_slice) ... ok 263s test_seq_by_index (tests.test_sequence_error.SequenceErrorTest.test_seq_by_index) ... ok 263s test_seq_by_key (tests.test_sequence_error.SequenceErrorTest.test_seq_by_key) ... ok 263s 263s ---------------------------------------------------------------------- 263s Ran 56 tests in 3.600s 263s 263s OK 263s pyfastx: 2.0.2; zlib: 1.3; sqlite: 3.44.2; zran: 1.7.0 264s autopkgtest [19:11:29]: test run-unit-test: -----------------------] 267s autopkgtest [19:11:32]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 267s run-unit-test PASS 271s autopkgtest [19:11:36]: test test-cli: preparing testbed 298s autopkgtest [19:12:03]: testbed dpkg architecture: armhf 300s autopkgtest [19:12:05]: testbed apt version: 2.7.12 300s autopkgtest [19:12:05]: @@@@@@@@@@@@@@@@@@@@ test bed setup 307s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 308s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [57.3 kB] 308s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [495 kB] 308s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [6540 B] 308s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [4007 kB] 308s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main armhf Packages [671 kB] 308s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main armhf c-n-f Metadata [2492 B] 308s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted armhf Packages [1372 B] 308s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted armhf c-n-f Metadata [116 B] 308s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe armhf Packages [4100 kB] 308s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe armhf c-n-f Metadata [7776 B] 308s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse armhf Packages [48.7 kB] 308s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse armhf c-n-f Metadata [116 B] 311s Fetched 9514 kB in 2s (5261 kB/s) 311s Reading package lists... 318s tee: /proc/self/fd/2: Permission denied 340s Hit:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease 340s Hit:2 http://ftpmaster.internal/ubuntu noble InRelease 340s Hit:3 http://ftpmaster.internal/ubuntu noble-updates InRelease 340s Hit:4 http://ftpmaster.internal/ubuntu noble-security InRelease 342s Reading package lists... 342s Reading package lists... 342s Building dependency tree... 342s Reading state information... 342s Calculating upgrade... 343s The following packages were automatically installed and are no longer required: 343s linux-headers-6.8.0-11 python3-distutils python3-lib2to3 343s Use 'apt autoremove' to remove them. 343s The following packages will be REMOVED: 343s libapt-pkg6.0 libarchive13 libatm1 libcurl3-gnutls libcurl4 libdb5.3 libelf1 343s libext2fs2 libgdbm-compat4 libgdbm6 libglib2.0-0 libgnutls30 libgpgme11 343s libhogweed6 libmagic1 libnetplan0 libnettle8 libnpth0 libnvme1 libparted2 343s libpcap0.8 libperl5.38 libpng16-16 libpsl5 libreadline8 libreiserfscore0 343s libssl3 libtirpc3 libuv1 linux-headers-6.8.0-11-generic 343s The following NEW packages will be installed: 343s libapt-pkg6.0t64 libarchive13t64 libatm1t64 libcurl3t64-gnutls libcurl4t64 343s libdb5.3t64 libelf1t64 libext2fs2t64 libgdbm-compat4t64 libgdbm6t64 343s libglib2.0-0t64 libgnutls30t64 libgpgme11t64 libhogweed6t64 libmagic1t64 343s libnetplan1 libnettle8t64 libnpth0t64 libnvme1t64 libparted2t64 343s libpcap0.8t64 libperl5.38t64 libpng16-16t64 libpsl5t64 libreadline8t64 343s libreiserfscore0t64 libssl3t64 libtirpc3t64 libuv1t64 linux-headers-6.8.0-20 343s linux-headers-6.8.0-20-generic xdg-user-dirs 343s The following packages have been kept back: 343s multipath-tools 343s The following packages will be upgraded: 343s apparmor apt apt-utils bind9-dnsutils bind9-host bind9-libs binutils 343s binutils-arm-linux-gnueabihf binutils-common bolt bsdextrautils bsdutils 343s btrfs-progs coreutils cryptsetup-bin curl dbus dbus-bin dbus-daemon 343s dbus-session-bus-common dbus-system-bus-common dbus-user-session dhcpcd-base 343s dirmngr dmsetup dpkg dpkg-dev e2fsprogs e2fsprogs-l10n eject fdisk file ftp 343s fwupd gawk gcc-13-base gcc-14-base gir1.2-girepository-2.0 gir1.2-glib-2.0 343s gnupg gnupg-l10n gnupg-utils gpg gpg-agent gpg-wks-client gpgconf gpgsm gpgv 343s groff-base ibverbs-providers inetutils-telnet info initramfs-tools 343s initramfs-tools-bin initramfs-tools-core install-info iproute2 jq keyboxd 343s kmod kpartx krb5-locales libapparmor1 libaudit-common libaudit1 libbinutils 343s libblkid1 libblockdev-crypto3 libblockdev-fs3 libblockdev-loop3 343s libblockdev-mdraid3 libblockdev-nvme3 libblockdev-part3 libblockdev-swap3 343s libblockdev-utils3 libblockdev3 libbpf1 libbrotli1 libcap-ng0 libcom-err2 343s libcryptsetup12 libctf-nobfd0 libctf0 libdbus-1-3 libdebconfclient0 343s libdevmapper1.02.1 libdpkg-perl libevent-core-2.1-7 libexpat1 libfdisk1 343s libfido2-1 libftdi1-2 libfwupd2 libgcc-s1 libgirepository-1.0-1 343s libglib2.0-data libgssapi-krb5-2 libgudev-1.0-0 libgusb2 libibverbs1 343s libjcat1 libjq1 libjson-glib-1.0-0 libjson-glib-1.0-common libk5crypto3 343s libkmod2 libkrb5-3 libkrb5support0 libldap-common libldap2 343s liblocale-gettext-perl liblzma5 libmagic-mgc libmbim-glib4 libmbim-proxy 343s libmm-glib0 libmount1 libnghttp2-14 libnsl2 libnss-systemd libpam-modules 343s libpam-modules-bin libpam-runtime libpam-systemd libpam0g libplymouth5 343s libpolkit-agent-1-0 libpolkit-gobject-1-0 libproc2-0 libprotobuf-c1 343s libpython3-stdlib libpython3.11-minimal libpython3.11-stdlib 343s libpython3.12-minimal libpython3.12-stdlib libqmi-glib5 libqmi-proxy 343s libqrtr-glib0 librtmp1 libsasl2-2 libsasl2-modules libsasl2-modules-db 343s libseccomp2 libselinux1 libsemanage-common libsemanage2 libsframe1 libslang2 343s libsmartcols1 libsqlite3-0 libss2 libssh-4 libstdc++6 libsystemd-shared 343s libsystemd0 libtext-charwidth-perl libtext-iconv-perl libtirpc-common 343s libudev1 libudisks2-0 libusb-1.0-0 libuuid1 libvolume-key1 libxml2 libxmlb2 343s libxmuu1 linux-headers-generic logsave lshw lsof man-db mount mtr-tiny 343s netplan-generator netplan.io openssh-client openssh-server 343s openssh-sftp-server openssl parted perl perl-base perl-modules-5.38 343s pinentry-curses plymouth plymouth-theme-ubuntu-text procps psmisc 343s python-apt-common python3 python3-apt python3-cryptography python3-dbus 343s python3-distutils python3-gdbm python3-gi python3-lib2to3 python3-minimal 343s python3-netplan python3-pkg-resources python3-pyrsistent python3-setuptools 343s python3-typing-extensions python3-yaml python3.11 python3.11-minimal 343s python3.12 python3.12-minimal readline-common rsync rsyslog shared-mime-info 343s sudo systemd systemd-dev systemd-resolved systemd-sysv systemd-timesyncd 343s tcpdump telnet tnftp ubuntu-pro-client ubuntu-pro-client-l10n udev udisks2 343s usb.ids util-linux uuid-runtime vim-common vim-tiny wget xxd xz-utils zlib1g 343s 234 upgraded, 32 newly installed, 30 to remove and 1 not upgraded. 343s Need to get 100 MB of archives. 343s After this operation, 85.0 MB of additional disk space will be used. 343s Get:1 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bsdutils armhf 1:2.39.3-9ubuntu2 [102 kB] 343s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libbrotli1 armhf 1.1.0-2build1 [319 kB] 343s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgssapi-krb5-2 armhf 1.20.1-6ubuntu1 [119 kB] 343s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libkrb5-3 armhf 1.20.1-6ubuntu1 [320 kB] 344s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libkrb5support0 armhf 1.20.1-6ubuntu1 [31.5 kB] 344s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libk5crypto3 armhf 1.20.1-6ubuntu1 [78.6 kB] 344s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcom-err2 armhf 1.47.0-2.4~exp1ubuntu2 [21.9 kB] 344s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/main armhf zlib1g armhf 1:1.3.dfsg-3.1ubuntu1 [49.2 kB] 344s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/main armhf librtmp1 armhf 2.4+20151223.gitfa8646d.1-2build6 [51.3 kB] 344s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/main armhf udisks2 armhf 2.10.1-6 [276 kB] 344s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libudisks2-0 armhf 2.10.1-6 [143 kB] 344s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblkid1 armhf 2.39.3-9ubuntu2 [160 kB] 344s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/main armhf liblzma5 armhf 5.6.0-0.2 [117 kB] 344s Get:14 http://ftpmaster.internal/ubuntu noble-proposed/main armhf kmod armhf 31+20240202-2ubuntu4 [91.8 kB] 344s Get:15 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libkmod2 armhf 31+20240202-2ubuntu4 [44.9 kB] 344s Get:16 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-dev all 255.4-1ubuntu5 [103 kB] 344s Get:17 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-timesyncd armhf 255.4-1ubuntu5 [36.0 kB] 344s Get:18 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-session-bus-common all 1.14.10-4ubuntu2 [80.3 kB] 344s Get:19 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libaudit-common all 1:3.1.2-2.1 [5674 B] 344s Get:20 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcap-ng0 armhf 0.8.4-2build1 [13.5 kB] 344s Get:21 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libaudit1 armhf 1:3.1.2-2.1 [44.3 kB] 344s Get:22 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam0g armhf 1.5.3-5ubuntu3 [62.0 kB] 344s Get:23 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libselinux1 armhf 3.5-2ubuntu1 [70.9 kB] 344s Get:24 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcurl4t64 armhf 8.5.0-2ubuntu8 [296 kB] 344s Get:25 http://ftpmaster.internal/ubuntu noble-proposed/main armhf curl armhf 8.5.0-2ubuntu8 [219 kB] 344s Get:26 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpsl5t64 armhf 0.21.2-1.1 [55.7 kB] 344s Get:27 http://ftpmaster.internal/ubuntu noble-proposed/main armhf wget armhf 1.21.4-1ubuntu2 [317 kB] 344s Get:28 http://ftpmaster.internal/ubuntu noble-proposed/main armhf tnftp armhf 20230507-2build1 [98.6 kB] 344s Get:29 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpcap0.8t64 armhf 1.10.4-4.1ubuntu2 [137 kB] 345s Get:30 http://ftpmaster.internal/ubuntu noble-proposed/main armhf tcpdump armhf 4.99.4-3ubuntu2 [425 kB] 345s Get:31 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsystemd-shared armhf 255.4-1ubuntu5 [2009 kB] 345s Get:32 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-resolved armhf 255.4-1ubuntu5 [289 kB] 345s Get:33 http://ftpmaster.internal/ubuntu noble-proposed/main armhf sudo armhf 1.9.15p5-3ubuntu3 [936 kB] 345s Get:34 http://ftpmaster.internal/ubuntu noble-proposed/main armhf rsync armhf 3.2.7-1build1 [413 kB] 345s Get:35 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-cryptography armhf 41.0.7-4build2 [788 kB] 345s Get:36 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssl armhf 3.0.13-0ubuntu2 [975 kB] 346s Get:37 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssh-sftp-server armhf 1:9.6p1-3ubuntu11 [35.5 kB] 346s Get:38 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssh-client armhf 1:9.6p1-3ubuntu11 [890 kB] 346s Get:39 http://ftpmaster.internal/ubuntu noble-proposed/main armhf openssh-server armhf 1:9.6p1-3ubuntu11 [503 kB] 346s Get:40 http://ftpmaster.internal/ubuntu noble-proposed/main armhf linux-headers-6.8.0-20 all 6.8.0-20.20 [13.6 MB] 347s Get:41 http://ftpmaster.internal/ubuntu noble-proposed/main armhf linux-headers-6.8.0-20-generic armhf 6.8.0-20.20 [1287 kB] 347s Get:42 http://ftpmaster.internal/ubuntu noble-proposed/main armhf linux-headers-generic armhf 6.8.0-20.20+1 [9610 B] 347s Get:43 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libssl3t64 armhf 3.0.13-0ubuntu2 [1558 kB] 347s Get:44 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnss-systemd armhf 255.4-1ubuntu5 [148 kB] 347s Get:45 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libudev1 armhf 255.4-1ubuntu5 [166 kB] 347s Get:46 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd armhf 255.4-1ubuntu5 [3502 kB] 347s Get:47 http://ftpmaster.internal/ubuntu noble-proposed/main armhf udev armhf 255.4-1ubuntu5 [1852 kB] 347s Get:48 http://ftpmaster.internal/ubuntu noble-proposed/main armhf systemd-sysv armhf 255.4-1ubuntu5 [11.9 kB] 347s Get:49 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-systemd armhf 255.4-1ubuntu5 [216 kB] 347s Get:50 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsystemd0 armhf 255.4-1ubuntu5 [410 kB] 347s Get:51 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-modules-bin armhf 1.5.3-5ubuntu3 [47.0 kB] 347s Get:52 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-modules armhf 1.5.3-5ubuntu3 [261 kB] 347s Get:53 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpam-runtime all 1.5.3-5ubuntu3 [40.8 kB] 347s Get:54 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-user-session armhf 1.14.10-4ubuntu2 [9962 B] 347s Get:55 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libapparmor1 armhf 4.0.0-beta3-0ubuntu2 [45.0 kB] 347s Get:56 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gcc-14-base armhf 14-20240315-1ubuntu1 [47.0 kB] 347s Get:57 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgcc-s1 armhf 14-20240315-1ubuntu1 [41.5 kB] 347s Get:58 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libstdc++6 armhf 14-20240315-1ubuntu1 [714 kB] 347s Get:59 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libexpat1 armhf 2.6.1-2 [65.9 kB] 347s Get:60 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-system-bus-common all 1.14.10-4ubuntu2 [81.5 kB] 347s Get:61 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-bin armhf 1.14.10-4ubuntu2 [37.1 kB] 347s Get:62 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus armhf 1.14.10-4ubuntu2 [28.1 kB] 347s Get:63 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dbus-daemon armhf 1.14.10-4ubuntu2 [109 kB] 347s Get:64 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdbus-1-3 armhf 1.14.10-4ubuntu2 [190 kB] 347s Get:65 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmount1 armhf 2.39.3-9ubuntu2 [171 kB] 347s Get:66 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libseccomp2 armhf 2.5.5-1ubuntu2 [49.5 kB] 347s Get:67 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdevmapper1.02.1 armhf 2:1.02.185-3ubuntu2 [135 kB] 347s Get:68 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libuuid1 armhf 2.39.3-9ubuntu2 [34.4 kB] 347s Get:69 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcryptsetup12 armhf 2:2.7.0-1ubuntu2 [238 kB] 347s Get:70 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libfdisk1 armhf 2.39.3-9ubuntu2 [196 kB] 347s Get:71 http://ftpmaster.internal/ubuntu noble-proposed/main armhf mount armhf 2.39.3-9ubuntu2 [134 kB] 347s Get:72 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-utils3 armhf 3.1.0-1build1 [16.9 kB] 347s Get:73 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libvolume-key1 armhf 0.3.12-7build1 [38.4 kB] 347s Get:74 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjcat1 armhf 0.2.0-2build2 [30.4 kB] 347s Get:75 http://ftpmaster.internal/ubuntu noble-proposed/main armhf parted armhf 3.6-3.1build2 [39.4 kB] 347s Get:76 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libparted2t64 armhf 3.6-3.1build2 [143 kB] 347s Get:77 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.12 armhf 3.12.2-4build3 [645 kB] 347s Get:78 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.12-minimal armhf 3.12.2-4build3 [1942 kB] 347s Get:79 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.12-stdlib armhf 3.12.2-4build3 [1906 kB] 347s Get:80 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.12-minimal armhf 3.12.2-4build3 [816 kB] 347s Get:81 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsasl2-modules-db armhf 2.1.28+dfsg1-5ubuntu1 [19.0 kB] 347s Get:82 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.11 armhf 3.11.8-1build4 [589 kB] 348s Get:83 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3.11-minimal armhf 3.11.8-1build4 [1795 kB] 348s Get:84 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.11-stdlib armhf 3.11.8-1build4 [1810 kB] 348s Get:85 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3.11-minimal armhf 3.11.8-1build4 [826 kB] 348s Get:86 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsqlite3-0 armhf 3.45.1-1ubuntu1 [599 kB] 348s Get:87 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtext-iconv-perl armhf 1.7-8build2 [12.7 kB] 348s Get:88 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtext-charwidth-perl armhf 0.04-11build2 [8962 B] 348s Get:89 http://ftpmaster.internal/ubuntu noble-proposed/main armhf perl-modules-5.38 all 5.38.2-3.2 [3110 kB] 348s Get:90 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdb5.3t64 armhf 5.3.28+dfsg2-6 [661 kB] 348s Get:91 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-gdbm armhf 3.12.2-3ubuntu1.1 [17.1 kB] 348s Get:92 http://ftpmaster.internal/ubuntu noble-proposed/main armhf man-db armhf 2.12.0-3build4 [1196 kB] 348s Get:93 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgdbm6t64 armhf 1.23-5.1 [30.3 kB] 348s Get:94 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgdbm-compat4t64 armhf 1.23-5.1 [6208 B] 348s Get:95 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libperl5.38t64 armhf 5.38.2-3.2 [4101 kB] 348s Get:96 http://ftpmaster.internal/ubuntu noble-proposed/main armhf perl armhf 5.38.2-3.2 [231 kB] 348s Get:97 http://ftpmaster.internal/ubuntu noble-proposed/main armhf perl-base armhf 5.38.2-3.2 [1671 kB] 348s Get:98 http://ftpmaster.internal/ubuntu noble-proposed/main armhf liblocale-gettext-perl armhf 1.07-6ubuntu4 [15.0 kB] 348s Get:99 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnettle8t64 armhf 3.9.1-2.2 [187 kB] 348s Get:100 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libhogweed6t64 armhf 3.9.1-2.2 [187 kB] 348s Get:101 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgnutls30t64 armhf 3.8.3-1.1ubuntu2 [1046 kB] 348s Get:102 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libldap2 armhf 2.6.7+dfsg-1~exp1ubuntu6 [172 kB] 348s Get:103 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libcurl3t64-gnutls armhf 8.5.0-2ubuntu8 [290 kB] 348s Get:104 http://ftpmaster.internal/ubuntu noble-proposed/main armhf shared-mime-info armhf 2.4-1build1 [470 kB] 349s Get:105 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gir1.2-girepository-2.0 armhf 1.79.1-1ubuntu6 [24.8 kB] 349s Get:106 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gir1.2-glib-2.0 armhf 2.79.3-3ubuntu5 [182 kB] 349s Get:107 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgirepository-1.0-1 armhf 1.79.1-1ubuntu6 [106 kB] 349s Get:108 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-gi armhf 3.47.0-3build1 [219 kB] 349s Get:109 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-dbus armhf 1.3.2-5build2 [94.7 kB] 349s Get:110 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnetplan1 armhf 1.0-1 [113 kB] 349s Get:111 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-netplan armhf 1.0-1 [22.5 kB] 349s Get:112 http://ftpmaster.internal/ubuntu noble-proposed/main armhf netplan-generator armhf 1.0-1 [58.7 kB] 349s Get:113 http://ftpmaster.internal/ubuntu noble-proposed/main armhf initramfs-tools-bin armhf 0.142ubuntu23 [20.3 kB] 349s Get:114 http://ftpmaster.internal/ubuntu noble-proposed/main armhf initramfs-tools-core all 0.142ubuntu23 [50.1 kB] 349s Get:115 http://ftpmaster.internal/ubuntu noble-proposed/main armhf initramfs-tools all 0.142ubuntu23 [9058 B] 349s Get:116 http://ftpmaster.internal/ubuntu noble-proposed/main armhf netplan.io armhf 1.0-1 [64.3 kB] 349s Get:117 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libxmlb2 armhf 0.3.15-1build1 [57.0 kB] 349s Get:118 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libqrtr-glib0 armhf 1.2.2-1ubuntu3 [15.4 kB] 349s Get:119 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libqmi-glib5 armhf 1.35.2-0ubuntu1 [908 kB] 349s Get:120 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libqmi-proxy armhf 1.35.2-0ubuntu1 [5732 B] 349s Get:121 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpolkit-agent-1-0 armhf 124-1ubuntu1 [15.3 kB] 349s Get:122 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpolkit-gobject-1-0 armhf 124-1ubuntu1 [44.1 kB] 349s Get:123 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libglib2.0-0t64 armhf 2.79.3-3ubuntu5 [1414 kB] 349s Get:124 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libfwupd2 armhf 1.9.15-2 [123 kB] 349s Get:125 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libarchive13t64 armhf 3.7.2-1.1ubuntu2 [330 kB] 349s Get:126 http://ftpmaster.internal/ubuntu noble-proposed/main armhf fwupd armhf 1.9.15-2 [4350 kB] 349s Get:127 http://ftpmaster.internal/ubuntu noble-proposed/main armhf apt-utils armhf 2.7.14 [210 kB] 349s Get:128 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libapt-pkg6.0t64 armhf 2.7.14 [986 kB] 349s Get:129 http://ftpmaster.internal/ubuntu noble-proposed/main armhf apt armhf 2.7.14 [1368 kB] 349s Get:130 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ubuntu-pro-client-l10n armhf 31.2.1 [19.4 kB] 349s Get:131 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ubuntu-pro-client armhf 31.2.1 [216 kB] 349s Get:132 http://ftpmaster.internal/ubuntu noble-proposed/main armhf keyboxd armhf 2.4.4-2ubuntu15 [111 kB] 349s Get:133 http://ftpmaster.internal/ubuntu noble/main armhf libnpth0t64 armhf 1.6-3.1 [6940 B] 349s Get:134 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpgv armhf 2.4.4-2ubuntu15 [224 kB] 349s Get:135 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpg armhf 2.4.4-2ubuntu15 [524 kB] 349s Get:136 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpg-wks-client armhf 2.4.4-2ubuntu15 [87.4 kB] 349s Get:137 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gnupg-utils armhf 2.4.4-2ubuntu15 [158 kB] 349s Get:138 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpg-agent armhf 2.4.4-2ubuntu15 [235 kB] 349s Get:139 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpgsm armhf 2.4.4-2ubuntu15 [241 kB] 349s Get:140 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libreadline8t64 armhf 8.2-4 [129 kB] 349s Get:141 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gawk armhf 1:5.2.1-2build2 [415 kB] 349s Get:142 http://ftpmaster.internal/ubuntu noble-proposed/main armhf fdisk armhf 2.39.3-9ubuntu2 [135 kB] 349s Get:143 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gpgconf armhf 2.4.4-2ubuntu15 [115 kB] 349s Get:144 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dirmngr armhf 2.4.4-2ubuntu15 [346 kB] 349s Get:145 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gnupg all 2.4.4-2ubuntu15 [359 kB] 349s Get:146 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-apt armhf 2.7.7 [162 kB] 349s Get:147 http://ftpmaster.internal/ubuntu noble-proposed/main armhf pinentry-curses armhf 1.2.1-3ubuntu4 [36.7 kB] 349s Get:148 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-yaml armhf 6.0.1-2build1 [117 kB] 349s Get:149 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python-apt-common all 2.7.7 [19.8 kB] 349s Get:150 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-setuptools all 68.1.2-2ubuntu1 [396 kB] 349s Get:151 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-pkg-resources all 68.1.2-2ubuntu1 [168 kB] 349s Get:152 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dpkg armhf 1.22.6ubuntu4 [1229 kB] 349s Get:153 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-minimal armhf 3.12.2-0ubuntu1 [27.1 kB] 349s Get:154 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3 armhf 3.12.2-0ubuntu1 [24.1 kB] 349s Get:155 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpython3-stdlib armhf 3.12.2-0ubuntu1 [9802 B] 349s Get:156 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsmartcols1 armhf 2.39.3-9ubuntu2 [117 kB] 349s Get:157 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bsdextrautils armhf 2.39.3-9ubuntu2 [78.7 kB] 349s Get:158 http://ftpmaster.internal/ubuntu noble-proposed/main armhf groff-base armhf 1.23.0-3build1 [946 kB] 349s Get:159 http://ftpmaster.internal/ubuntu noble-proposed/main armhf readline-common all 8.2-4 [56.4 kB] 349s Get:160 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgpgme11t64 armhf 1.18.0-4.1ubuntu3 [120 kB] 349s Get:161 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-crypto3 armhf 3.1.0-1build1 [20.3 kB] 349s Get:162 http://ftpmaster.internal/ubuntu noble-proposed/main armhf e2fsprogs-l10n all 1.47.0-2.4~exp1ubuntu2 [5996 B] 349s Get:163 http://ftpmaster.internal/ubuntu noble-proposed/main armhf logsave armhf 1.47.0-2.4~exp1ubuntu2 [21.9 kB] 349s Get:164 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dhcpcd-base armhf 1:10.0.6-1ubuntu2 [186 kB] 349s Get:165 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-fs3 armhf 3.1.0-1build1 [34.4 kB] 349s Get:166 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libreiserfscore0t64 armhf 1:3.6.27-7.1 [66.2 kB] 349s Get:167 http://ftpmaster.internal/ubuntu noble-proposed/main armhf btrfs-progs armhf 6.6.3-1.1build1 [852 kB] 349s Get:168 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libext2fs2t64 armhf 1.47.0-2.4~exp1ubuntu2 [201 kB] 350s Get:169 http://ftpmaster.internal/ubuntu noble-proposed/main armhf e2fsprogs armhf 1.47.0-2.4~exp1ubuntu2 [571 kB] 350s Get:170 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-loop3 armhf 3.1.0-1build1 [6502 B] 350s Get:171 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-mdraid3 armhf 3.1.0-1build1 [13.3 kB] 350s Get:172 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-nvme3 armhf 3.1.0-1build1 [17.5 kB] 350s Get:173 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnvme1t64 armhf 1.8-3 [67.5 kB] 350s Get:174 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-part3 armhf 3.1.0-1build1 [16.4 kB] 350s Get:175 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev-swap3 armhf 3.1.0-1build1 [8894 B] 350s Get:176 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libblockdev3 armhf 3.1.0-1build1 [42.9 kB] 350s Get:177 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgudev-1.0-0 armhf 1:238-3ubuntu2 [13.6 kB] 350s Get:178 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libxml2 armhf 2.9.14+dfsg-1.3ubuntu2 [595 kB] 350s Get:179 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libbpf1 armhf 1:1.3.0-2build1 [146 kB] 350s Get:180 http://ftpmaster.internal/ubuntu noble-proposed/main armhf iproute2 armhf 6.1.0-1ubuntu5 [1060 kB] 350s Get:181 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libelf1t64 armhf 0.190-1.1build2 [49.9 kB] 350s Get:182 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtirpc-common all 1.3.4+ds-1.1 [8018 B] 350s Get:183 http://ftpmaster.internal/ubuntu noble-proposed/main armhf lsof armhf 4.95.0-1build2 [248 kB] 350s Get:184 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnsl2 armhf 1.3.0-3build2 [36.5 kB] 350s Get:185 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libtirpc3t64 armhf 1.3.4+ds-1.1 [73.2 kB] 350s Get:186 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmbim-proxy armhf 1.31.2-0ubuntu2 [5748 B] 350s Get:187 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmbim-glib4 armhf 1.31.2-0ubuntu2 [216 kB] 350s Get:188 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjson-glib-1.0-common all 1.8.0-2build1 [4210 B] 350s Get:189 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjson-glib-1.0-0 armhf 1.8.0-2build1 [61.2 kB] 350s Get:190 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libnghttp2-14 armhf 1.59.0-1build1 [68.1 kB] 350s Get:191 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libssh-4 armhf 0.10.6-2build1 [169 kB] 350s Get:192 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libusb-1.0-0 armhf 2:1.0.27-1 [48.7 kB] 350s Get:193 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libgusb2 armhf 0.4.8-1build1 [34.6 kB] 350s Get:194 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmm-glib0 armhf 1.23.4-0ubuntu1 [214 kB] 350s Get:195 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libprotobuf-c1 armhf 1.4.1-1ubuntu3 [17.7 kB] 350s Get:196 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsasl2-2 armhf 2.1.28+dfsg1-5ubuntu1 [49.7 kB] 350s Get:197 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libibverbs1 armhf 50.0-2build1 [57.9 kB] 350s Get:198 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libfido2-1 armhf 1.14.0-1build1 [75.8 kB] 350s Get:199 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libproc2-0 armhf 2:4.0.4-4ubuntu2 [49.0 kB] 350s Get:200 http://ftpmaster.internal/ubuntu noble-proposed/main armhf procps armhf 2:4.0.4-4ubuntu2 [700 kB] 350s Get:201 http://ftpmaster.internal/ubuntu noble-proposed/main armhf coreutils armhf 9.4-3ubuntu3 [1280 kB] 350s Get:202 http://ftpmaster.internal/ubuntu noble-proposed/main armhf util-linux armhf 2.39.3-9ubuntu2 [1216 kB] 350s Get:203 http://ftpmaster.internal/ubuntu noble-proposed/main armhf file armhf 1:5.45-3 [21.1 kB] 350s Get:204 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmagic-mgc armhf 1:5.45-3 [307 kB] 350s Get:205 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libmagic1t64 armhf 1:5.45-3 [81.4 kB] 350s Get:206 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libplymouth5 armhf 24.004.60-1ubuntu6 [140 kB] 351s Get:207 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libpng16-16t64 armhf 1.6.43-3 [166 kB] 351s Get:208 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bind9-host armhf 1:9.18.24-0ubuntu3 [47.4 kB] 351s Get:209 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bind9-dnsutils armhf 1:9.18.24-0ubuntu3 [149 kB] 351s Get:210 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bind9-libs armhf 1:9.18.24-0ubuntu3 [1148 kB] 351s Get:211 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libuv1t64 armhf 1.48.0-1.1 [82.9 kB] 351s Get:212 http://ftpmaster.internal/ubuntu noble-proposed/main armhf uuid-runtime armhf 2.39.3-9ubuntu2 [41.7 kB] 351s Get:213 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdebconfclient0 armhf 0.271ubuntu2 [10.8 kB] 351s Get:214 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsemanage-common all 3.5-1build4 [10.1 kB] 351s Get:215 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsemanage2 armhf 3.5-1build4 [84.5 kB] 351s Get:216 http://ftpmaster.internal/ubuntu noble-proposed/main armhf install-info armhf 7.1-3build1 [60.5 kB] 351s Get:217 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gcc-13-base armhf 13.2.0-21ubuntu1 [48.3 kB] 351s Get:218 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libss2 armhf 1.47.0-2.4~exp1ubuntu2 [14.7 kB] 351s Get:219 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dmsetup armhf 2:1.02.185-3ubuntu2 [81.1 kB] 351s Get:220 http://ftpmaster.internal/ubuntu noble-proposed/main armhf eject armhf 2.39.3-9ubuntu2 [43.2 kB] 351s Get:221 http://ftpmaster.internal/ubuntu noble-proposed/main armhf krb5-locales all 1.20.1-6ubuntu1 [13.8 kB] 351s Get:222 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libglib2.0-data all 2.79.3-3ubuntu5 [46.6 kB] 351s Get:223 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libslang2 armhf 2.3.3-3build1 [478 kB] 351s Get:224 http://ftpmaster.internal/ubuntu noble-proposed/main armhf rsyslog armhf 8.2312.0-3ubuntu7 [460 kB] 351s Get:225 http://ftpmaster.internal/ubuntu noble-proposed/main armhf vim-tiny armhf 2:9.1.0016-1ubuntu6 [665 kB] 351s Get:226 http://ftpmaster.internal/ubuntu noble-proposed/main armhf vim-common all 2:9.1.0016-1ubuntu6 [385 kB] 351s Get:227 http://ftpmaster.internal/ubuntu noble/main armhf xdg-user-dirs armhf 0.18-1 [17.3 kB] 351s Get:228 http://ftpmaster.internal/ubuntu noble-proposed/main armhf xxd armhf 2:9.1.0016-1ubuntu6 [62.5 kB] 351s Get:229 http://ftpmaster.internal/ubuntu noble-proposed/main armhf apparmor armhf 4.0.0-beta3-0ubuntu2 [562 kB] 351s Get:230 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ftp all 20230507-2build1 [4724 B] 351s Get:231 http://ftpmaster.internal/ubuntu noble-proposed/main armhf inetutils-telnet armhf 2:2.5-3ubuntu3 [90.7 kB] 351s Get:232 http://ftpmaster.internal/ubuntu noble-proposed/main armhf info armhf 7.1-3build1 [127 kB] 351s Get:233 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libxmuu1 armhf 2:1.1.3-3build1 [8004 B] 351s Get:234 http://ftpmaster.internal/ubuntu noble-proposed/main armhf lshw armhf 02.19.git.2021.06.19.996aaad9c7-2build2 [310 kB] 351s Get:235 http://ftpmaster.internal/ubuntu noble-proposed/main armhf mtr-tiny armhf 0.95-1.1build1 [51.7 kB] 351s Get:236 http://ftpmaster.internal/ubuntu noble-proposed/main armhf plymouth-theme-ubuntu-text armhf 24.004.60-1ubuntu6 [9818 B] 351s Get:237 http://ftpmaster.internal/ubuntu noble-proposed/main armhf plymouth armhf 24.004.60-1ubuntu6 [142 kB] 351s Get:238 http://ftpmaster.internal/ubuntu noble-proposed/main armhf psmisc armhf 23.7-1 [176 kB] 351s Get:239 http://ftpmaster.internal/ubuntu noble-proposed/main armhf telnet all 0.17+2.5-3ubuntu3 [3682 B] 351s Get:240 http://ftpmaster.internal/ubuntu noble-proposed/main armhf usb.ids all 2024.03.18-1 [223 kB] 351s Get:241 http://ftpmaster.internal/ubuntu noble-proposed/main armhf xz-utils armhf 5.6.0-0.2 [271 kB] 351s Get:242 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libctf0 armhf 2.42-4ubuntu1 [87.7 kB] 351s Get:243 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libctf-nobfd0 armhf 2.42-4ubuntu1 [88.0 kB] 351s Get:244 http://ftpmaster.internal/ubuntu noble-proposed/main armhf binutils-arm-linux-gnueabihf armhf 2.42-4ubuntu1 [2925 kB] 351s Get:245 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libbinutils armhf 2.42-4ubuntu1 [464 kB] 351s Get:246 http://ftpmaster.internal/ubuntu noble-proposed/main armhf binutils armhf 2.42-4ubuntu1 [3078 B] 351s Get:247 http://ftpmaster.internal/ubuntu noble-proposed/main armhf binutils-common armhf 2.42-4ubuntu1 [217 kB] 351s Get:248 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsframe1 armhf 2.42-4ubuntu1 [13.1 kB] 351s Get:249 http://ftpmaster.internal/ubuntu noble-proposed/main armhf bolt armhf 0.9.6-2build1 [138 kB] 351s Get:250 http://ftpmaster.internal/ubuntu noble-proposed/main armhf cryptsetup-bin armhf 2:2.7.0-1ubuntu2 [214 kB] 351s Get:251 http://ftpmaster.internal/ubuntu noble-proposed/main armhf dpkg-dev all 1.22.6ubuntu4 [1074 kB] 351s Get:252 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libdpkg-perl all 1.22.6ubuntu4 [268 kB] 351s Get:253 http://ftpmaster.internal/ubuntu noble-proposed/main armhf gnupg-l10n all 2.4.4-2ubuntu15 [65.8 kB] 351s Get:254 http://ftpmaster.internal/ubuntu noble-proposed/main armhf ibverbs-providers armhf 50.0-2build1 [27.4 kB] 351s Get:255 http://ftpmaster.internal/ubuntu noble-proposed/main armhf jq armhf 1.7.1-3 [65.2 kB] 351s Get:256 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libjq1 armhf 1.7.1-3 [156 kB] 351s Get:257 http://ftpmaster.internal/ubuntu noble/main armhf libatm1t64 armhf 1:2.5.1-5.1 [20.0 kB] 351s Get:258 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libevent-core-2.1-7 armhf 2.1.12-stable-9build1 [82.3 kB] 351s Get:259 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libftdi1-2 armhf 1.5-6build4 [25.7 kB] 351s Get:260 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libldap-common all 2.6.7+dfsg-1~exp1ubuntu6 [31.3 kB] 351s Get:261 http://ftpmaster.internal/ubuntu noble-proposed/main armhf libsasl2-modules armhf 2.1.28+dfsg1-5ubuntu1 [61.3 kB] 351s Get:262 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-distutils all 3.12.2-3ubuntu1.1 [133 kB] 351s Get:263 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-lib2to3 all 3.12.2-3ubuntu1.1 [79.1 kB] 351s Get:264 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-pyrsistent armhf 0.20.0-1build1 [53.0 kB] 351s Get:265 http://ftpmaster.internal/ubuntu noble-proposed/main armhf python3-typing-extensions all 4.10.0-1 [60.7 kB] 351s Get:266 http://ftpmaster.internal/ubuntu noble-proposed/main armhf kpartx armhf 0.9.4-5ubuntu6 [31.5 kB] 352s Preconfiguring packages ... 352s Fetched 100 MB in 9s (11.7 MB/s) 352s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 352s Preparing to unpack .../bsdutils_1%3a2.39.3-9ubuntu2_armhf.deb ... 352s Unpacking bsdutils (1:2.39.3-9ubuntu2) over (1:2.39.3-6ubuntu2) ... 352s Setting up bsdutils (1:2.39.3-9ubuntu2) ... 352s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 352s Preparing to unpack .../0-libbrotli1_1.1.0-2build1_armhf.deb ... 352s Unpacking libbrotli1:armhf (1.1.0-2build1) over (1.1.0-2) ... 352s Preparing to unpack .../1-libgssapi-krb5-2_1.20.1-6ubuntu1_armhf.deb ... 352s Unpacking libgssapi-krb5-2:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 353s Preparing to unpack .../2-libkrb5-3_1.20.1-6ubuntu1_armhf.deb ... 353s Unpacking libkrb5-3:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 353s Preparing to unpack .../3-libkrb5support0_1.20.1-6ubuntu1_armhf.deb ... 353s Unpacking libkrb5support0:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 353s Preparing to unpack .../4-libk5crypto3_1.20.1-6ubuntu1_armhf.deb ... 353s Unpacking libk5crypto3:armhf (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 353s Preparing to unpack .../5-libcom-err2_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 353s Unpacking libcom-err2:armhf (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 353s Preparing to unpack .../6-zlib1g_1%3a1.3.dfsg-3.1ubuntu1_armhf.deb ... 353s Unpacking zlib1g:armhf (1:1.3.dfsg-3.1ubuntu1) over (1:1.3.dfsg-3ubuntu1) ... 353s Setting up zlib1g:armhf (1:1.3.dfsg-3.1ubuntu1) ... 353s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 353s Preparing to unpack .../librtmp1_2.4+20151223.gitfa8646d.1-2build6_armhf.deb ... 353s Unpacking librtmp1:armhf (2.4+20151223.gitfa8646d.1-2build6) over (2.4+20151223.gitfa8646d.1-2build4) ... 353s Preparing to unpack .../udisks2_2.10.1-6_armhf.deb ... 353s Unpacking udisks2 (2.10.1-6) over (2.10.1-1ubuntu2) ... 353s Preparing to unpack .../libudisks2-0_2.10.1-6_armhf.deb ... 353s Unpacking libudisks2-0:armhf (2.10.1-6) over (2.10.1-1ubuntu2) ... 353s Preparing to unpack .../libblkid1_2.39.3-9ubuntu2_armhf.deb ... 353s Unpacking libblkid1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 353s Setting up libblkid1:armhf (2.39.3-9ubuntu2) ... 353s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 353s Preparing to unpack .../liblzma5_5.6.0-0.2_armhf.deb ... 353s Unpacking liblzma5:armhf (5.6.0-0.2) over (5.4.5-0.3) ... 353s Setting up liblzma5:armhf (5.6.0-0.2) ... 353s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 353s Preparing to unpack .../0-kmod_31+20240202-2ubuntu4_armhf.deb ... 353s Unpacking kmod (31+20240202-2ubuntu4) over (30+20230601-2ubuntu1) ... 353s dpkg: warning: unable to delete old directory '/lib/modprobe.d': Directory not empty 353s Preparing to unpack .../1-libkmod2_31+20240202-2ubuntu4_armhf.deb ... 353s Unpacking libkmod2:armhf (31+20240202-2ubuntu4) over (30+20230601-2ubuntu1) ... 353s Preparing to unpack .../2-systemd-dev_255.4-1ubuntu5_all.deb ... 353s Unpacking systemd-dev (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 353s Preparing to unpack .../3-systemd-timesyncd_255.4-1ubuntu5_armhf.deb ... 353s Unpacking systemd-timesyncd (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 353s Preparing to unpack .../4-dbus-session-bus-common_1.14.10-4ubuntu2_all.deb ... 353s Unpacking dbus-session-bus-common (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 353s Preparing to unpack .../5-libaudit-common_1%3a3.1.2-2.1_all.deb ... 353s Unpacking libaudit-common (1:3.1.2-2.1) over (1:3.1.2-2) ... 353s Setting up libaudit-common (1:3.1.2-2.1) ... 353s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 353s Preparing to unpack .../libcap-ng0_0.8.4-2build1_armhf.deb ... 353s Unpacking libcap-ng0:armhf (0.8.4-2build1) over (0.8.4-2) ... 353s Setting up libcap-ng0:armhf (0.8.4-2build1) ... 353s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 353s Preparing to unpack .../libaudit1_1%3a3.1.2-2.1_armhf.deb ... 353s Unpacking libaudit1:armhf (1:3.1.2-2.1) over (1:3.1.2-2) ... 353s Setting up libaudit1:armhf (1:3.1.2-2.1) ... 353s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 353s Preparing to unpack .../libpam0g_1.5.3-5ubuntu3_armhf.deb ... 353s Unpacking libpam0g:armhf (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 353s Setting up libpam0g:armhf (1.5.3-5ubuntu3) ... 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 354s Preparing to unpack .../libselinux1_3.5-2ubuntu1_armhf.deb ... 354s Unpacking libselinux1:armhf (3.5-2ubuntu1) over (3.5-2build1) ... 354s Setting up libselinux1:armhf (3.5-2ubuntu1) ... 354s dpkg: libcurl4:armhf: dependency problems, but removing anyway as you requested: 354s curl depends on libcurl4 (= 8.5.0-2ubuntu2). 354s 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58618 files and directories currently installed.) 354s Removing libcurl4:armhf (8.5.0-2ubuntu2) ... 354s Selecting previously unselected package libcurl4t64:armhf. 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58613 files and directories currently installed.) 354s Preparing to unpack .../libcurl4t64_8.5.0-2ubuntu8_armhf.deb ... 354s Unpacking libcurl4t64:armhf (8.5.0-2ubuntu8) ... 354s Preparing to unpack .../curl_8.5.0-2ubuntu8_armhf.deb ... 354s Unpacking curl (8.5.0-2ubuntu8) over (8.5.0-2ubuntu2) ... 354s dpkg: libpsl5:armhf: dependency problems, but removing anyway as you requested: 354s wget depends on libpsl5 (>= 0.16.0). 354s libcurl3-gnutls:armhf depends on libpsl5 (>= 0.16.0). 354s 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58619 files and directories currently installed.) 354s Removing libpsl5:armhf (0.21.2-1build1) ... 354s Selecting previously unselected package libpsl5t64:armhf. 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58614 files and directories currently installed.) 354s Preparing to unpack .../libpsl5t64_0.21.2-1.1_armhf.deb ... 354s Unpacking libpsl5t64:armhf (0.21.2-1.1) ... 354s Preparing to unpack .../wget_1.21.4-1ubuntu2_armhf.deb ... 354s Unpacking wget (1.21.4-1ubuntu2) over (1.21.4-1ubuntu1) ... 354s Preparing to unpack .../tnftp_20230507-2build1_armhf.deb ... 354s Unpacking tnftp (20230507-2build1) over (20230507-2) ... 354s dpkg: libpcap0.8:armhf: dependency problems, but removing anyway as you requested: 354s tcpdump depends on libpcap0.8 (>= 1.9.1). 354s 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58620 files and directories currently installed.) 354s Removing libpcap0.8:armhf (1.10.4-4ubuntu3) ... 354s Selecting previously unselected package libpcap0.8t64:armhf. 354s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58609 files and directories currently installed.) 354s Preparing to unpack .../00-libpcap0.8t64_1.10.4-4.1ubuntu2_armhf.deb ... 354s Unpacking libpcap0.8t64:armhf (1.10.4-4.1ubuntu2) ... 354s Preparing to unpack .../01-tcpdump_4.99.4-3ubuntu2_armhf.deb ... 354s Unpacking tcpdump (4.99.4-3ubuntu2) over (4.99.4-3ubuntu1) ... 354s Preparing to unpack .../02-libsystemd-shared_255.4-1ubuntu5_armhf.deb ... 354s Unpacking libsystemd-shared:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 354s Preparing to unpack .../03-systemd-resolved_255.4-1ubuntu5_armhf.deb ... 354s Unpacking systemd-resolved (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 354s Preparing to unpack .../04-sudo_1.9.15p5-3ubuntu3_armhf.deb ... 354s Unpacking sudo (1.9.15p5-3ubuntu3) over (1.9.15p5-3ubuntu1) ... 354s Preparing to unpack .../05-rsync_3.2.7-1build1_armhf.deb ... 354s Unpacking rsync (3.2.7-1build1) over (3.2.7-1) ... 355s Preparing to unpack .../06-python3-cryptography_41.0.7-4build2_armhf.deb ... 355s Unpacking python3-cryptography (41.0.7-4build2) over (41.0.7-3) ... 355s Preparing to unpack .../07-openssl_3.0.13-0ubuntu2_armhf.deb ... 355s Unpacking openssl (3.0.13-0ubuntu2) over (3.0.10-1ubuntu4) ... 355s Preparing to unpack .../08-openssh-sftp-server_1%3a9.6p1-3ubuntu11_armhf.deb ... 355s Unpacking openssh-sftp-server (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 355s Preparing to unpack .../09-openssh-client_1%3a9.6p1-3ubuntu11_armhf.deb ... 355s Unpacking openssh-client (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 355s Preparing to unpack .../10-openssh-server_1%3a9.6p1-3ubuntu11_armhf.deb ... 355s Unpacking openssh-server (1:9.6p1-3ubuntu11) over (1:9.6p1-3ubuntu2) ... 355s Selecting previously unselected package linux-headers-6.8.0-20. 355s Preparing to unpack .../11-linux-headers-6.8.0-20_6.8.0-20.20_all.deb ... 355s Unpacking linux-headers-6.8.0-20 (6.8.0-20.20) ... 358s Selecting previously unselected package linux-headers-6.8.0-20-generic. 358s Preparing to unpack .../12-linux-headers-6.8.0-20-generic_6.8.0-20.20_armhf.deb ... 358s Unpacking linux-headers-6.8.0-20-generic (6.8.0-20.20) ... 360s Preparing to unpack .../13-linux-headers-generic_6.8.0-20.20+1_armhf.deb ... 360s Unpacking linux-headers-generic (6.8.0-20.20+1) over (6.8.0-11.11+1) ... 360s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 89772 files and directories currently installed.) 360s Removing linux-headers-6.8.0-11-generic (6.8.0-11.11) ... 360s dpkg: libssl3:armhf: dependency problems, but removing anyway as you requested: 360s systemd depends on libssl3 (>= 3.0.0). 360s libssh-4:armhf depends on libssl3 (>= 3.0.0). 360s libsasl2-modules:armhf depends on libssl3 (>= 3.0.0). 360s libsasl2-2:armhf depends on libssl3 (>= 3.0.0). 360s libpython3.12-minimal:armhf depends on libssl3 (>= 3.0.0). 360s libpython3.11-minimal:armhf depends on libssl3 (>= 3.0.0). 360s libnvme1 depends on libssl3 (>= 3.0.0). 360s libfido2-1:armhf depends on libssl3 (>= 3.0.0). 360s libcryptsetup12:armhf depends on libssl3 (>= 3.0.0). 360s dhcpcd-base depends on libssl3 (>= 3.0.0). 360s bind9-libs:armhf depends on libssl3 (>= 3.0.0). 360s 360s Removing libssl3:armhf (3.0.10-1ubuntu4) ... 360s Selecting previously unselected package libssl3t64:armhf. 360s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78622 files and directories currently installed.) 360s Preparing to unpack .../libssl3t64_3.0.13-0ubuntu2_armhf.deb ... 360s Unpacking libssl3t64:armhf (3.0.13-0ubuntu2) ... 360s Setting up libssl3t64:armhf (3.0.13-0ubuntu2) ... 360s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 360s Preparing to unpack .../libnss-systemd_255.4-1ubuntu5_armhf.deb ... 360s Unpacking libnss-systemd:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 360s Preparing to unpack .../libudev1_255.4-1ubuntu5_armhf.deb ... 360s Unpacking libudev1:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 361s Setting up libudev1:armhf (255.4-1ubuntu5) ... 361s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 361s Preparing to unpack .../systemd_255.4-1ubuntu5_armhf.deb ... 361s Unpacking systemd (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 362s Preparing to unpack .../udev_255.4-1ubuntu5_armhf.deb ... 362s Unpacking udev (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 362s Preparing to unpack .../libsystemd0_255.4-1ubuntu5_armhf.deb ... 362s Unpacking libsystemd0:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 362s Setting up libsystemd0:armhf (255.4-1ubuntu5) ... 362s Setting up libkmod2:armhf (31+20240202-2ubuntu4) ... 362s Setting up libsystemd-shared:armhf (255.4-1ubuntu5) ... 362s Setting up systemd-dev (255.4-1ubuntu5) ... 362s Setting up systemd (255.4-1ubuntu5) ... 363s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 363s Preparing to unpack .../systemd-sysv_255.4-1ubuntu5_armhf.deb ... 363s Unpacking systemd-sysv (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 363s Preparing to unpack .../libpam-systemd_255.4-1ubuntu5_armhf.deb ... 363s Unpacking libpam-systemd:armhf (255.4-1ubuntu5) over (255.2-3ubuntu2) ... 363s Preparing to unpack .../libpam-modules-bin_1.5.3-5ubuntu3_armhf.deb ... 363s Unpacking libpam-modules-bin (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 364s Setting up libpam-modules-bin (1.5.3-5ubuntu3) ... 364s pam_namespace.service is a disabled or a static unit not running, not starting it. 364s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78635 files and directories currently installed.) 364s Preparing to unpack .../libpam-modules_1.5.3-5ubuntu3_armhf.deb ... 364s Unpacking libpam-modules:armhf (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 365s Setting up libpam-modules:armhf (1.5.3-5ubuntu3) ... 365s Installing new version of config file /etc/security/namespace.init ... 365s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 365s Preparing to unpack .../libpam-runtime_1.5.3-5ubuntu3_all.deb ... 365s Unpacking libpam-runtime (1.5.3-5ubuntu3) over (1.5.2-9.1ubuntu3) ... 365s Setting up libpam-runtime (1.5.3-5ubuntu3) ... 365s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 365s Preparing to unpack .../dbus-user-session_1.14.10-4ubuntu2_armhf.deb ... 365s Unpacking dbus-user-session (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 365s Preparing to unpack .../libapparmor1_4.0.0-beta3-0ubuntu2_armhf.deb ... 365s Unpacking libapparmor1:armhf (4.0.0-beta3-0ubuntu2) over (4.0.0~alpha4-0ubuntu1) ... 365s Preparing to unpack .../gcc-14-base_14-20240315-1ubuntu1_armhf.deb ... 365s Unpacking gcc-14-base:armhf (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 365s Setting up gcc-14-base:armhf (14-20240315-1ubuntu1) ... 365s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 365s Preparing to unpack .../libgcc-s1_14-20240315-1ubuntu1_armhf.deb ... 365s Unpacking libgcc-s1:armhf (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 365s Setting up libgcc-s1:armhf (14-20240315-1ubuntu1) ... 365s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 365s Preparing to unpack .../libstdc++6_14-20240315-1ubuntu1_armhf.deb ... 365s Unpacking libstdc++6:armhf (14-20240315-1ubuntu1) over (14-20240303-1ubuntu1) ... 365s Setting up libstdc++6:armhf (14-20240315-1ubuntu1) ... 365s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 365s Preparing to unpack .../0-libexpat1_2.6.1-2_armhf.deb ... 365s Unpacking libexpat1:armhf (2.6.1-2) over (2.6.0-1) ... 365s Preparing to unpack .../1-dbus-system-bus-common_1.14.10-4ubuntu2_all.deb ... 365s Unpacking dbus-system-bus-common (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 365s Preparing to unpack .../2-dbus-bin_1.14.10-4ubuntu2_armhf.deb ... 365s Unpacking dbus-bin (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 365s Preparing to unpack .../3-dbus_1.14.10-4ubuntu2_armhf.deb ... 365s Unpacking dbus (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 365s Preparing to unpack .../4-dbus-daemon_1.14.10-4ubuntu2_armhf.deb ... 365s Unpacking dbus-daemon (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 365s Preparing to unpack .../5-libdbus-1-3_1.14.10-4ubuntu2_armhf.deb ... 365s Unpacking libdbus-1-3:armhf (1.14.10-4ubuntu2) over (1.14.10-4ubuntu1) ... 366s Preparing to unpack .../6-libmount1_2.39.3-9ubuntu2_armhf.deb ... 366s Unpacking libmount1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 366s Setting up libmount1:armhf (2.39.3-9ubuntu2) ... 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 366s Preparing to unpack .../libseccomp2_2.5.5-1ubuntu2_armhf.deb ... 366s Unpacking libseccomp2:armhf (2.5.5-1ubuntu2) over (2.5.5-1ubuntu1) ... 366s Setting up libseccomp2:armhf (2.5.5-1ubuntu2) ... 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 366s Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.185-3ubuntu2_armhf.deb ... 366s Unpacking libdevmapper1.02.1:armhf (2:1.02.185-3ubuntu2) over (2:1.02.185-3ubuntu1) ... 366s Preparing to unpack .../libuuid1_2.39.3-9ubuntu2_armhf.deb ... 366s Unpacking libuuid1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 366s Setting up libuuid1:armhf (2.39.3-9ubuntu2) ... 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 366s Preparing to unpack .../0-libcryptsetup12_2%3a2.7.0-1ubuntu2_armhf.deb ... 366s Unpacking libcryptsetup12:armhf (2:2.7.0-1ubuntu2) over (2:2.7.0-1ubuntu1) ... 366s Preparing to unpack .../1-libfdisk1_2.39.3-9ubuntu2_armhf.deb ... 366s Unpacking libfdisk1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 366s Preparing to unpack .../2-mount_2.39.3-9ubuntu2_armhf.deb ... 366s Unpacking mount (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 366s Preparing to unpack .../3-libblockdev-utils3_3.1.0-1build1_armhf.deb ... 366s Unpacking libblockdev-utils3:armhf (3.1.0-1build1) over (3.1.0-1) ... 366s Preparing to unpack .../4-libvolume-key1_0.3.12-7build1_armhf.deb ... 366s Unpacking libvolume-key1:armhf (0.3.12-7build1) over (0.3.12-5build2) ... 366s Preparing to unpack .../5-libjcat1_0.2.0-2build2_armhf.deb ... 366s Unpacking libjcat1:armhf (0.2.0-2build2) over (0.2.0-2) ... 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78633 files and directories currently installed.) 366s Removing libgpgme11:armhf (1.18.0-4ubuntu1) ... 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78627 files and directories currently installed.) 366s Preparing to unpack .../parted_3.6-3.1build2_armhf.deb ... 366s Unpacking parted (3.6-3.1build2) over (3.6-3) ... 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78627 files and directories currently installed.) 366s Removing libparted2:armhf (3.6-3) ... 366s Selecting previously unselected package libparted2t64:armhf. 366s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78621 files and directories currently installed.) 366s Preparing to unpack .../00-libparted2t64_3.6-3.1build2_armhf.deb ... 366s Unpacking libparted2t64:armhf (3.6-3.1build2) ... 366s Preparing to unpack .../01-python3.12_3.12.2-4build3_armhf.deb ... 366s Unpacking python3.12 (3.12.2-4build3) over (3.12.2-1) ... 366s Preparing to unpack .../02-python3.12-minimal_3.12.2-4build3_armhf.deb ... 366s Unpacking python3.12-minimal (3.12.2-4build3) over (3.12.2-1) ... 367s Preparing to unpack .../03-libpython3.12-stdlib_3.12.2-4build3_armhf.deb ... 367s Unpacking libpython3.12-stdlib:armhf (3.12.2-4build3) over (3.12.2-1) ... 367s Preparing to unpack .../04-libpython3.12-minimal_3.12.2-4build3_armhf.deb ... 367s Unpacking libpython3.12-minimal:armhf (3.12.2-4build3) over (3.12.2-1) ... 367s Preparing to unpack .../05-libsasl2-modules-db_2.1.28+dfsg1-5ubuntu1_armhf.deb ... 367s Unpacking libsasl2-modules-db:armhf (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 367s Preparing to unpack .../06-python3.11_3.11.8-1build4_armhf.deb ... 367s Unpacking python3.11 (3.11.8-1build4) over (3.11.8-1) ... 367s Preparing to unpack .../07-python3.11-minimal_3.11.8-1build4_armhf.deb ... 367s Unpacking python3.11-minimal (3.11.8-1build4) over (3.11.8-1) ... 367s Preparing to unpack .../08-libpython3.11-stdlib_3.11.8-1build4_armhf.deb ... 367s Unpacking libpython3.11-stdlib:armhf (3.11.8-1build4) over (3.11.8-1) ... 367s Preparing to unpack .../09-libpython3.11-minimal_3.11.8-1build4_armhf.deb ... 367s Unpacking libpython3.11-minimal:armhf (3.11.8-1build4) over (3.11.8-1) ... 368s Preparing to unpack .../10-libsqlite3-0_3.45.1-1ubuntu1_armhf.deb ... 368s Unpacking libsqlite3-0:armhf (3.45.1-1ubuntu1) over (3.45.1-1) ... 368s Preparing to unpack .../11-libtext-iconv-perl_1.7-8build2_armhf.deb ... 368s Unpacking libtext-iconv-perl:armhf (1.7-8build2) over (1.7-8build1) ... 368s Preparing to unpack .../12-libtext-charwidth-perl_0.04-11build2_armhf.deb ... 368s Unpacking libtext-charwidth-perl:armhf (0.04-11build2) over (0.04-11build1) ... 368s Preparing to unpack .../13-perl-modules-5.38_5.38.2-3.2_all.deb ... 368s Unpacking perl-modules-5.38 (5.38.2-3.2) over (5.38.2-3) ... 368s dpkg: libperl5.38:armhf: dependency problems, but removing anyway as you requested: 368s perl depends on libperl5.38 (= 5.38.2-3). 368s 368s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78624 files and directories currently installed.) 368s Removing libperl5.38:armhf (5.38.2-3) ... 368s dpkg: libdb5.3:armhf: dependency problems, but removing anyway as you requested: 368s iproute2 depends on libdb5.3. 368s apt-utils depends on libdb5.3. 368s 368s Removing libdb5.3:armhf (5.3.28+dfsg2-4) ... 368s Selecting previously unselected package libdb5.3t64:armhf. 369s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78099 files and directories currently installed.) 369s Preparing to unpack .../libdb5.3t64_5.3.28+dfsg2-6_armhf.deb ... 369s Unpacking libdb5.3t64:armhf (5.3.28+dfsg2-6) ... 369s Preparing to unpack .../python3-gdbm_3.12.2-3ubuntu1.1_armhf.deb ... 369s Unpacking python3-gdbm:armhf (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 369s Preparing to unpack .../man-db_2.12.0-3build4_armhf.deb ... 369s Unpacking man-db (2.12.0-3build4) over (2.12.0-3) ... 369s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78105 files and directories currently installed.) 369s Removing libgdbm-compat4:armhf (1.23-5) ... 369s Removing libgdbm6:armhf (1.23-5) ... 369s Selecting previously unselected package libgdbm6t64:armhf. 369s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78095 files and directories currently installed.) 369s Preparing to unpack .../libgdbm6t64_1.23-5.1_armhf.deb ... 369s Unpacking libgdbm6t64:armhf (1.23-5.1) ... 369s Selecting previously unselected package libgdbm-compat4t64:armhf. 369s Preparing to unpack .../libgdbm-compat4t64_1.23-5.1_armhf.deb ... 369s Unpacking libgdbm-compat4t64:armhf (1.23-5.1) ... 369s Selecting previously unselected package libperl5.38t64:armhf. 369s Preparing to unpack .../libperl5.38t64_5.38.2-3.2_armhf.deb ... 369s Unpacking libperl5.38t64:armhf (5.38.2-3.2) ... 369s Preparing to unpack .../perl_5.38.2-3.2_armhf.deb ... 369s Unpacking perl (5.38.2-3.2) over (5.38.2-3) ... 369s Preparing to unpack .../perl-base_5.38.2-3.2_armhf.deb ... 369s Unpacking perl-base (5.38.2-3.2) over (5.38.2-3) ... 369s Setting up perl-base (5.38.2-3.2) ... 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78626 files and directories currently installed.) 370s Preparing to unpack .../liblocale-gettext-perl_1.07-6ubuntu4_armhf.deb ... 370s Unpacking liblocale-gettext-perl (1.07-6ubuntu4) over (1.07-6build1) ... 370s dpkg: libnettle8:armhf: dependency problems, but removing anyway as you requested: 370s libhogweed6:armhf depends on libnettle8. 370s libgnutls30:armhf depends on libnettle8 (>= 3.9~). 370s libcurl3-gnutls:armhf depends on libnettle8. 370s libarchive13:armhf depends on libnettle8. 370s 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78626 files and directories currently installed.) 370s Removing libnettle8:armhf (3.9.1-2) ... 370s Selecting previously unselected package libnettle8t64:armhf. 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78619 files and directories currently installed.) 370s Preparing to unpack .../libnettle8t64_3.9.1-2.2_armhf.deb ... 370s Unpacking libnettle8t64:armhf (3.9.1-2.2) ... 370s Setting up libnettle8t64:armhf (3.9.1-2.2) ... 370s dpkg: libhogweed6:armhf: dependency problems, but removing anyway as you requested: 370s libgnutls30:armhf depends on libhogweed6 (>= 3.6). 370s 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78627 files and directories currently installed.) 370s Removing libhogweed6:armhf (3.9.1-2) ... 370s Selecting previously unselected package libhogweed6t64:armhf. 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78622 files and directories currently installed.) 370s Preparing to unpack .../libhogweed6t64_3.9.1-2.2_armhf.deb ... 370s Unpacking libhogweed6t64:armhf (3.9.1-2.2) ... 370s Setting up libhogweed6t64:armhf (3.9.1-2.2) ... 370s dpkg: libgnutls30:armhf: dependency problems, but removing anyway as you requested: 370s libldap2:armhf depends on libgnutls30 (>= 3.8.2). 370s libcurl3-gnutls:armhf depends on libgnutls30 (>= 3.8.2). 370s fwupd depends on libgnutls30 (>= 3.7.3). 370s dirmngr depends on libgnutls30 (>= 3.8.1). 370s apt depends on libgnutls30 (>= 3.8.1). 370s 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78628 files and directories currently installed.) 370s Removing libgnutls30:armhf (3.8.3-1ubuntu1) ... 370s Selecting previously unselected package libgnutls30t64:armhf. 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78619 files and directories currently installed.) 370s Preparing to unpack .../libgnutls30t64_3.8.3-1.1ubuntu2_armhf.deb ... 370s Unpacking libgnutls30t64:armhf (3.8.3-1.1ubuntu2) ... 370s Setting up libgnutls30t64:armhf (3.8.3-1.1ubuntu2) ... 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 370s Preparing to unpack .../libldap2_2.6.7+dfsg-1~exp1ubuntu6_armhf.deb ... 370s Unpacking libldap2:armhf (2.6.7+dfsg-1~exp1ubuntu6) over (2.6.7+dfsg-1~exp1ubuntu1) ... 370s dpkg: libcurl3-gnutls:armhf: dependency problems, but removing anyway as you requested: 370s libfwupd2:armhf depends on libcurl3-gnutls (>= 7.63.0). 370s fwupd depends on libcurl3-gnutls (>= 7.63.0). 370s 370s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 370s Removing libcurl3-gnutls:armhf (8.5.0-2ubuntu2) ... 371s Selecting previously unselected package libcurl3t64-gnutls:armhf. 371s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78640 files and directories currently installed.) 371s Preparing to unpack .../00-libcurl3t64-gnutls_8.5.0-2ubuntu8_armhf.deb ... 371s Unpacking libcurl3t64-gnutls:armhf (8.5.0-2ubuntu8) ... 371s Preparing to unpack .../01-shared-mime-info_2.4-1build1_armhf.deb ... 371s Unpacking shared-mime-info (2.4-1build1) over (2.4-1) ... 371s Preparing to unpack .../02-gir1.2-girepository-2.0_1.79.1-1ubuntu6_armhf.deb ... 371s Unpacking gir1.2-girepository-2.0:armhf (1.79.1-1ubuntu6) over (1.79.1-1) ... 371s Preparing to unpack .../03-gir1.2-glib-2.0_2.79.3-3ubuntu5_armhf.deb ... 371s Unpacking gir1.2-glib-2.0:armhf (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 371s Preparing to unpack .../04-libgirepository-1.0-1_1.79.1-1ubuntu6_armhf.deb ... 371s Unpacking libgirepository-1.0-1:armhf (1.79.1-1ubuntu6) over (1.79.1-1) ... 371s Preparing to unpack .../05-python3-gi_3.47.0-3build1_armhf.deb ... 371s Unpacking python3-gi (3.47.0-3build1) over (3.47.0-3) ... 371s Preparing to unpack .../06-python3-dbus_1.3.2-5build2_armhf.deb ... 371s Unpacking python3-dbus (1.3.2-5build2) over (1.3.2-5build1) ... 371s Selecting previously unselected package libnetplan1:armhf. 371s Preparing to unpack .../07-libnetplan1_1.0-1_armhf.deb ... 371s Unpacking libnetplan1:armhf (1.0-1) ... 371s Preparing to unpack .../08-python3-netplan_1.0-1_armhf.deb ... 371s Unpacking python3-netplan (1.0-1) over (0.107.1-3) ... 371s Preparing to unpack .../09-netplan-generator_1.0-1_armhf.deb ... 371s Adding 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 371s Unpacking netplan-generator (1.0-1) over (0.107.1-3) ... 371s Preparing to unpack .../10-initramfs-tools-bin_0.142ubuntu23_armhf.deb ... 372s Unpacking initramfs-tools-bin (0.142ubuntu23) over (0.142ubuntu20) ... 372s Preparing to unpack .../11-initramfs-tools-core_0.142ubuntu23_all.deb ... 372s Unpacking initramfs-tools-core (0.142ubuntu23) over (0.142ubuntu20) ... 372s Preparing to unpack .../12-initramfs-tools_0.142ubuntu23_all.deb ... 372s Unpacking initramfs-tools (0.142ubuntu23) over (0.142ubuntu20) ... 372s Preparing to unpack .../13-netplan.io_1.0-1_armhf.deb ... 372s Unpacking netplan.io (1.0-1) over (0.107.1-3) ... 372s Preparing to unpack .../14-libxmlb2_0.3.15-1build1_armhf.deb ... 372s Unpacking libxmlb2:armhf (0.3.15-1build1) over (0.3.15-1) ... 372s Preparing to unpack .../15-libqrtr-glib0_1.2.2-1ubuntu3_armhf.deb ... 372s Unpacking libqrtr-glib0:armhf (1.2.2-1ubuntu3) over (1.2.2-1ubuntu2) ... 372s Preparing to unpack .../16-libqmi-glib5_1.35.2-0ubuntu1_armhf.deb ... 372s Unpacking libqmi-glib5:armhf (1.35.2-0ubuntu1) over (1.34.0-2) ... 372s Preparing to unpack .../17-libqmi-proxy_1.35.2-0ubuntu1_armhf.deb ... 372s Unpacking libqmi-proxy (1.35.2-0ubuntu1) over (1.34.0-2) ... 372s Preparing to unpack .../18-libpolkit-agent-1-0_124-1ubuntu1_armhf.deb ... 372s Unpacking libpolkit-agent-1-0:armhf (124-1ubuntu1) over (124-1) ... 372s Preparing to unpack .../19-libpolkit-gobject-1-0_124-1ubuntu1_armhf.deb ... 372s Unpacking libpolkit-gobject-1-0:armhf (124-1ubuntu1) over (124-1) ... 372s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78651 files and directories currently installed.) 372s Removing libnetplan0:armhf (0.107.1-3) ... 372s dpkg: libglib2.0-0:armhf: dependency problems, but removing anyway as you requested: 372s libmm-glib0:armhf depends on libglib2.0-0 (>= 2.62.0). 372s libmbim-proxy depends on libglib2.0-0 (>= 2.56). 372s libmbim-glib4:armhf depends on libglib2.0-0 (>= 2.56). 372s libjson-glib-1.0-0:armhf depends on libglib2.0-0 (>= 2.75.3). 372s libgusb2:armhf depends on libglib2.0-0 (>= 2.75.3). 372s libgudev-1.0-0:armhf depends on libglib2.0-0 (>= 2.38.0). 372s libfwupd2:armhf depends on libglib2.0-0 (>= 2.79.0). 372s libblockdev3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-swap3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-part3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-nvme3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-mdraid3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-loop3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-fs3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s libblockdev-crypto3:armhf depends on libglib2.0-0 (>= 2.42.2). 372s fwupd depends on libglib2.0-0 (>= 2.79.0). 372s bolt depends on libglib2.0-0 (>= 2.56.0). 372s 372s Removing libglib2.0-0:armhf (2.79.2-1~ubuntu1) ... 372s Selecting previously unselected package libglib2.0-0t64:armhf. 372s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78622 files and directories currently installed.) 372s Preparing to unpack .../libglib2.0-0t64_2.79.3-3ubuntu5_armhf.deb ... 372s libglib2.0-0t64.preinst: Removing /var/lib/dpkg/info/libglib2.0-0:armhf.postrm to avoid loss of /usr/share/glib-2.0/schemas/gschemas.compiled... 372s removed '/var/lib/dpkg/info/libglib2.0-0:armhf.postrm' 372s Unpacking libglib2.0-0t64:armhf (2.79.3-3ubuntu5) ... 372s Preparing to unpack .../libfwupd2_1.9.15-2_armhf.deb ... 372s Unpacking libfwupd2:armhf (1.9.15-2) over (1.9.14-1) ... 372s dpkg: libarchive13:armhf: dependency problems, but removing anyway as you requested: 372s fwupd depends on libarchive13 (>= 3.2.1). 372s 373s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 373s Removing libarchive13:armhf (3.7.2-1ubuntu2) ... 373s Selecting previously unselected package libarchive13t64:armhf. 373s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78641 files and directories currently installed.) 373s Preparing to unpack .../libarchive13t64_3.7.2-1.1ubuntu2_armhf.deb ... 373s Unpacking libarchive13t64:armhf (3.7.2-1.1ubuntu2) ... 373s Preparing to unpack .../fwupd_1.9.15-2_armhf.deb ... 373s Unpacking fwupd (1.9.15-2) over (1.9.14-1) ... 373s Preparing to unpack .../apt-utils_2.7.14_armhf.deb ... 373s Unpacking apt-utils (2.7.14) over (2.7.12) ... 373s dpkg: libapt-pkg6.0:armhf: dependency problems, but removing anyway as you requested: 373s ubuntu-pro-client depends on libapt-pkg6.0 (>= 1.9~). 373s python3-apt depends on libapt-pkg6.0 (>= 2.7.11). 373s apt depends on libapt-pkg6.0 (>= 2.7.12). 373s 373s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78648 files and directories currently installed.) 373s Removing libapt-pkg6.0:armhf (2.7.12) ... 373s Selecting previously unselected package libapt-pkg6.0t64:armhf. 373s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78599 files and directories currently installed.) 373s Preparing to unpack .../libapt-pkg6.0t64_2.7.14_armhf.deb ... 373s Unpacking libapt-pkg6.0t64:armhf (2.7.14) ... 373s Setting up libapt-pkg6.0t64:armhf (2.7.14) ... 373s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78649 files and directories currently installed.) 373s Preparing to unpack .../archives/apt_2.7.14_armhf.deb ... 373s Unpacking apt (2.7.14) over (2.7.12) ... 374s Setting up apt (2.7.14) ... 375s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78649 files and directories currently installed.) 375s Preparing to unpack .../ubuntu-pro-client-l10n_31.2.1_armhf.deb ... 375s Unpacking ubuntu-pro-client-l10n (31.2.1) over (31.1) ... 375s Preparing to unpack .../ubuntu-pro-client_31.2.1_armhf.deb ... 375s Unpacking ubuntu-pro-client (31.2.1) over (31.1) ... 375s Preparing to unpack .../keyboxd_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking keyboxd (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 375s dpkg: libnpth0:armhf: dependency problems, but removing anyway as you requested: 375s gpgv depends on libnpth0 (>= 0.90). 375s gpgsm depends on libnpth0 (>= 0.90). 375s gpg-agent depends on libnpth0 (>= 0.90). 375s gpg depends on libnpth0 (>= 0.90). 375s dirmngr depends on libnpth0 (>= 0.90). 375s 375s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78649 files and directories currently installed.) 375s Removing libnpth0:armhf (1.6-3build2) ... 375s Selecting previously unselected package libnpth0t64:armhf. 375s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78644 files and directories currently installed.) 375s Preparing to unpack .../libnpth0t64_1.6-3.1_armhf.deb ... 375s Unpacking libnpth0t64:armhf (1.6-3.1) ... 375s Setting up libnpth0t64:armhf (1.6-3.1) ... 375s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78650 files and directories currently installed.) 375s Preparing to unpack .../gpgv_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking gpgv (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 375s Setting up gpgv (2.4.4-2ubuntu15) ... 375s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78650 files and directories currently installed.) 375s Preparing to unpack .../gpg_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking gpg (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 375s Preparing to unpack .../gpg-wks-client_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking gpg-wks-client (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 375s Preparing to unpack .../gnupg-utils_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking gnupg-utils (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 375s Preparing to unpack .../gpg-agent_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking gpg-agent (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 375s Preparing to unpack .../gpgsm_2.4.4-2ubuntu15_armhf.deb ... 375s Unpacking gpgsm (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 376s dpkg: libreadline8:armhf: dependency problems, but removing anyway as you requested: 376s gpgconf depends on libreadline8 (>= 6.0). 376s gawk depends on libreadline8 (>= 6.0). 376s fdisk depends on libreadline8 (>= 6.0). 376s 376s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78650 files and directories currently installed.) 376s Removing libreadline8:armhf (8.2-3) ... 376s Selecting previously unselected package libreadline8t64:armhf. 376s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78638 files and directories currently installed.) 376s Preparing to unpack .../libreadline8t64_8.2-4_armhf.deb ... 376s Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8 to /lib/arm-linux-gnueabihf/libhistory.so.8.usr-is-merged by libreadline8t64' 376s Adding 'diversion of /lib/arm-linux-gnueabihf/libhistory.so.8.2 to /lib/arm-linux-gnueabihf/libhistory.so.8.2.usr-is-merged by libreadline8t64' 376s Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8 to /lib/arm-linux-gnueabihf/libreadline.so.8.usr-is-merged by libreadline8t64' 376s Adding 'diversion of /lib/arm-linux-gnueabihf/libreadline.so.8.2 to /lib/arm-linux-gnueabihf/libreadline.so.8.2.usr-is-merged by libreadline8t64' 376s Unpacking libreadline8t64:armhf (8.2-4) ... 376s Setting up libreadline8t64:armhf (8.2-4) ... 376s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78658 files and directories currently installed.) 376s Preparing to unpack .../00-gawk_1%3a5.2.1-2build2_armhf.deb ... 376s Unpacking gawk (1:5.2.1-2build2) over (1:5.2.1-2) ... 376s Preparing to unpack .../01-fdisk_2.39.3-9ubuntu2_armhf.deb ... 376s Unpacking fdisk (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 376s Preparing to unpack .../02-gpgconf_2.4.4-2ubuntu15_armhf.deb ... 376s Unpacking gpgconf (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 376s Preparing to unpack .../03-dirmngr_2.4.4-2ubuntu15_armhf.deb ... 376s Unpacking dirmngr (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 376s Preparing to unpack .../04-gnupg_2.4.4-2ubuntu15_all.deb ... 376s Unpacking gnupg (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 376s Preparing to unpack .../05-python3-apt_2.7.7_armhf.deb ... 376s Unpacking python3-apt (2.7.7) over (2.7.6) ... 376s Preparing to unpack .../06-pinentry-curses_1.2.1-3ubuntu4_armhf.deb ... 376s Unpacking pinentry-curses (1.2.1-3ubuntu4) over (1.2.1-3ubuntu1) ... 376s Preparing to unpack .../07-python3-yaml_6.0.1-2build1_armhf.deb ... 376s Unpacking python3-yaml (6.0.1-2build1) over (6.0.1-2) ... 376s Preparing to unpack .../08-python-apt-common_2.7.7_all.deb ... 376s Unpacking python-apt-common (2.7.7) over (2.7.6) ... 376s Preparing to unpack .../09-python3-setuptools_68.1.2-2ubuntu1_all.deb ... 377s Unpacking python3-setuptools (68.1.2-2ubuntu1) over (68.1.2-2) ... 377s Preparing to unpack .../10-python3-pkg-resources_68.1.2-2ubuntu1_all.deb ... 377s Unpacking python3-pkg-resources (68.1.2-2ubuntu1) over (68.1.2-2) ... 377s Preparing to unpack .../11-dpkg_1.22.6ubuntu4_armhf.deb ... 377s Unpacking dpkg (1.22.6ubuntu4) over (1.22.4ubuntu5) ... 377s Setting up dpkg (1.22.6ubuntu4) ... 378s Setting up libpython3.12-minimal:armhf (3.12.2-4build3) ... 378s Setting up libexpat1:armhf (2.6.1-2) ... 378s Setting up python3.12-minimal (3.12.2-4build3) ... 379s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78655 files and directories currently installed.) 379s Preparing to unpack .../python3-minimal_3.12.2-0ubuntu1_armhf.deb ... 379s Unpacking python3-minimal (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 379s Setting up python3-minimal (3.12.2-0ubuntu1) ... 379s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78655 files and directories currently installed.) 379s Preparing to unpack .../python3_3.12.2-0ubuntu1_armhf.deb ... 379s Unpacking python3 (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 379s Preparing to unpack .../libpython3-stdlib_3.12.2-0ubuntu1_armhf.deb ... 379s Unpacking libpython3-stdlib:armhf (3.12.2-0ubuntu1) over (3.12.1-0ubuntu2) ... 379s Preparing to unpack .../libsmartcols1_2.39.3-9ubuntu2_armhf.deb ... 379s Unpacking libsmartcols1:armhf (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 379s Setting up libsmartcols1:armhf (2.39.3-9ubuntu2) ... 379s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78655 files and directories currently installed.) 379s Preparing to unpack .../0-bsdextrautils_2.39.3-9ubuntu2_armhf.deb ... 379s Unpacking bsdextrautils (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 379s Preparing to unpack .../1-groff-base_1.23.0-3build1_armhf.deb ... 379s Unpacking groff-base (1.23.0-3build1) over (1.23.0-3) ... 380s Preparing to unpack .../2-readline-common_8.2-4_all.deb ... 380s Unpacking readline-common (8.2-4) over (8.2-3) ... 380s Selecting previously unselected package libgpgme11t64:armhf. 380s Preparing to unpack .../3-libgpgme11t64_1.18.0-4.1ubuntu3_armhf.deb ... 380s Unpacking libgpgme11t64:armhf (1.18.0-4.1ubuntu3) ... 380s Preparing to unpack .../4-libblockdev-crypto3_3.1.0-1build1_armhf.deb ... 380s Unpacking libblockdev-crypto3:armhf (3.1.0-1build1) over (3.1.0-1) ... 380s Preparing to unpack .../5-e2fsprogs-l10n_1.47.0-2.4~exp1ubuntu2_all.deb ... 380s Unpacking e2fsprogs-l10n (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 380s Preparing to unpack .../6-logsave_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 380s Unpacking logsave (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 380s Preparing to unpack .../7-dhcpcd-base_1%3a10.0.6-1ubuntu2_armhf.deb ... 380s Unpacking dhcpcd-base (1:10.0.6-1ubuntu2) over (1:10.0.6-1ubuntu1) ... 380s Preparing to unpack .../8-libblockdev-fs3_3.1.0-1build1_armhf.deb ... 380s Unpacking libblockdev-fs3:armhf (3.1.0-1build1) over (3.1.0-1) ... 380s dpkg: libreiserfscore0: dependency problems, but removing anyway as you requested: 380s btrfs-progs depends on libreiserfscore0 (>= 1:3.6.27). 380s 380s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78662 files and directories currently installed.) 380s Removing libreiserfscore0 (1:3.6.27-7) ... 380s Selecting previously unselected package libreiserfscore0t64. 380s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78657 files and directories currently installed.) 380s Preparing to unpack .../libreiserfscore0t64_1%3a3.6.27-7.1_armhf.deb ... 380s Unpacking libreiserfscore0t64 (1:3.6.27-7.1) ... 380s Preparing to unpack .../btrfs-progs_6.6.3-1.1build1_armhf.deb ... 380s Unpacking btrfs-progs (6.6.3-1.1build1) over (6.6.3-1.1) ... 380s dpkg: libext2fs2:armhf: dependency problems, but removing anyway as you requested: 380s e2fsprogs depends on libext2fs2 (= 1.47.0-2ubuntu1). 380s 380s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78663 files and directories currently installed.) 380s Removing libext2fs2:armhf (1.47.0-2ubuntu1) ... 380s Selecting previously unselected package libext2fs2t64:armhf. 380s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78656 files and directories currently installed.) 380s Preparing to unpack .../libext2fs2t64_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 380s Adding 'diversion of /lib/arm-linux-gnueabihf/libe2p.so.2 to /lib/arm-linux-gnueabihf/libe2p.so.2.usr-is-merged by libext2fs2t64' 380s Adding 'diversion of /lib/arm-linux-gnueabihf/libe2p.so.2.3 to /lib/arm-linux-gnueabihf/libe2p.so.2.3.usr-is-merged by libext2fs2t64' 380s Adding 'diversion of /lib/arm-linux-gnueabihf/libext2fs.so.2 to /lib/arm-linux-gnueabihf/libext2fs.so.2.usr-is-merged by libext2fs2t64' 380s Adding 'diversion of /lib/arm-linux-gnueabihf/libext2fs.so.2.4 to /lib/arm-linux-gnueabihf/libext2fs.so.2.4.usr-is-merged by libext2fs2t64' 380s Unpacking libext2fs2t64:armhf (1.47.0-2.4~exp1ubuntu2) ... 380s Setting up libcom-err2:armhf (1.47.0-2.4~exp1ubuntu2) ... 380s Setting up libext2fs2t64:armhf (1.47.0-2.4~exp1ubuntu2) ... 381s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78672 files and directories currently installed.) 381s Preparing to unpack .../e2fsprogs_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 381s Unpacking e2fsprogs (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 381s Preparing to unpack .../libblockdev-loop3_3.1.0-1build1_armhf.deb ... 381s Unpacking libblockdev-loop3:armhf (3.1.0-1build1) over (3.1.0-1) ... 381s Preparing to unpack .../libblockdev-mdraid3_3.1.0-1build1_armhf.deb ... 381s Unpacking libblockdev-mdraid3:armhf (3.1.0-1build1) over (3.1.0-1) ... 381s Preparing to unpack .../libblockdev-nvme3_3.1.0-1build1_armhf.deb ... 381s Unpacking libblockdev-nvme3:armhf (3.1.0-1build1) over (3.1.0-1) ... 381s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78672 files and directories currently installed.) 381s Removing libnvme1 (1.8-2) ... 381s Selecting previously unselected package libnvme1t64. 381s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78665 files and directories currently installed.) 381s Preparing to unpack .../0-libnvme1t64_1.8-3_armhf.deb ... 381s Unpacking libnvme1t64 (1.8-3) ... 381s Preparing to unpack .../1-libblockdev-part3_3.1.0-1build1_armhf.deb ... 381s Unpacking libblockdev-part3:armhf (3.1.0-1build1) over (3.1.0-1) ... 381s Preparing to unpack .../2-libblockdev-swap3_3.1.0-1build1_armhf.deb ... 381s Unpacking libblockdev-swap3:armhf (3.1.0-1build1) over (3.1.0-1) ... 381s Preparing to unpack .../3-libblockdev3_3.1.0-1build1_armhf.deb ... 381s Unpacking libblockdev3:armhf (3.1.0-1build1) over (3.1.0-1) ... 381s Preparing to unpack .../4-libgudev-1.0-0_1%3a238-3ubuntu2_armhf.deb ... 381s Unpacking libgudev-1.0-0:armhf (1:238-3ubuntu2) over (1:238-3) ... 381s Preparing to unpack .../5-libxml2_2.9.14+dfsg-1.3ubuntu2_armhf.deb ... 381s Unpacking libxml2:armhf (2.9.14+dfsg-1.3ubuntu2) over (2.9.14+dfsg-1.3ubuntu1) ... 381s Preparing to unpack .../6-libbpf1_1%3a1.3.0-2build1_armhf.deb ... 381s Unpacking libbpf1:armhf (1:1.3.0-2build1) over (1:1.3.0-2) ... 381s Preparing to unpack .../7-iproute2_6.1.0-1ubuntu5_armhf.deb ... 381s Unpacking iproute2 (6.1.0-1ubuntu5) over (6.1.0-1ubuntu2) ... 381s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78673 files and directories currently installed.) 381s Removing libelf1:armhf (0.190-1) ... 381s Selecting previously unselected package libelf1t64:armhf. 381s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78668 files and directories currently installed.) 381s Preparing to unpack .../libelf1t64_0.190-1.1build2_armhf.deb ... 381s Unpacking libelf1t64:armhf (0.190-1.1build2) ... 381s Preparing to unpack .../libtirpc-common_1.3.4+ds-1.1_all.deb ... 381s Unpacking libtirpc-common (1.3.4+ds-1.1) over (1.3.4+ds-1build1) ... 382s Preparing to unpack .../lsof_4.95.0-1build2_armhf.deb ... 382s Unpacking lsof (4.95.0-1build2) over (4.95.0-1build1) ... 382s Preparing to unpack .../libnsl2_1.3.0-3build2_armhf.deb ... 382s Unpacking libnsl2:armhf (1.3.0-3build2) over (1.3.0-3) ... 382s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78673 files and directories currently installed.) 382s Removing libtirpc3:armhf (1.3.4+ds-1build1) ... 382s Selecting previously unselected package libtirpc3t64:armhf. 382s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78667 files and directories currently installed.) 382s Preparing to unpack .../00-libtirpc3t64_1.3.4+ds-1.1_armhf.deb ... 382s Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3 to /lib/arm-linux-gnueabihf/libtirpc.so.3.usr-is-merged by libtirpc3t64' 382s Adding 'diversion of /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0 to /lib/arm-linux-gnueabihf/libtirpc.so.3.0.0.usr-is-merged by libtirpc3t64' 382s Unpacking libtirpc3t64:armhf (1.3.4+ds-1.1) ... 382s Preparing to unpack .../01-libmbim-proxy_1.31.2-0ubuntu2_armhf.deb ... 382s Unpacking libmbim-proxy (1.31.2-0ubuntu2) over (1.30.0-1) ... 382s Preparing to unpack .../02-libmbim-glib4_1.31.2-0ubuntu2_armhf.deb ... 382s Unpacking libmbim-glib4:armhf (1.31.2-0ubuntu2) over (1.30.0-1) ... 382s Preparing to unpack .../03-libjson-glib-1.0-common_1.8.0-2build1_all.deb ... 382s Unpacking libjson-glib-1.0-common (1.8.0-2build1) over (1.8.0-2) ... 382s Preparing to unpack .../04-libjson-glib-1.0-0_1.8.0-2build1_armhf.deb ... 382s Unpacking libjson-glib-1.0-0:armhf (1.8.0-2build1) over (1.8.0-2) ... 382s Preparing to unpack .../05-libnghttp2-14_1.59.0-1build1_armhf.deb ... 382s Unpacking libnghttp2-14:armhf (1.59.0-1build1) over (1.59.0-1) ... 382s Preparing to unpack .../06-libssh-4_0.10.6-2build1_armhf.deb ... 382s Unpacking libssh-4:armhf (0.10.6-2build1) over (0.10.6-2) ... 382s Preparing to unpack .../07-libusb-1.0-0_2%3a1.0.27-1_armhf.deb ... 382s Unpacking libusb-1.0-0:armhf (2:1.0.27-1) over (2:1.0.26-1) ... 382s Preparing to unpack .../08-libgusb2_0.4.8-1build1_armhf.deb ... 382s Unpacking libgusb2:armhf (0.4.8-1build1) over (0.4.8-1) ... 382s Preparing to unpack .../09-libmm-glib0_1.23.4-0ubuntu1_armhf.deb ... 382s Unpacking libmm-glib0:armhf (1.23.4-0ubuntu1) over (1.22.0-3) ... 383s Preparing to unpack .../10-libprotobuf-c1_1.4.1-1ubuntu3_armhf.deb ... 383s Unpacking libprotobuf-c1:armhf (1.4.1-1ubuntu3) over (1.4.1-1ubuntu2) ... 383s Preparing to unpack .../11-libsasl2-2_2.1.28+dfsg1-5ubuntu1_armhf.deb ... 383s Unpacking libsasl2-2:armhf (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 383s Preparing to unpack .../12-libibverbs1_50.0-2build1_armhf.deb ... 383s Unpacking libibverbs1:armhf (50.0-2build1) over (50.0-2) ... 383s Preparing to unpack .../13-libfido2-1_1.14.0-1build1_armhf.deb ... 383s Unpacking libfido2-1:armhf (1.14.0-1build1) over (1.14.0-1) ... 383s Preparing to unpack .../14-libproc2-0_2%3a4.0.4-4ubuntu2_armhf.deb ... 383s Unpacking libproc2-0:armhf (2:4.0.4-4ubuntu2) over (2:4.0.4-4ubuntu1) ... 383s Preparing to unpack .../15-procps_2%3a4.0.4-4ubuntu2_armhf.deb ... 383s Unpacking procps (2:4.0.4-4ubuntu2) over (2:4.0.4-4ubuntu1) ... 383s Preparing to unpack .../16-coreutils_9.4-3ubuntu3_armhf.deb ... 383s Unpacking coreutils (9.4-3ubuntu3) over (9.4-2ubuntu4) ... 383s Setting up coreutils (9.4-3ubuntu3) ... 383s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78679 files and directories currently installed.) 383s Preparing to unpack .../util-linux_2.39.3-9ubuntu2_armhf.deb ... 383s Unpacking util-linux (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 383s Setting up util-linux (2.39.3-9ubuntu2) ... 385s fstrim.service is a disabled or a static unit not running, not starting it. 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78679 files and directories currently installed.) 385s Removing libatm1:armhf (1:2.5.1-5) ... 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78674 files and directories currently installed.) 385s Preparing to unpack .../file_1%3a5.45-3_armhf.deb ... 385s Unpacking file (1:5.45-3) over (1:5.45-2) ... 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78674 files and directories currently installed.) 385s Removing libmagic1:armhf (1:5.45-2) ... 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78664 files and directories currently installed.) 385s Preparing to unpack .../libmagic-mgc_1%3a5.45-3_armhf.deb ... 385s Unpacking libmagic-mgc (1:5.45-3) over (1:5.45-2) ... 385s Selecting previously unselected package libmagic1t64:armhf. 385s Preparing to unpack .../libmagic1t64_1%3a5.45-3_armhf.deb ... 385s Unpacking libmagic1t64:armhf (1:5.45-3) ... 385s Preparing to unpack .../libplymouth5_24.004.60-1ubuntu6_armhf.deb ... 385s Unpacking libplymouth5:armhf (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78675 files and directories currently installed.) 385s Removing libpng16-16:armhf (1.6.43-1) ... 385s Selecting previously unselected package libpng16-16t64:armhf. 385s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78665 files and directories currently installed.) 385s Preparing to unpack .../libpng16-16t64_1.6.43-3_armhf.deb ... 385s Unpacking libpng16-16t64:armhf (1.6.43-3) ... 385s Preparing to unpack .../bind9-host_1%3a9.18.24-0ubuntu3_armhf.deb ... 385s Unpacking bind9-host (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 385s Preparing to unpack .../bind9-dnsutils_1%3a9.18.24-0ubuntu3_armhf.deb ... 385s Unpacking bind9-dnsutils (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 385s Preparing to unpack .../bind9-libs_1%3a9.18.24-0ubuntu3_armhf.deb ... 385s Unpacking bind9-libs:armhf (1:9.18.24-0ubuntu3) over (1:9.18.21-0ubuntu1) ... 386s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78676 files and directories currently installed.) 386s Removing libuv1:armhf (1.48.0-1) ... 386s Selecting previously unselected package libuv1t64:armhf. 386s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78671 files and directories currently installed.) 386s Preparing to unpack .../libuv1t64_1.48.0-1.1_armhf.deb ... 386s Unpacking libuv1t64:armhf (1.48.0-1.1) ... 386s Preparing to unpack .../uuid-runtime_2.39.3-9ubuntu2_armhf.deb ... 386s Unpacking uuid-runtime (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 386s Preparing to unpack .../libdebconfclient0_0.271ubuntu2_armhf.deb ... 386s Unpacking libdebconfclient0:armhf (0.271ubuntu2) over (0.271ubuntu1) ... 386s Setting up libdebconfclient0:armhf (0.271ubuntu2) ... 386s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 386s Preparing to unpack .../libsemanage-common_3.5-1build4_all.deb ... 386s Unpacking libsemanage-common (3.5-1build4) over (3.5-1build2) ... 386s Setting up libsemanage-common (3.5-1build4) ... 386s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 386s Preparing to unpack .../libsemanage2_3.5-1build4_armhf.deb ... 386s Unpacking libsemanage2:armhf (3.5-1build4) over (3.5-1build2) ... 386s Setting up libsemanage2:armhf (3.5-1build4) ... 386s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 386s Preparing to unpack .../install-info_7.1-3build1_armhf.deb ... 386s Unpacking install-info (7.1-3build1) over (7.1-3) ... 386s Setting up install-info (7.1-3build1) ... 386s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78677 files and directories currently installed.) 386s Preparing to unpack .../00-gcc-13-base_13.2.0-21ubuntu1_armhf.deb ... 386s Unpacking gcc-13-base:armhf (13.2.0-21ubuntu1) over (13.2.0-17ubuntu2) ... 386s Preparing to unpack .../01-libss2_1.47.0-2.4~exp1ubuntu2_armhf.deb ... 386s Unpacking libss2:armhf (1.47.0-2.4~exp1ubuntu2) over (1.47.0-2ubuntu1) ... 387s Preparing to unpack .../02-dmsetup_2%3a1.02.185-3ubuntu2_armhf.deb ... 387s Unpacking dmsetup (2:1.02.185-3ubuntu2) over (2:1.02.185-3ubuntu1) ... 387s Preparing to unpack .../03-eject_2.39.3-9ubuntu2_armhf.deb ... 387s Unpacking eject (2.39.3-9ubuntu2) over (2.39.3-6ubuntu2) ... 387s Preparing to unpack .../04-krb5-locales_1.20.1-6ubuntu1_all.deb ... 387s Unpacking krb5-locales (1.20.1-6ubuntu1) over (1.20.1-5build1) ... 387s Preparing to unpack .../05-libglib2.0-data_2.79.3-3ubuntu5_all.deb ... 387s Unpacking libglib2.0-data (2.79.3-3ubuntu5) over (2.79.2-1~ubuntu1) ... 387s Preparing to unpack .../06-libslang2_2.3.3-3build1_armhf.deb ... 387s Unpacking libslang2:armhf (2.3.3-3build1) over (2.3.3-3) ... 387s Preparing to unpack .../07-rsyslog_8.2312.0-3ubuntu7_armhf.deb ... 387s Unpacking rsyslog (8.2312.0-3ubuntu7) over (8.2312.0-3ubuntu3) ... 387s Preparing to unpack .../08-vim-tiny_2%3a9.1.0016-1ubuntu6_armhf.deb ... 387s Unpacking vim-tiny (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 387s Preparing to unpack .../09-vim-common_2%3a9.1.0016-1ubuntu6_all.deb ... 387s Unpacking vim-common (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 387s Selecting previously unselected package xdg-user-dirs. 387s Preparing to unpack .../10-xdg-user-dirs_0.18-1_armhf.deb ... 387s Unpacking xdg-user-dirs (0.18-1) ... 387s Preparing to unpack .../11-xxd_2%3a9.1.0016-1ubuntu6_armhf.deb ... 387s Unpacking xxd (2:9.1.0016-1ubuntu6) over (2:9.1.0016-1ubuntu2) ... 387s Preparing to unpack .../12-apparmor_4.0.0-beta3-0ubuntu2_armhf.deb ... 388s Unpacking apparmor (4.0.0-beta3-0ubuntu2) over (4.0.0~alpha4-0ubuntu1) ... 388s Preparing to unpack .../13-ftp_20230507-2build1_all.deb ... 388s Unpacking ftp (20230507-2build1) over (20230507-2) ... 388s Preparing to unpack .../14-inetutils-telnet_2%3a2.5-3ubuntu3_armhf.deb ... 388s Unpacking inetutils-telnet (2:2.5-3ubuntu3) over (2:2.5-3ubuntu1) ... 388s Preparing to unpack .../15-info_7.1-3build1_armhf.deb ... 388s Unpacking info (7.1-3build1) over (7.1-3) ... 388s Preparing to unpack .../16-libxmuu1_2%3a1.1.3-3build1_armhf.deb ... 388s Unpacking libxmuu1:armhf (2:1.1.3-3build1) over (2:1.1.3-3) ... 388s Preparing to unpack .../17-lshw_02.19.git.2021.06.19.996aaad9c7-2build2_armhf.deb ... 388s Unpacking lshw (02.19.git.2021.06.19.996aaad9c7-2build2) over (02.19.git.2021.06.19.996aaad9c7-2build1) ... 388s Preparing to unpack .../18-mtr-tiny_0.95-1.1build1_armhf.deb ... 388s Unpacking mtr-tiny (0.95-1.1build1) over (0.95-1.1) ... 388s Preparing to unpack .../19-plymouth-theme-ubuntu-text_24.004.60-1ubuntu6_armhf.deb ... 388s Unpacking plymouth-theme-ubuntu-text (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 388s Preparing to unpack .../20-plymouth_24.004.60-1ubuntu6_armhf.deb ... 389s Unpacking plymouth (24.004.60-1ubuntu6) over (24.004.60-1ubuntu3) ... 389s Preparing to unpack .../21-psmisc_23.7-1_armhf.deb ... 389s Unpacking psmisc (23.7-1) over (23.6-2) ... 389s Preparing to unpack .../22-telnet_0.17+2.5-3ubuntu3_all.deb ... 389s Unpacking telnet (0.17+2.5-3ubuntu3) over (0.17+2.5-3ubuntu1) ... 389s Preparing to unpack .../23-usb.ids_2024.03.18-1_all.deb ... 389s Unpacking usb.ids (2024.03.18-1) over (2024.01.30-1) ... 389s Preparing to unpack .../24-xz-utils_5.6.0-0.2_armhf.deb ... 389s Unpacking xz-utils (5.6.0-0.2) over (5.4.5-0.3) ... 389s Preparing to unpack .../25-libctf0_2.42-4ubuntu1_armhf.deb ... 389s Unpacking libctf0:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../26-libctf-nobfd0_2.42-4ubuntu1_armhf.deb ... 389s Unpacking libctf-nobfd0:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../27-binutils-arm-linux-gnueabihf_2.42-4ubuntu1_armhf.deb ... 389s Unpacking binutils-arm-linux-gnueabihf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../28-libbinutils_2.42-4ubuntu1_armhf.deb ... 389s Unpacking libbinutils:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../29-binutils_2.42-4ubuntu1_armhf.deb ... 389s Unpacking binutils (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../30-binutils-common_2.42-4ubuntu1_armhf.deb ... 389s Unpacking binutils-common:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../31-libsframe1_2.42-4ubuntu1_armhf.deb ... 389s Unpacking libsframe1:armhf (2.42-4ubuntu1) over (2.42-3ubuntu1) ... 389s Preparing to unpack .../32-bolt_0.9.6-2build1_armhf.deb ... 389s Unpacking bolt (0.9.6-2build1) over (0.9.6-2) ... 389s Preparing to unpack .../33-cryptsetup-bin_2%3a2.7.0-1ubuntu2_armhf.deb ... 389s Unpacking cryptsetup-bin (2:2.7.0-1ubuntu2) over (2:2.7.0-1ubuntu1) ... 389s Preparing to unpack .../34-dpkg-dev_1.22.6ubuntu4_all.deb ... 389s Unpacking dpkg-dev (1.22.6ubuntu4) over (1.22.4ubuntu5) ... 389s Preparing to unpack .../35-libdpkg-perl_1.22.6ubuntu4_all.deb ... 389s Unpacking libdpkg-perl (1.22.6ubuntu4) over (1.22.4ubuntu5) ... 390s Preparing to unpack .../36-gnupg-l10n_2.4.4-2ubuntu15_all.deb ... 390s Unpacking gnupg-l10n (2.4.4-2ubuntu15) over (2.4.4-2ubuntu7) ... 390s Preparing to unpack .../37-ibverbs-providers_50.0-2build1_armhf.deb ... 390s Unpacking ibverbs-providers:armhf (50.0-2build1) over (50.0-2) ... 390s Preparing to unpack .../38-jq_1.7.1-3_armhf.deb ... 390s Unpacking jq (1.7.1-3) over (1.7.1-2) ... 390s Preparing to unpack .../39-libjq1_1.7.1-3_armhf.deb ... 390s Unpacking libjq1:armhf (1.7.1-3) over (1.7.1-2) ... 390s Selecting previously unselected package libatm1t64:armhf. 390s Preparing to unpack .../40-libatm1t64_1%3a2.5.1-5.1_armhf.deb ... 390s Unpacking libatm1t64:armhf (1:2.5.1-5.1) ... 390s Preparing to unpack .../41-libevent-core-2.1-7_2.1.12-stable-9build1_armhf.deb ... 390s Unpacking libevent-core-2.1-7:armhf (2.1.12-stable-9build1) over (2.1.12-stable-9) ... 390s Preparing to unpack .../42-libftdi1-2_1.5-6build4_armhf.deb ... 390s Unpacking libftdi1-2:armhf (1.5-6build4) over (1.5-6build3) ... 390s Preparing to unpack .../43-libldap-common_2.6.7+dfsg-1~exp1ubuntu6_all.deb ... 390s Unpacking libldap-common (2.6.7+dfsg-1~exp1ubuntu6) over (2.6.7+dfsg-1~exp1ubuntu1) ... 390s Preparing to unpack .../44-libsasl2-modules_2.1.28+dfsg1-5ubuntu1_armhf.deb ... 390s Unpacking libsasl2-modules:armhf (2.1.28+dfsg1-5ubuntu1) over (2.1.28+dfsg1-4) ... 390s Preparing to unpack .../45-python3-distutils_3.12.2-3ubuntu1.1_all.deb ... 390s Unpacking python3-distutils (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 390s Preparing to unpack .../46-python3-lib2to3_3.12.2-3ubuntu1.1_all.deb ... 390s Unpacking python3-lib2to3 (3.12.2-3ubuntu1.1) over (3.11.5-1) ... 390s Preparing to unpack .../47-python3-pyrsistent_0.20.0-1build1_armhf.deb ... 390s Unpacking python3-pyrsistent:armhf (0.20.0-1build1) over (0.20.0-1) ... 390s Preparing to unpack .../48-python3-typing-extensions_4.10.0-1_all.deb ... 390s Unpacking python3-typing-extensions (4.10.0-1) over (4.9.0-1) ... 390s Preparing to unpack .../49-kpartx_0.9.4-5ubuntu6_armhf.deb ... 390s Unpacking kpartx (0.9.4-5ubuntu6) over (0.9.4-5ubuntu3) ... 391s Setting up pinentry-curses (1.2.1-3ubuntu4) ... 391s Setting up libtext-iconv-perl:armhf (1.7-8build2) ... 391s Setting up libtext-charwidth-perl:armhf (0.04-11build2) ... 391s Setting up libibverbs1:armhf (50.0-2build1) ... 391s Setting up systemd-sysv (255.4-1ubuntu5) ... 391s Setting up libapparmor1:armhf (4.0.0-beta3-0ubuntu2) ... 391s Setting up libatm1t64:armhf (1:2.5.1-5.1) ... 391s Setting up libgdbm6t64:armhf (1.23-5.1) ... 391s Setting up bsdextrautils (2.39.3-9ubuntu2) ... 391s Setting up libgdbm-compat4t64:armhf (1.23-5.1) ... 391s Setting up xdg-user-dirs (0.18-1) ... 391s Setting up ibverbs-providers:armhf (50.0-2build1) ... 391s Setting up linux-headers-6.8.0-20 (6.8.0-20.20) ... 391s Setting up libmagic-mgc (1:5.45-3) ... 391s Setting up gawk (1:5.2.1-2build2) ... 391s Setting up psmisc (23.7-1) ... 391s Setting up libjq1:armhf (1.7.1-3) ... 391s Setting up libtirpc-common (1.3.4+ds-1.1) ... 391s Setting up libbrotli1:armhf (1.1.0-2build1) ... 391s Setting up libsqlite3-0:armhf (3.45.1-1ubuntu1) ... 391s Setting up libsasl2-modules:armhf (2.1.28+dfsg1-5ubuntu1) ... 391s Setting up libuv1t64:armhf (1.48.0-1.1) ... 391s Setting up libmagic1t64:armhf (1:5.45-3) ... 391s Setting up rsyslog (8.2312.0-3ubuntu7) ... 391s info: The user `syslog' is already a member of `adm'. 391s apparmor_parser: Unable to replace "rsyslogd". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 391s 392s Setting up binutils-common:armhf (2.42-4ubuntu1) ... 392s Setting up libpsl5t64:armhf (0.21.2-1.1) ... 392s Setting up libnghttp2-14:armhf (1.59.0-1build1) ... 392s Setting up libreiserfscore0t64 (1:3.6.27-7.1) ... 392s Setting up libctf-nobfd0:armhf (2.42-4ubuntu1) ... 392s Setting up libnss-systemd:armhf (255.4-1ubuntu5) ... 392s Setting up krb5-locales (1.20.1-6ubuntu1) ... 392s Setting up file (1:5.45-3) ... 392s Setting up kmod (31+20240202-2ubuntu4) ... 392s Setting up lshw (02.19.git.2021.06.19.996aaad9c7-2build2) ... 392s Setting up libldap-common (2.6.7+dfsg-1~exp1ubuntu6) ... 392s Setting up libprotobuf-c1:armhf (1.4.1-1ubuntu3) ... 392s Setting up xxd (2:9.1.0016-1ubuntu6) ... 392s Setting up libsframe1:armhf (2.42-4ubuntu1) ... 392s Setting up libelf1t64:armhf (0.190-1.1build2) ... 392s Setting up libkrb5support0:armhf (1.20.1-6ubuntu1) ... 392s Setting up linux-headers-6.8.0-20-generic (6.8.0-20.20) ... 392s Setting up eject (2.39.3-9ubuntu2) ... 392s Setting up apparmor (4.0.0-beta3-0ubuntu2) ... 392s Installing new version of config file /etc/apparmor.d/abstractions/authentication ... 392s Installing new version of config file /etc/apparmor.d/abstractions/crypto ... 392s Installing new version of config file /etc/apparmor.d/abstractions/kde-open5 ... 392s Installing new version of config file /etc/apparmor.d/abstractions/openssl ... 392s Installing new version of config file /etc/apparmor.d/code ... 392s Installing new version of config file /etc/apparmor.d/firefox ... 392s apparmor_parser: Unable to replace "lsb_release". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 392s 393s apparmor_parser: Unable to replace "kmod". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s apparmor_parser: Unable to replace "nvidia_modprobe". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s sysctl: cannot stat /proc/sys/kernel/apparmor_restrict_unprivileged_userns: No such file or directory 393s Reloading AppArmor profiles 393s /sbin/apparmor_parser: Unable to replace "1password". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "Discord". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "MongoDB Compass". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "QtWebEngineProcess". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "brave". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "buildah". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "cam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "ch-checkns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "ch-run". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "chrome". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "vscode". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "busybox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "devhelp". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "element-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "epiphany". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "evolution". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "crun". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "geary". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "github-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "firefox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "flatpak". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "kchmviewer". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "goldendict". /sbin/apparmor_parser: Unable to replace "keybase". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lc-compliance". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "loupe". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "linux-sandbox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "libcamerify". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "ipa_verify". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-create". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-attach". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-destroy". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-stop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-usernsexec". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-unshare". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "msedge". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "nautilus". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "obsidian". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lxc-execute". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "opam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "mmdebstrap". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "pageedit". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "podman". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "polypane". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "notepadqq". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "privacybrowser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "qcam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "qmapshack". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "qutebrowser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "rootlesskit". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "rssguard". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "rpm". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "runc". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-adduser". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-abort". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "QtWebEngineProcess". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "plasmashell". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-apt". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-checkpackages". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-createchroot". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-destroychroot". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-clean". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-shell". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-hold". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "opera". /sbin/apparmor_parser: Unable to replace "sbuild-unhold". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-upgrade". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "scide". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-distupgrade". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "signal-desktop". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "slirp4netns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "steam". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "stress-ng". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "surfshark". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "sbuild-update". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "thunderbird". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "toybox". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "trinity". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "tup". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "tuxedo-control-center". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "kmod". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "nvidia_modprobe". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "userbindmount". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "unprivileged_userns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "slack". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "uwsgi-core". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "systemd-coredump". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "vdens". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "virtiofsd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "vivaldi-bin". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "vpnns". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "wpcom". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "lsb_release". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "unix-chkpwd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "ubuntu_pro_apt_news". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "/usr/bin/man". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 393s /sbin/apparmor_parser: Unable to replace "rsyslogd". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 393s 394s /sbin/apparmor_parser: Unable to replace "tcpdump". /sbin/apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 394s 394s Error: At least one profile failed to load 394s Setting up libglib2.0-0t64:armhf (2.79.3-3ubuntu5) ... 394s No schema files found: doing nothing. 394s Setting up libglib2.0-data (2.79.3-3ubuntu5) ... 394s Setting up vim-common (2:9.1.0016-1ubuntu6) ... 394s Setting up gcc-13-base:armhf (13.2.0-21ubuntu1) ... 394s Setting up libqrtr-glib0:armhf (1.2.2-1ubuntu3) ... 394s Setting up libslang2:armhf (2.3.3-3build1) ... 394s Setting up libnvme1t64 (1.8-3) ... 394s Setting up mtr-tiny (0.95-1.1build1) ... 394s Setting up gnupg-l10n (2.4.4-2ubuntu15) ... 394s Setting up librtmp1:armhf (2.4+20151223.gitfa8646d.1-2build6) ... 394s Setting up libdbus-1-3:armhf (1.14.10-4ubuntu2) ... 394s Setting up xz-utils (5.6.0-0.2) ... 394s Setting up perl-modules-5.38 (5.38.2-3.2) ... 394s Setting up libproc2-0:armhf (2:4.0.4-4ubuntu2) ... 394s Setting up libblockdev-utils3:armhf (3.1.0-1build1) ... 394s Setting up libpng16-16t64:armhf (1.6.43-3) ... 394s Setting up systemd-timesyncd (255.4-1ubuntu5) ... 394s Setting up libevent-core-2.1-7:armhf (2.1.12-stable-9build1) ... 394s Setting up udev (255.4-1ubuntu5) ... 395s Setting up libss2:armhf (1.47.0-2.4~exp1ubuntu2) ... 395s Setting up usb.ids (2024.03.18-1) ... 395s Setting up sudo (1.9.15p5-3ubuntu3) ... 395s Setting up dhcpcd-base (1:10.0.6-1ubuntu2) ... 395s Setting up gir1.2-glib-2.0:armhf (2.79.3-3ubuntu5) ... 395s Setting up libk5crypto3:armhf (1.20.1-6ubuntu1) ... 395s Setting up logsave (1.47.0-2.4~exp1ubuntu2) ... 395s Setting up libfdisk1:armhf (2.39.3-9ubuntu2) ... 395s Setting up libdb5.3t64:armhf (5.3.28+dfsg2-6) ... 395s Setting up libblockdev-nvme3:armhf (3.1.0-1build1) ... 395s Setting up libdevmapper1.02.1:armhf (2:1.02.185-3ubuntu2) ... 395s Setting up libblockdev-fs3:armhf (3.1.0-1build1) ... 395s Setting up python-apt-common (2.7.7) ... 395s Setting up mount (2.39.3-9ubuntu2) ... 395s Setting up dmsetup (2:1.02.185-3ubuntu2) ... 395s Setting up uuid-runtime (2.39.3-9ubuntu2) ... 397s uuidd.service is a disabled or a static unit not running, not starting it. 397s Setting up libmm-glib0:armhf (1.23.4-0ubuntu1) ... 397s Setting up groff-base (1.23.0-3build1) ... 397s Setting up libplymouth5:armhf (24.004.60-1ubuntu6) ... 397s Setting up dbus-session-bus-common (1.14.10-4ubuntu2) ... 397s Setting up kpartx (0.9.4-5ubuntu6) ... 397s Setting up jq (1.7.1-3) ... 397s Setting up procps (2:4.0.4-4ubuntu2) ... 397s Setting up gpgconf (2.4.4-2ubuntu15) ... 397s Setting up libpcap0.8t64:armhf (1.10.4-4.1ubuntu2) ... 397s Setting up libcryptsetup12:armhf (2:2.7.0-1ubuntu2) ... 397s Setting up libgirepository-1.0-1:armhf (1.79.1-1ubuntu6) ... 397s Setting up libjson-glib-1.0-common (1.8.0-2build1) ... 397s Setting up libkrb5-3:armhf (1.20.1-6ubuntu1) ... 397s Setting up libpython3.11-minimal:armhf (3.11.8-1build4) ... 397s Setting up libusb-1.0-0:armhf (2:1.0.27-1) ... 397s Setting up libperl5.38t64:armhf (5.38.2-3.2) ... 397s Setting up tnftp (20230507-2build1) ... 397s Setting up libbinutils:armhf (2.42-4ubuntu1) ... 397s Setting up dbus-system-bus-common (1.14.10-4ubuntu2) ... 397s Setting up libfido2-1:armhf (1.14.0-1build1) ... 397s Setting up openssl (3.0.13-0ubuntu2) ... 397s Setting up readline-common (8.2-4) ... 397s Setting up libxml2:armhf (2.9.14+dfsg-1.3ubuntu2) ... 397s Setting up libxmuu1:armhf (2:1.1.3-3build1) ... 397s Setting up dbus-bin (1.14.10-4ubuntu2) ... 397s Setting up info (7.1-3build1) ... 397s Setting up liblocale-gettext-perl (1.07-6ubuntu4) ... 397s Setting up gpg (2.4.4-2ubuntu15) ... 397s Setting up libgudev-1.0-0:armhf (1:238-3ubuntu2) ... 397s Setting up libpolkit-gobject-1-0:armhf (124-1ubuntu1) ... 397s Setting up libbpf1:armhf (1:1.3.0-2build1) ... 397s Setting up libmbim-glib4:armhf (1.31.2-0ubuntu2) ... 397s Setting up rsync (3.2.7-1build1) ... 398s rsync.service is a disabled or a static unit not running, not starting it. 398s Setting up libudisks2-0:armhf (2.10.1-6) ... 398s Setting up bolt (0.9.6-2build1) ... 398s bolt.service is a disabled or a static unit not running, not starting it. 398s Setting up gnupg-utils (2.4.4-2ubuntu15) ... 398s Setting up initramfs-tools-bin (0.142ubuntu23) ... 398s Setting up libctf0:armhf (2.42-4ubuntu1) ... 398s Setting up cryptsetup-bin (2:2.7.0-1ubuntu2) ... 398s Setting up python3.11-minimal (3.11.8-1build4) ... 400s Setting up tcpdump (4.99.4-3ubuntu2) ... 400s apparmor_parser: Unable to replace "tcpdump". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 400s 400s Setting up apt-utils (2.7.14) ... 400s Setting up gpg-agent (2.4.4-2ubuntu15) ... 400s Setting up libpython3.12-stdlib:armhf (3.12.2-4build3) ... 400s Setting up libblockdev-mdraid3:armhf (3.1.0-1build1) ... 400s Setting up wget (1.21.4-1ubuntu2) ... 400s Setting up libblockdev-swap3:armhf (3.1.0-1build1) ... 400s Setting up plymouth (24.004.60-1ubuntu6) ... 400s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 401s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 401s Setting up libxmlb2:armhf (0.3.15-1build1) ... 401s Setting up btrfs-progs (6.6.3-1.1build1) ... 401s Setting up libpython3.11-stdlib:armhf (3.11.8-1build4) ... 401s Setting up python3.12 (3.12.2-4build3) ... 403s Setting up libblockdev-loop3:armhf (3.1.0-1build1) ... 403s Setting up gpgsm (2.4.4-2ubuntu15) ... 403s Setting up inetutils-telnet (2:2.5-3ubuntu3) ... 403s Setting up e2fsprogs (1.47.0-2.4~exp1ubuntu2) ... 403s update-initramfs: deferring update (trigger activated) 403s e2scrub_all.service is a disabled or a static unit not running, not starting it. 403s Setting up libparted2t64:armhf (3.6-3.1build2) ... 403s Setting up linux-headers-generic (6.8.0-20.20+1) ... 403s Setting up dbus-daemon (1.14.10-4ubuntu2) ... 403s Setting up libmbim-proxy (1.31.2-0ubuntu2) ... 403s Setting up vim-tiny (2:9.1.0016-1ubuntu6) ... 403s Setting up libnetplan1:armhf (1.0-1) ... 403s Setting up man-db (2.12.0-3build4) ... 403s Updating database of manual pages ... 405s apparmor_parser: Unable to replace "/usr/bin/man". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 405s 406s man-db.service is a disabled or a static unit not running, not starting it. 406s Setting up libblockdev3:armhf (3.1.0-1build1) ... 406s Setting up fdisk (2.39.3-9ubuntu2) ... 406s Setting up libjson-glib-1.0-0:armhf (1.8.0-2build1) ... 406s Setting up libblockdev-part3:armhf (3.1.0-1build1) ... 406s Setting up libsasl2-modules-db:armhf (2.1.28+dfsg1-5ubuntu1) ... 406s Setting up libftdi1-2:armhf (1.5-6build4) ... 406s Setting up perl (5.38.2-3.2) ... 406s Setting up plymouth-theme-ubuntu-text (24.004.60-1ubuntu6) ... 406s update-initramfs: deferring update (trigger activated) 406s Setting up gir1.2-girepository-2.0:armhf (1.79.1-1ubuntu6) ... 406s Setting up dbus (1.14.10-4ubuntu2) ... 406s A reboot is required to replace the running dbus-daemon. 406s Please reboot the system when convenient. 406s Setting up shared-mime-info (2.4-1build1) ... 407s Setting up libgssapi-krb5-2:armhf (1.20.1-6ubuntu1) ... 407s Setting up ftp (20230507-2build1) ... 407s Setting up keyboxd (2.4.4-2ubuntu15) ... 407s Setting up libdpkg-perl (1.22.6ubuntu4) ... 407s Setting up libsasl2-2:armhf (2.1.28+dfsg1-5ubuntu1) ... 407s Setting up libssh-4:armhf (0.10.6-2build1) ... 407s Setting up libpam-systemd:armhf (255.4-1ubuntu5) ... 407s Setting up libpolkit-agent-1-0:armhf (124-1ubuntu1) ... 407s Setting up libgpgme11t64:armhf (1.18.0-4.1ubuntu3) ... 407s Setting up netplan-generator (1.0-1) ... 407s Removing 'diversion of /lib/systemd/system-generators/netplan to /lib/systemd/system-generators/netplan.usr-is-merged by netplan-generator' 407s Setting up initramfs-tools-core (0.142ubuntu23) ... 407s Setting up binutils-arm-linux-gnueabihf (2.42-4ubuntu1) ... 407s Setting up libarchive13t64:armhf (3.7.2-1.1ubuntu2) ... 407s Setting up libldap2:armhf (2.6.7+dfsg-1~exp1ubuntu6) ... 407s Setting up libpython3-stdlib:armhf (3.12.2-0ubuntu1) ... 407s Setting up systemd-resolved (255.4-1ubuntu5) ... 408s Setting up python3.11 (3.11.8-1build4) ... 410s Setting up telnet (0.17+2.5-3ubuntu3) ... 410s Setting up initramfs-tools (0.142ubuntu23) ... 410s update-initramfs: deferring update (trigger activated) 410s Setting up libcurl4t64:armhf (8.5.0-2ubuntu8) ... 410s Setting up bind9-libs:armhf (1:9.18.24-0ubuntu3) ... 410s Setting up libtirpc3t64:armhf (1.3.4+ds-1.1) ... 410s Setting up e2fsprogs-l10n (1.47.0-2.4~exp1ubuntu2) ... 410s Setting up iproute2 (6.1.0-1ubuntu5) ... 410s Setting up openssh-client (1:9.6p1-3ubuntu11) ... 410s Setting up libgusb2:armhf (0.4.8-1build1) ... 410s Setting up libcurl3t64-gnutls:armhf (8.5.0-2ubuntu8) ... 410s Setting up parted (3.6-3.1build2) ... 410s Setting up libqmi-glib5:armhf (1.35.2-0ubuntu1) ... 410s Setting up python3 (3.12.2-0ubuntu1) ... 410s Setting up binutils (2.42-4ubuntu1) ... 410s Setting up libjcat1:armhf (0.2.0-2build2) ... 410s Setting up dpkg-dev (1.22.6ubuntu4) ... 410s Setting up dirmngr (2.4.4-2ubuntu15) ... 410s Setting up dbus-user-session (1.14.10-4ubuntu2) ... 410s Setting up python3-cryptography (41.0.7-4build2) ... 411s Setting up python3-gi (3.47.0-3build1) ... 411s Setting up python3-typing-extensions (4.10.0-1) ... 411s Setting up lsof (4.95.0-1build2) ... 411s Setting up python3-pyrsistent:armhf (0.20.0-1build1) ... 411s Setting up libnsl2:armhf (1.3.0-3build2) ... 411s Setting up gnupg (2.4.4-2ubuntu15) ... 411s Setting up python3-netplan (1.0-1) ... 411s Setting up curl (8.5.0-2ubuntu8) ... 411s Setting up libvolume-key1:armhf (0.3.12-7build1) ... 411s Setting up bind9-host (1:9.18.24-0ubuntu3) ... 411s Setting up python3-lib2to3 (3.12.2-3ubuntu1.1) ... 412s Setting up python3-pkg-resources (68.1.2-2ubuntu1) ... 412s Setting up python3-distutils (3.12.2-3ubuntu1.1) ... 412s python3.12: can't get files for byte-compilation 412s Setting up openssh-sftp-server (1:9.6p1-3ubuntu11) ... 412s Setting up python3-dbus (1.3.2-5build2) ... 412s Setting up python3-setuptools (68.1.2-2ubuntu1) ... 413s Setting up gpg-wks-client (2.4.4-2ubuntu15) ... 413s Setting up openssh-server (1:9.6p1-3ubuntu11) ... 413s Replacing config file /etc/ssh/sshd_config with new version 415s Created symlink /etc/systemd/system/ssh.service.requires/ssh.socket → /usr/lib/systemd/system/ssh.socket. 416s Setting up libblockdev-crypto3:armhf (3.1.0-1build1) ... 416s Setting up python3-gdbm:armhf (3.12.2-3ubuntu1.1) ... 416s Setting up python3-apt (2.7.7) ... 417s Setting up libfwupd2:armhf (1.9.15-2) ... 417s Setting up python3-yaml (6.0.1-2build1) ... 417s Setting up libqmi-proxy (1.35.2-0ubuntu1) ... 417s Setting up netplan.io (1.0-1) ... 417s Setting up bind9-dnsutils (1:9.18.24-0ubuntu3) ... 417s Setting up ubuntu-pro-client (31.2.1) ... 417s apparmor_parser: Unable to replace "ubuntu_pro_apt_news". apparmor_parser: Access denied. You need policy admin privileges to manage profiles. 417s 418s Setting up fwupd (1.9.15-2) ... 419s fwupd-offline-update.service is a disabled or a static unit not running, not starting it. 419s fwupd-refresh.service is a disabled or a static unit not running, not starting it. 419s fwupd.service is a disabled or a static unit not running, not starting it. 419s Setting up ubuntu-pro-client-l10n (31.2.1) ... 419s Setting up udisks2 (2.10.1-6) ... 419s vda: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/uevent': Permission denied 419s vda1: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda1/uevent': Permission denied 419s vda15: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda15/uevent': Permission denied 419s vda2: Failed to write 'change' to '/sys/devices/pci0000:00/0000:00:01.3/0000:04:00.0/virtio2/block/vda/vda2/uevent': Permission denied 419s loop0: Failed to write 'change' to '/sys/devices/virtual/block/loop0/uevent': Permission denied 419s loop1: Failed to write 'change' to '/sys/devices/virtual/block/loop1/uevent': Permission denied 419s loop2: Failed to write 'change' to '/sys/devices/virtual/block/loop2/uevent': Permission denied 419s loop3: Failed to write 'change' to '/sys/devices/virtual/block/loop3/uevent': Permission denied 419s loop4: Failed to write 'change' to '/sys/devices/virtual/block/loop4/uevent': Permission denied 419s loop5: Failed to write 'change' to '/sys/devices/virtual/block/loop5/uevent': Permission denied 419s loop6: Failed to write 'change' to '/sys/devices/virtual/block/loop6/uevent': Permission denied 419s loop7: Failed to write 'change' to '/sys/devices/virtual/block/loop7/uevent': Permission denied 420s Processing triggers for ufw (0.36.2-5) ... 420s Processing triggers for systemd (255.4-1ubuntu5) ... 420s Processing triggers for install-info (7.1-3build1) ... 420s Processing triggers for libc-bin (2.39-0ubuntu6) ... 420s Processing triggers for initramfs-tools (0.142ubuntu23) ... 422s Reading package lists... 422s Building dependency tree... 422s Reading state information... 423s The following packages will be REMOVED: 423s linux-headers-6.8.0-11* python3-distutils* python3-lib2to3* 423s 0 upgraded, 0 newly installed, 3 to remove and 1 not upgraded. 423s After this operation, 86.5 MB disk space will be freed. 423s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 78647 files and directories currently installed.) 423s Removing linux-headers-6.8.0-11 (6.8.0-11.11) ... 424s Removing python3-distutils (3.12.2-3ubuntu1.1) ... 424s Removing python3-lib2to3 (3.12.2-3ubuntu1.1) ... 426s autopkgtest [19:14:11]: rebooting testbed after setup commands that affected boot 495s Reading package lists... 496s Building dependency tree... 496s Reading state information... 496s Starting pkgProblemResolver with broken count: 0 496s Starting 2 pkgProblemResolver with broken count: 0 496s Done 497s The following additional packages will be installed: 497s pyfastx python3-importlib-metadata python3-more-itertools python3-pyfaidx 497s python3-pyfastx python3-zipp 497s Recommended packages: 497s python3-biopython 497s The following NEW packages will be installed: 497s autopkgtest-satdep pyfastx python3-importlib-metadata python3-more-itertools 497s python3-pyfaidx python3-pyfastx python3-zipp 497s 0 upgraded, 7 newly installed, 0 to remove and 1 not upgraded. 497s Need to get 292 kB/293 kB of archives. 497s After this operation, 881 kB of additional disk space will be used. 497s Get:1 /tmp/autopkgtest.1a9z0X/2-autopkgtest-satdep.deb autopkgtest-satdep armhf 0 [708 B] 497s Get:2 http://ftpmaster.internal/ubuntu noble/main armhf python3-more-itertools all 10.2.0-1 [52.9 kB] 497s Get:3 http://ftpmaster.internal/ubuntu noble/main armhf python3-zipp all 1.0.0-6 [6090 B] 497s Get:4 http://ftpmaster.internal/ubuntu noble/main armhf python3-importlib-metadata all 4.12.0-1 [17.8 kB] 497s Get:5 http://ftpmaster.internal/ubuntu noble/universe armhf python3-pyfaidx all 0.8.1.1-1 [29.6 kB] 497s Get:6 http://ftpmaster.internal/ubuntu noble/universe armhf python3-pyfastx armhf 2.0.2-2 [63.5 kB] 497s Get:7 http://ftpmaster.internal/ubuntu noble/universe armhf pyfastx armhf 2.0.2-2 [123 kB] 498s Fetched 292 kB in 0s (590 kB/s) 498s Selecting previously unselected package python3-more-itertools. 498s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 58436 files and directories currently installed.) 498s Preparing to unpack .../0-python3-more-itertools_10.2.0-1_all.deb ... 498s Unpacking python3-more-itertools (10.2.0-1) ... 498s Selecting previously unselected package python3-zipp. 498s Preparing to unpack .../1-python3-zipp_1.0.0-6_all.deb ... 498s Unpacking python3-zipp (1.0.0-6) ... 498s Selecting previously unselected package python3-importlib-metadata. 498s Preparing to unpack .../2-python3-importlib-metadata_4.12.0-1_all.deb ... 498s Unpacking python3-importlib-metadata (4.12.0-1) ... 498s Selecting previously unselected package python3-pyfaidx. 498s Preparing to unpack .../3-python3-pyfaidx_0.8.1.1-1_all.deb ... 498s Unpacking python3-pyfaidx (0.8.1.1-1) ... 498s Selecting previously unselected package python3-pyfastx. 498s Preparing to unpack .../4-python3-pyfastx_2.0.2-2_armhf.deb ... 498s Unpacking python3-pyfastx (2.0.2-2) ... 498s Selecting previously unselected package pyfastx. 498s Preparing to unpack .../5-pyfastx_2.0.2-2_armhf.deb ... 498s Unpacking pyfastx (2.0.2-2) ... 498s Selecting previously unselected package autopkgtest-satdep. 498s Preparing to unpack .../6-2-autopkgtest-satdep.deb ... 498s Unpacking autopkgtest-satdep (0) ... 498s Setting up python3-more-itertools (10.2.0-1) ... 498s Setting up python3-zipp (1.0.0-6) ... 498s Setting up python3-importlib-metadata (4.12.0-1) ... 499s Setting up python3-pyfaidx (0.8.1.1-1) ... 499s Setting up python3-pyfastx (2.0.2-2) ... 499s Setting up pyfastx (2.0.2-2) ... 499s Setting up autopkgtest-satdep (0) ... 499s Processing triggers for man-db (2.12.0-3build4) ... 511s (Reading database ... 58532 files and directories currently installed.) 511s Removing autopkgtest-satdep (0) ... 522s autopkgtest [19:15:47]: test test-cli: [----------------------- 524s $ pyfastx --help 524s usage: pyfastx COMMAND [OPTIONS] 524s 524s A command line tool for FASTA/Q file manipulation 524s 524s options: 524s -h, --help show this help message and exit 524s -v, --version show program's version number and exit 524s 524s Commands: 524s 524s index build index for fasta/q file 524s stat show detailed statistics information of fasta/q file 524s split split fasta/q file into multiple files 524s fq2fa convert fastq file to fasta file 524s subseq get subsequences from fasta file by region 524s sample randomly sample sequences from fasta or fastq file 524s extract extract full sequences or reads from fasta/q file 524s $ # Found pyfastx commands: 'index stat split fq2fa subseq sample extract' 524s $ pyfastx index --help 524s usage: pyfastx index [-h] [-f] fastx [fastx ...] 524s 524s positional arguments: 524s fastx fasta or fastq file, gzip support 524s 524s options: 524s -h, --help show this help message and exit 524s -f, --full build full index, base composition will be calculated 524s $ pyfastx stat --help 524s usage: pyfastx stat [-h] fastx [fastx ...] 524s 524s positional arguments: 524s fastx fasta or fastq file, gzip support 524s 524s options: 524s -h, --help show this help message and exit 524s $ pyfastx split --help 524s usage: pyfastx split [-h] (-n int | -c int) [-o str] fastx 524s 524s positional arguments: 524s fastx fasta or fastq file, gzip support 524s 524s options: 524s -h, --help show this help message and exit 524s -n int split a fasta/q file into N new files with even size 524s -c int split a fasta/q file into multiple files containing 524s the same sequence counts 524s -o str, --out-dir str 524s output directory, default is current folder 524s $ pyfastx fq2fa --help 524s usage: pyfastx fq2fa [-h] [-o str] fastx 524s 524s positional arguments: 524s fastx fastq file, gzip support 524s 524s options: 524s -h, --help show this help message and exit 524s -o str, --out-file str 524s output file, default: output to stdout 524s $ pyfastx subseq --help 524s usage: pyfastx subseq [-h] [-r str | -b str] [-o str] fastx [region ...] 524s 524s positional arguments: 524s fastx input fasta file, gzip support 524s region format is chr:start-end, start and end position is 524s 1-based, multiple regions were separated by space 524s 524s options: 524s -h, --help show this help message and exit 524s -r str, --region-file str 524s tab-delimited file, one region per line, both start 524s and end position are 1-based 524s -b str, --bed-file str 524s tab-delimited BED file, 0-based start position and 524s 1-based end position 524s -o str, --out-file str 524s output file, default: output to stdout 524s $ pyfastx sample --help 524s usage: pyfastx sample [-h] (-n int | -p float) [-s int] [--sequential-read] 524s [-o str] 524s fastx 524s 524s positional arguments: 524s fastx fasta or fastq file, gzip support 524s 524s options: 524s -h, --help show this help message and exit 524s -n int number of sequences to be sampled 524s -p float proportion of sequences to be sampled, 0~1 524s -s int, --seed int random seed, default is the current system time 524s --sequential-read start sequential reading, particularly suitable for 524s sampling large numbers of sequences 524s -o str, --out-file str 524s output file, default: output to stdout 524s $ pyfastx extract --help 525s usage: pyfastx extract [-h] [-l str] [--reverse-complement] [--out-fasta] 525s [-o str] [--sequential-read] 525s fastx [name ...] 525s 525s positional arguments: 525s fastx fasta or fastq file, gzip support 525s name sequence name or read name, multiple names were 525s separated by space 525s 525s options: 525s -h, --help show this help message and exit 525s -l str, --list-file str 525s a file containing sequence or read names, one name per 525s line 525s --reverse-complement output reverse complement sequence 525s --out-fasta output fasta format when extract reads from fastq, 525s default output fastq format 525s -o str, --out-file str 525s output file, default: output to stdout 525s --sequential-read start sequential reading, particularly suitable for 525s extracting large numbers of sequences 525s $ pyfastx --version 525s pyfastx version 2.0.2 525s $ pyfastx index protein.fa 525s $ pyfastx index rna.fa 525s $ pyfastx index test.fa 525s $ pyfastx index test.fq 525s $ pyfastx index test.fa.gz 525s $ pyfastx index test.fq.gz 525s $ pyfastx stat protein.fa 526s fileName seqType seqCounts totalBases GC% avgLen medianLen maxLen minLen N50 L50 526s protein.fa protein 17 2265 - 133.235 80.0 419 23 263 4 526s $ pyfastx split -n 2 protein.fa 526s $ pyfastx fq2fa test.fq -o test.fa 526s $ pyfastx subseq protein.fa UPI0000000011:1-4 526s >UPI0000000011:1-4 526s MVDA 526s $ pyfastx sample -n 1 test.fq.gz -o sample.fq 526s $ pyfastx extract protein.fa UPI0000000011 526s >UPI0000000011 status=active 526s MVDAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIY 526s IPGTIILYATYVKSLLMKS 527s autopkgtest [19:15:52]: test test-cli: -----------------------] 530s test-cli PASS 530s autopkgtest [19:15:55]: test test-cli: - - - - - - - - - - results - - - - - - - - - - 534s autopkgtest [19:15:59]: @@@@@@@@@@@@@@@@@@@@ summary 534s run-unit-test PASS 534s test-cli PASS