0s autopkgtest [20:56:47]: starting date and time: 2024-03-13 20:56:47+0000 0s autopkgtest [20:56:47]: git checkout: b506e79c ssh-setup/nova: fix ARCH having two lines of data 0s autopkgtest [20:56:47]: host juju-7f2275-prod-proposed-migration-environment-3; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.v6p1tep5/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --apt-pocket=proposed=src:fftw3,src:openmpi,src:pmix --apt-upgrade glam2 --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=fftw3/3.3.10-1ubuntu2 openmpi/4.1.6-5.1ubuntu3 pmix/5.0.1-4.1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-3@bos03-arm64-12.secgroup --name adt-noble-arm64-glam2-20240313-205647-juju-7f2275-prod-proposed-migration-environment-3 --image adt/ubuntu-noble-arm64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-3 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/ 100s autopkgtest [20:58:27]: testbed dpkg architecture: arm64 101s autopkgtest [20:58:28]: testbed apt version: 2.7.12 101s autopkgtest [20:58:28]: @@@@@@@@@@@@@@@@@@@@ test bed setup 101s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 101s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [4812 B] 101s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [2820 kB] 102s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [42.3 kB] 102s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [450 kB] 102s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 Packages [603 kB] 102s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 c-n-f Metadata [3144 B] 102s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 Packages [20.3 kB] 102s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 c-n-f Metadata [116 B] 102s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 Packages [3215 kB] 102s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 c-n-f Metadata [8528 B] 102s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 Packages [41.7 kB] 102s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 c-n-f Metadata [116 B] 104s Fetched 7326 kB in 2s (4592 kB/s) 104s Reading package lists... 108s Reading package lists... 108s Building dependency tree... 108s Reading state information... 109s Calculating upgrade... 110s The following packages will be upgraded: 110s console-setup console-setup-linux keyboard-configuration 110s 3 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 110s Need to get 2202 kB of archives. 110s After this operation, 2048 B of additional disk space will be used. 110s Get:1 http://ftpmaster.internal/ubuntu noble/main arm64 console-setup-linux all 1.226ubuntu1 [1880 kB] 110s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 console-setup all 1.226ubuntu1 [110 kB] 110s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 keyboard-configuration all 1.226ubuntu1 [212 kB] 112s Preconfiguring packages ... 113s Fetched 2202 kB in 1s (2788 kB/s) 113s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 74759 files and directories currently installed.) 113s Preparing to unpack .../console-setup-linux_1.226ubuntu1_all.deb ... 114s Unpacking console-setup-linux (1.226ubuntu1) over (1.223ubuntu2) ... 114s Preparing to unpack .../console-setup_1.226ubuntu1_all.deb ... 114s Unpacking console-setup (1.226ubuntu1) over (1.223ubuntu2) ... 114s Preparing to unpack .../keyboard-configuration_1.226ubuntu1_all.deb ... 115s Unpacking keyboard-configuration (1.226ubuntu1) over (1.223ubuntu2) ... 115s Setting up keyboard-configuration (1.226ubuntu1) ... 116s Your console font configuration will be updated the next time your system 116s boots. If you want to update it now, run 'setupcon' from a virtual console. 116s update-initramfs: deferring update (trigger activated) 116s Setting up console-setup-linux (1.226ubuntu1) ... 118s Setting up console-setup (1.226ubuntu1) ... 119s update-initramfs: deferring update (trigger activated) 119s Processing triggers for man-db (2.12.0-3) ... 120s Processing triggers for initramfs-tools (0.142ubuntu20) ... 120s update-initramfs: Generating /boot/initrd.img-6.8.0-11-generic 120s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 163s System running in EFI mode, skipping. 164s Reading package lists... 164s Building dependency tree... 164s Reading state information... 165s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 166s Hit:1 http://ftpmaster.internal/ubuntu noble InRelease 166s Hit:2 http://ftpmaster.internal/ubuntu noble-updates InRelease 166s Hit:3 http://ftpmaster.internal/ubuntu noble-security InRelease 166s Hit:4 http://ftpmaster.internal/ubuntu noble-proposed InRelease 169s Reading package lists... 169s Reading package lists... 169s Building dependency tree... 169s Reading state information... 170s Calculating upgrade... 171s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 171s Reading package lists... 171s Building dependency tree... 171s Reading state information... 172s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 173s autopkgtest [20:59:40]: rebooting testbed after setup commands that affected boot 480s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 488s autopkgtest [21:04:55]: testbed running kernel: Linux 6.8.0-11-generic #11-Ubuntu SMP PREEMPT_DYNAMIC Wed Feb 14 02:53:31 UTC 2024 490s autopkgtest [21:04:57]: @@@@@@@@@@@@@@@@@@@@ apt-source glam2 493s Get:1 http://ftpmaster.internal/ubuntu noble/universe glam2 1064-9 (dsc) [2006 B] 493s Get:2 http://ftpmaster.internal/ubuntu noble/universe glam2 1064-9 (tar) [238 kB] 493s Get:3 http://ftpmaster.internal/ubuntu noble/universe glam2 1064-9 (diff) [12.6 kB] 493s gpgv: Signature made Mon Dec 7 21:41:36 2020 UTC 493s gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 493s gpgv: issuer "tille@debian.org" 493s gpgv: Can't check signature: No public key 493s dpkg-source: warning: cannot verify inline signature for ./glam2_1064-9.dsc: no acceptable signature found 493s autopkgtest [21:05:00]: testing package glam2 version 1064-9 493s autopkgtest [21:05:00]: build not needed 494s autopkgtest [21:05:01]: test check-no-args: preparing testbed 495s Reading package lists... 496s Building dependency tree... 496s Reading state information... 496s Starting pkgProblemResolver with broken count: 0 496s Starting 2 pkgProblemResolver with broken count: 0 496s Done 497s The following additional packages will be installed: 497s glam2 libfftw3-double3 libgomp1 497s Suggested packages: 497s libfftw3-bin libfftw3-dev 497s The following NEW packages will be installed: 497s autopkgtest-satdep glam2 libfftw3-double3 libgomp1 497s 0 upgraded, 4 newly installed, 0 to remove and 0 not upgraded. 497s Need to get 757 kB/758 kB of archives. 497s After this operation, 1828 kB of additional disk space will be used. 497s Get:1 /tmp/autopkgtest.cG1nAY/1-autopkgtest-satdep.deb autopkgtest-satdep arm64 0 [700 B] 497s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 libgomp1 arm64 14-20240303-1ubuntu1 [144 kB] 497s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 libfftw3-double3 arm64 3.3.10-1ubuntu2 [384 kB] 497s Get:4 http://ftpmaster.internal/ubuntu noble/universe arm64 glam2 arm64 1064-9 [228 kB] 498s Fetched 757 kB in 1s (1373 kB/s) 498s Selecting previously unselected package libgomp1:arm64. 498s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 74759 files and directories currently installed.) 498s Preparing to unpack .../libgomp1_14-20240303-1ubuntu1_arm64.deb ... 498s Unpacking libgomp1:arm64 (14-20240303-1ubuntu1) ... 498s Selecting previously unselected package libfftw3-double3:arm64. 498s Preparing to unpack .../libfftw3-double3_3.3.10-1ubuntu2_arm64.deb ... 498s Unpacking libfftw3-double3:arm64 (3.3.10-1ubuntu2) ... 498s Selecting previously unselected package glam2. 498s Preparing to unpack .../glam2_1064-9_arm64.deb ... 498s Unpacking glam2 (1064-9) ... 498s Selecting previously unselected package autopkgtest-satdep. 498s Preparing to unpack .../1-autopkgtest-satdep.deb ... 498s Unpacking autopkgtest-satdep (0) ... 498s Setting up libgomp1:arm64 (14-20240303-1ubuntu1) ... 498s Setting up libfftw3-double3:arm64 (3.3.10-1ubuntu2) ... 498s Setting up glam2 (1064-9) ... 498s Setting up autopkgtest-satdep (0) ... 498s Processing triggers for man-db (2.12.0-3) ... 498s Processing triggers for libc-bin (2.39-0ubuntu2) ... 502s (Reading database ... 74813 files and directories currently installed.) 502s Removing autopkgtest-satdep (0) ... 503s autopkgtest [21:05:10]: test check-no-args: [----------------------- 503s Usage: glam2 [options] alphabet my_seqs.fa 503s Alphabets: p = proteins, n = nucleotides, other = alphabet file 503s Options (default settings): 503s -h: show all options and their default settings 503s -o: output file (stdout) 503s -r: number of alignment runs (10) 503s -n: end each run after this many iterations without improvement (10000) 503s -2: examine both strands - forward and reverse complement 503s -z: minimum number of sequences in the alignment (2) 503s -a: minimum number of aligned columns (2) 503s -b: maximum number of aligned columns (50) 503s -w: initial number of aligned columns (20) 503s -d: Dirichlet mixture file 503s -D: deletion pseudocount (0.1) 503s -E: no-deletion pseudocount (2.0) 503s -I: insertion pseudocount (0.02) 503s -J: no-insertion pseudocount (1.0) 503s -q: weight for generic versus sequence-set-specific residue abundances (1e+99) 503s -t: initial temperature (1.2) 503s -c: cooling factor per n iterations (1.44) 503s -u: temperature lower bound (0.1) 503s -p: print progress information at each iteration 503s -m: column-sampling moves per site-sampling move (1.0) 503s -x: site sampling algorithm: 0=FAST 1=SLOW 2=FFT (0) 503s -s: seed for pseudo-random numbers (1) 503s SUCCESS: Help text is there! 504s autopkgtest [21:05:11]: test check-no-args: -----------------------] 504s check-no-args PASS 504s autopkgtest [21:05:11]: test check-no-args: - - - - - - - - - - results - - - - - - - - - - 505s autopkgtest [21:05:11]: test run-unit-test: preparing testbed 507s Reading package lists... 507s Building dependency tree... 507s Reading state information... 507s Starting pkgProblemResolver with broken count: 0 507s Starting 2 pkgProblemResolver with broken count: 0 507s Done 508s The following NEW packages will be installed: 508s autopkgtest-satdep 508s 0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. 508s Need to get 0 B/700 B of archives. 508s After this operation, 0 B of additional disk space will be used. 508s Get:1 /tmp/autopkgtest.cG1nAY/2-autopkgtest-satdep.deb autopkgtest-satdep arm64 0 [700 B] 509s Selecting previously unselected package autopkgtest-satdep. 509s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 74813 files and directories currently installed.) 509s Preparing to unpack .../2-autopkgtest-satdep.deb ... 509s Unpacking autopkgtest-satdep (0) ... 509s Setting up autopkgtest-satdep (0) ... 514s (Reading database ... 74813 files and directories currently installed.) 514s Removing autopkgtest-satdep (0) ... 514s autopkgtest [21:05:21]: test run-unit-test: [----------------------- 515s Run 1... 12350 iterations 516s Run 2... 17270 iterations 517s Run 3... 19781 iterations 518s Run 4... 12220 iterations 519s Run 5... 18950 iterations 520s Run 6... 15650 iterations 522s Run 7... 31104 iterations 523s Run 8... 21854 iterations 524s Run 9... 11813 iterations 525s Run 10... 11182 iterations 525s 525s GLAM2: Gapped Local Alignment of Motifs 525s Version 1064 525s 525s glam2 p lipocalin.s 525s Sequences: 5 525s Greatest sequence length: 189 525s Residue counts: A=65 C=26 D=62 E=70 F=39 G=52 H=23 I=43 K=78 L=79 M=16 N=48 P=29 Q=26 R=28 S=53 T=43 V=63 W=15 Y=45 x=0 525s 525s Score: 80.3660 Columns: 20 Sequences: 5 525s 525s ******************** 525s ICYA_MANSE 13 KPVNDFDLSAFAGAWHEIAK 32 + 33.3 525s LACB_BOVIN 21 QTMKGLDIQKVAGTWYSLAM 40 + 18.8 525s BBP_PIEBR 12 KPVDNFDWSNYHGKWWEVAK 31 + 27.9 525s RETB_BOVIN 10 RVKENFDKARFAGTWYAMAK 29 + 25.5 525s MUP2_MOUSE 23 STGRNFNVEKINGEWHTIIL 42 + 13.4 525s 525s KPVDNFDISKFAGTWHEIAK 525s QTGEDLNKAAIH A YALIL 525s RVKKG LENVN E WSM M 525s S MN VQRY K TV 525s R W 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 2 0 0 0 0 1 1 1 0 0 0 0 0 1.51 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 2 1 0 0 0 1.06 525s 0 -0.0655 525s 0 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 2 0 0 0 -2.00 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0.233 525s 0 -0.0655 525s 0 0 1 0 0 1 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 4.91 525s 0 -0.0655 525s 0 0 0 0 4 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 9.87 525s 0 -0.0655 525s 0 0 4 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 9.08 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 1 1 0 0 -1.61 525s 0 -0.0655 525s 1 0 0 1 0 0 0 0 0 0 0 0 0 1 0 2 0 0 0 0 0 -0.0557 525s 0 -0.0655 525s 1 0 0 0 0 0 0 0 2 0 0 1 0 0 1 0 0 0 0 0 0 0.836 525s 0 -0.0655 525s 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 1 0 1 0 2.40 525s 0 -0.0655 525s 3 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1.35 525s 0 -0.0655 525s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9 525s 0 -0.0655 525s 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 2 0 0 0 0 0.355 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 22.5 525s 0 -0.0655 525s 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 2 0 7.34 525s 0 -0.0655 525s 1 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 -0.00544 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 5.12 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0 0 0 1.70 525s 525s Score: 80.3660 Columns: 20 Sequences: 5 525s 525s ******************** 525s ICYA_MANSE 13 KPVNDFDLSAFAGAWHEIAK 32 + 33.3 525s LACB_BOVIN 21 QTMKGLDIQKVAGTWYSLAM 40 + 18.8 525s BBP_PIEBR 12 KPVDNFDWSNYHGKWWEVAK 31 + 27.9 525s RETB_BOVIN 10 RVKENFDKARFAGTWYAMAK 29 + 25.5 525s MUP2_MOUSE 23 STGRNFNVEKINGEWHTIIL 42 + 13.4 525s 525s KPVDNFDISKFAGTWHEIAK 525s QTGEDLNKAAIH A YALIL 525s RVKKG LENVN E WSM M 525s S MN VQRY K TV 525s R W 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 2 0 0 0 0 1 1 1 0 0 0 0 0 1.51 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 2 1 0 0 0 1.06 525s 0 -0.0655 525s 0 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 2 0 0 0 -2.00 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0.233 525s 0 -0.0655 525s 0 0 1 0 0 1 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 4.91 525s 0 -0.0655 525s 0 0 0 0 4 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 9.87 525s 0 -0.0655 525s 0 0 4 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 9.08 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 1 1 0 0 -1.61 525s 0 -0.0655 525s 1 0 0 1 0 0 0 0 0 0 0 0 0 1 0 2 0 0 0 0 0 -0.0557 525s 0 -0.0655 525s 1 0 0 0 0 0 0 0 2 0 0 1 0 0 1 0 0 0 0 0 0 0.836 525s 0 -0.0655 525s 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 1 0 1 0 2.40 525s 0 -0.0655 525s 3 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1.35 525s 0 -0.0655 525s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9 525s 0 -0.0655 525s 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 2 0 0 0 0 0.355 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 22.5 525s 0 -0.0655 525s 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 2 0 7.34 525s 0 -0.0655 525s 1 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 -0.00544 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 5.12 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0 0 0 1.70 525s 525s Score: 80.3660 Columns: 20 Sequences: 5 525s 525s ******************** 525s ICYA_MANSE 13 KPVNDFDLSAFAGAWHEIAK 32 + 33.3 525s LACB_BOVIN 21 QTMKGLDIQKVAGTWYSLAM 40 + 18.8 525s BBP_PIEBR 12 KPVDNFDWSNYHGKWWEVAK 31 + 27.9 525s RETB_BOVIN 10 RVKENFDKARFAGTWYAMAK 29 + 25.5 525s MUP2_MOUSE 23 STGRNFNVEKINGEWHTIIL 42 + 13.4 525s 525s KPVDNFDISKFAGTWHEIAK 525s QTGEDLNKAAIH A YALIL 525s RVKKG LENVN E WSM M 525s S MN VQRY K TV 525s R W 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 2 0 0 0 0 1 1 1 0 0 0 0 0 1.51 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 2 1 0 0 0 1.06 525s 0 -0.0655 525s 0 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 2 0 0 0 -2.00 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0.233 525s 0 -0.0655 525s 0 0 1 0 0 1 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 4.91 525s 0 -0.0655 525s 0 0 0 0 4 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 9.87 525s 0 -0.0655 525s 0 0 4 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 9.08 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 1 1 0 0 -1.61 525s 0 -0.0655 525s 1 0 0 1 0 0 0 0 0 0 0 0 0 1 0 2 0 0 0 0 0 -0.0557 525s 0 -0.0655 525s 1 0 0 0 0 0 0 0 2 0 0 1 0 0 1 0 0 0 0 0 0 0.836 525s 0 -0.0655 525s 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 1 0 1 0 2.40 525s 0 -0.0655 525s 3 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1.35 525s 0 -0.0655 525s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9 525s 0 -0.0655 525s 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 2 0 0 0 0 0.355 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 22.5 525s 0 -0.0655 525s 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 2 0 7.34 525s 0 -0.0655 525s 1 0 0 2 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 -0.00544 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 5.12 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0 0 0 1.70 525s 525s Score: 77.3362 Columns: 21 Sequences: 5 525s 525s ********************* 525s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 525s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 525s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 525s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 525s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 525s 525s NDFHWVLDTDYKNYAIAYLCN 525s KVL IIA NDKFLLFCMED 525s LDN PK ET IMGHNIK 525s T P S VN S R 525s V T Q Y 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 525s Score: 77.3362 Columns: 21 Sequences: 5 525s 525s ********************* 525s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 525s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 525s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 525s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 525s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 525s 525s NDFHWVLDTDYKNYAIAYLCN 525s KVL IIA NDKFLLFCMED 525s LDN PK ET IMGHNIK 525s T P S VN S R 525s V T Q Y 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 525s Score: 77.3362 Columns: 21 Sequences: 5 525s 525s ********************* 525s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 525s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 525s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 525s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 525s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 525s 525s NDFHWVLDTDYKNYAIAYLCN 525s KVL IIA NDKFLLFCMED 525s LDN PK ET IMGHNIK 525s T P S VN S R 525s V T Q Y 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 525s Score: 77.3362 Columns: 21 Sequences: 5 525s 525s ********************* 525s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCD 120 + 37.8 525s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMEN 125 + 20.1 525s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCK 116 + 27.2 525s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCR 121 + 26.7 525s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLIN 125 + 18.6 525s 525s NDFHWVLDTDYKNYAIAYLCN 525s KVL IIA NDKFLLFCMED 525s LDN PK ET IMGHNIK 525s T P S VN S R 525s V T Q Y 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 525s Score: 75.7471 Columns: 26 Sequences: 5 525s 525s ************************** 525s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCDYHPDK 125 + 40.6 525s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMENSAEPE 130 + 20.6 525s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCKYDEDK 121 + 32.0 525s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCRLLNLD 126 + 20.6 525s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLINEKDGE 130 + 18.1 525s 525s NDFHWVLDTDYKNYAIAYLCNYAEDE 525s KVL IIA NDKFLLFCMEDEDDGK 525s LDN PK ET IMGHNIKLHNLD 525s T P S VN S RSKPP 525s V T Q Y L 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 0 -0.0655 525s 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 -0.975 525s 0 -0.0655 525s 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 -2.88 525s 0 -0.0655 525s 0 0 1 2 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 1.18 525s 0 -0.0655 525s 0 0 2 0 0 1 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 -2.32 525s 0 -0.0655 525s 0 0 1 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 3.72 525s 525s Score: 75.7471 Columns: 26 Sequences: 5 525s 525s ************************** 525s ICYA_MANSE 100 NLVPWVLATDYKNYAINYNCDYHPDK 125 + 40.6 525s LACB_BOVIN 106 NKVL.VLDTDYKKYLLFCMENSAEPE 130 + 20.6 525s BBP_PIEBR 97 NVFN.VLSTDNKNYIIGYYCKYDEDK 121 + 32.0 525s RETB_BOVIN 101 NDDHWIIDTDYETFAVQYSCRLLNLD 126 + 20.6 525s MUP2_MOUSE 106 NTFT.IPKTDYDNFLMAHLINEKDGE 130 + 18.1 525s 525s NDFHWVLDTDYKNYAIAYLCNYAEDE 525s KVL IIA NDKFLLFCMEDEDDGK 525s LDN PK ET IMGHNIKLHNLD 525s T P S VN S RSKPP 525s V T Q Y L 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s Run 1... 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 0 -0.0655 525s 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 -0.975 525s 0 -0.0655 525s 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 -2.88 525s 0 -0.0655 525s 0 0 1 2 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 1.18 525s 0 -0.0655 525s 0 0 2 0 0 1 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 -2.32 525s 0 -0.0655 525s 0 0 1 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 3.72 525s 525s Score: 73.5314 Columns: 41 Sequences: 5 525s 525s ********.*******.......************************** 525s ICYA_MANSE 81 KYTKQGKY.VMTFK.FGQRVV..NLVPWVLATDYKNYAINYNCDYHPDK 125 + 38.9 525s LACB_BOVIN 91 KTKIPAVF.KIDALNE.......NKVL.VLDTDYKKYLLFCMENSAEPE 130 + 21.8 525s BBP_PIEBR 78 DSKIGKIYHKLTYGGVTKE....NVFN.VLSTDNKNYIIGYYCKYDEDK 121 + 32.8 525s RETB_BOVIN 79 DTEDPAKF.KMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLD 126 + 34.1 525s MUP2_MOUSE 91 KTEKAGEY.SVTYDGF.......NTFT.IPKTDYDNFLMAHLINEKDGE 130 + 33.6 525s 525s KTEIPAKY KMTYDGF NDFHWVLDTDYKNYAIAYLCNYAEDE 525s DSKKAGEF SIDAGNV KVL IIA NDKFLLFCMEDEDDGK 525s YTDGKI VLKFK E LDN PK ET IMGHNIKLHNLD 525s Q V V L T P S VN S RSKPP 525s W V T Q Y L 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 0 0 2 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 5.22 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 3 0 0 1 0 2.46 525s 0 -0.0655 525s 0 0 0 2 0 0 0 0 2 0 0 0 0 0 0 0 1 0 0 0 0 2.94 525s 0 -0.0655 525s 0 0 1 0 0 0 0 2 2 0 0 0 0 0 0 0 0 0 0 0 0 0.216 525s 0 -0.0655 525s 1 0 0 0 0 1 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 -1.06 525s 0 -0.0655 525s 2 0 0 0 0 2 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0.824 525s 0 -0.0655 525s 0 0 0 1 0 0 0 1 2 0 0 0 0 0 0 0 0 1 0 0 0 -0.808 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 1 -8.30 525s 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 1 0 1 0 0 0 1.49 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 1 2 0 0 0 0 0 0 1 0 0 0 4.57 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 0 0 0 0 0 3 0 0 0 0 2.41 525s 0 -0.0655 525s 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.65 525s 0 -0.0655 525s 0 0 1 0 0 1 0 0 1 1 0 0 0 0 0 0 0 0 1 0 0 -4.16 525s 0 -0.0655 525s 0 0 0 0 0 3 0 0 0 0 0 1 0 0 0 0 0 0 0 0 1 -1.19 525s 0 -0.0655 525s 0 0 0 1 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.743 525s 15 -23.5 525s 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 14.2 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 1 1 0 0 0 -3.28 525s 0 -0.0655 525s 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0.278 525s 0 -0.0655 525s 0 0 0 0 0 0 1 0 0 1 0 1 1 0 0 0 1 0 0 0 0 -2.97 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 3 -4.19 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 3 0 0 0 8.67 525s 0 -0.0655 525s 0 0 0 0 0 0 0 1 0 3 0 0 1 0 0 0 0 0 0 0 0 1.58 525s 0 -0.0655 525s 1 0 2 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0.395 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 12.2 525s 0 -0.0655 525s 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 8.89 525s 0 -0.0655 525s 0 0 1 1 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 4.07 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 1 0 0 3 0 0 0 0 1 0 0 0 0 3.33 525s 0 -0.0655 525s 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 11.1 525s 0 -0.0655 525s 2 0 0 0 0 0 0 1 0 2 0 0 0 0 0 0 0 0 0 0 0 2.04 525s 0 -0.0655 525s 0 0 0 0 0 0 0 2 0 1 1 0 0 0 0 0 0 1 0 0 0 4.05 525s 0 -0.0655 525s 1 0 0 0 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 -3.34 525s 0 -0.0655 525s 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 3 0 5.78 525s 0 -0.0655 525s 0 0 0 0 0 0 0 0 0 1 1 1 0 0 0 1 0 0 0 1 0 -2.50 525s 0 -0.0655 525s 0 3 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2.99 525s 0 -0.0655 525s 0 0 1 0 0 0 0 0 1 0 0 2 0 0 1 0 0 0 0 0 0 1.52 525s 0 -0.0655 525s 0 0 0 1 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 -0.975 525s 0 -0.0655 525s 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0 0 0 0 0 0 0 -2.88 525s 0 -0.0655 525s 0 0 1 2 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 1.18 525s 0 -0.0655 525s 0 0 2 0 0 1 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 -2.32 525s 0 -0.0655 525s 0 0 1 2 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 3.72 525s 525s 4122 iterations 525s 525s GLAM2: Gapped Local Alignment of Motifs 525s Version 1064 525s 525s glam2 -r 1 -n 1000 p crp0.s 525s Sequences: 18 525s Greatest sequence length: 105 525s Residue counts: A=572 C=345 D=0 E=0 F=0 G=395 H=0 I=0 K=0 L=0 M=0 N=0 P=0 Q=0 R=0 S=0 T=578 V=0 W=0 Y=0 x=0 525s 525s Score: 1431.87 Columns: 46 Sequences: 18 525s 525s *********.......*****.................********...............********........***.........****..********* 525s ce1cg 31 GCGAGAATAG......CGCGTGGTG.............TGAAAGACTGTTTTTTTGATCGTTTTCACAAAAA.....TGGAA.......GTCC..ACAGTCTTG 101 + 95.1 525s ara 31 TCACGGCAGAAAAGTCCACATTGATTATT.........TGCACGGCG..............TCACACTT........TGCTA.......TGCC..ATAGCATTT 94 + 114. 525s bglr1 37 ATATAACTTTATAAA.TTCCTAAAAT............TACACAAA...............GTTAATAAC.......TGTG........AGCAT.GGTCATATT 96 + 99.8 525s crp 46 ACATTGATG.......TACTGCATG.............TATGCAAAGGACG..........TCACATTACCG.....TGCAG.......TACA..GTTGATAGC 105 + 109. 525s cya 1 ACGGTGCTA.......CACTTG................TATGTAGCGCATC..........TTTCTTTACGG.....TCA.........ATCA..GCAAGGTGT 55 + 109. 525s deop2 18 AGATCGCAT.......TACAGTGATGCAAACTTG....TAAGTAGA...............TTTCCTTAAT......TGTGATGTG...TATC..GAAGTGTGT 84 + 105. 525s gale 10 AAACGGCTAAA.....TTCTTG................TGTAAACGA..............TTCCACTAATTTAT..TCCA........TGTC..ACACTTTTC 66 + 117. 525s ilv 21 TATCTGCAA.......TTCAG.................TACAAAACGTGATCA........ACCCCTCAATTT....TCCCTT......TGCT..GAAAAATTT 80 + 112. 525s lac 16 AGTTAGCTCA......CTCAT.................TAGGCACCCCAGGCT........TTACACTTTA......TGC.........TTCCG.GCTCGTATG 72 + 111. 525s male 4 TTACCGCCAA......TTCTG.................TAACAGAGA..............TCACACAAAGCGACGGTGGGGCGTAGG.GGCAA.GGAGGATGG 68 + 95.1 525s malk 22 ACACGGCTT.......CTGTGAACTAAACCGAGGTCA.TGTAAGGAA..............TTTCGTGA........TGT.........TGCTT.GCAAAAATC 85 + 109. 525s malt 50 ACAGTGCAAA......TTCAGACACA............TAAAAAAAC..............GTCATCGCT.......TGC.........ATTA..GAAAGGTTT 103 + 107. 525s ompa 30 ACAAGACTTTTTT...TTCATA................TGCCTGACGGA............GTTCACACT.......TGTAAGTT....TTCA..ACTACGTTG 89 + 113. 525s tnaa 9 ACATTAAAA.......TTCTTACGTAATTTATAATCTTTAAAAAAAGCA............TTTAATAT........TGC.........TCCCC.GAACGATTG 75 + 109. 525s uxu1 32 AACCCAATTAGAA...TTCGGGATTGACATGTCT....TACCAAAAGGTAGAACTT.....ATACGCCA........TCTC........ATCC..GATGCAAGC 105 + 101. 525s pbr322 12 ATGCGGCAT.......CAGAGCAGATTG..........TACTGAGA...............GTGCACCATA......TGCGGTGTGAAATACC..GCACAGATG 75 + 108. 525s trn9cat 11 AGATCACTT.......CGCAGAA...............TAAATAAATCCTGGT........GTCCCTGT........TGA.........TACCGGGAAGCCCTG 67 + 107. 525s tdc 47 ATAACGATA.......CTCTGGAAAG............TATTGAAA...............GTTAATTTG.......TGAGT.......GGTC..GCACATATC 100 + 107. 525s 525s ACACGGCTA TTCAG TAAAAAAA TTTCACTA TGC TGCC GCAGAATTG 525s T TCAAAT CA TT GCGCGGC GCAA TAT CT ATTA AATCGGAGT 525s T T T C A ACT C 525s 525s A C D E F G H I K L M N P Q R S T V W Y Del Ins Score 525s 14 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 37.3 525s 0 -0.100 525s 3 8 0 0 0 3 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 32.9 525s 0 -0.100 525s 12 1 0 0 0 3 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 29.5 525s 0 -0.100 525s 3 7 0 0 0 2 0 0 0 0 0 0 0 0 0 0 6 0 0 0 0 31.9 525s 0 -0.100 525s 2 5 0 0 0 6 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 26.4 525s 0 -0.100 525s 6 0 0 0 0 12 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 40.1 525s 0 -0.100 525s 5 13 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 62.9 525s 0 -0.100 525s 6 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 34.9 525s 0 -0.100 525s 8 1 0 0 0 2 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 26.2 525s 27 -51.1 525s 0 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 0 0 0 0 52.5 525s 0 -0.100 525s 5 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 32.4 525s 0 -0.100 525s 0 16 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 75.8 525s 0 -0.100 525s 8 1 0 0 0 2 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 26.2 525s 0 -0.100 525s 0 0 0 0 0 10 0 0 0 0 0 0 0 0 0 0 8 0 0 0 0 38.4 525s 102 -82.2 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18 0 0 0 0 64.5 525s 0 -0.100 525s 13 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39.7 525s 0 -0.100 525s 6 6 0 0 0 1 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 31.2 525s 0 -0.100 525s 9 3 0 0 0 4 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 26.2 525s 0 -0.100 525s 8 4 0 0 0 2 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 26.9 525s 0 -0.100 525s 13 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39.7 525s 0 -0.100 525s 11 2 0 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 33.5 525s 0 -0.100 525s 10 6 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39.7 525s 67 -71.8 525s 2 0 0 0 0 6 0 0 0 0 0 0 0 0 0 0 10 0 0 0 0 30.8 525s 0 -0.100 525s 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14 0 0 0 0 49.3 525s 0 -0.100 525s 5 4 0 0 0 1 0 0 0 0 0 0 0 0 0 0 8 0 0 0 0 29.1 525s 0 -0.100 525s 4 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 66.8 525s 0 -0.100 525s 11 3 0 0 0 2 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 29.8 525s 0 -0.100 525s 0 9 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9 0 0 0 0 54.3 525s 0 -0.100 525s 5 3 0 0 0 3 0 0 0 0 0 0 0 0 0 0 7 0 0 0 0 24.3 525s 0 -0.100 525s 11 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 33.0 525s 37 -57.9 525s 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18 0 0 0 0 64.5 525s 0 -0.100 525s 0 4 0 0 0 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 47.7 525s 0 -0.100 525s 3 8 0 0 0 2 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 34.0 525s 42 -60.8 525s 4 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 11 0 0 0 0 31.4 525s 0 -0.100 525s 4 1 0 0 0 7 0 0 0 0 0 0 0 0 0 0 6 0 0 0 0 22.9 525s 0 -0.100 525s 0 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 68.5 525s 0 -0.100 525s 6 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 45.9 525s 7 -27.4 525s 4 0 0 0 0 14 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 43.6 525s 0 -0.100 525s 6 8 0 0 0 2 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 35.2 525s 0 -0.100 525s 13 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 39.1 525s 0 -0.100 525s 5 6 0 0 0 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 35.3 525s 0 -0.100 525s 6 4 0 0 0 5 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 24.4 525s 0 -0.100 525s 6 2 0 0 0 5 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 22.2 525s 0 -0.100 525s 7 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 0 0 0 0 33.9 525s 0 -0.100 525s 0 0 0 0 0 5 0 0 0 0 0 0 0 0 0 0 13 0 0 0 0 40.8 525s 0 -0.100 525s 0 5 0 0 0 7 0 0 0 0 0 0 0 0 0 0 6 0 0 0 0 31.3 525s 525s PASS 526s autopkgtest [21:05:33]: test run-unit-test: -----------------------] 527s autopkgtest [21:05:34]: test run-unit-test: - - - - - - - - - - results - - - - - - - - - - 527s run-unit-test PASS 527s autopkgtest [21:05:34]: @@@@@@@@@@@@@@@@@@@@ summary 527s check-no-args PASS 527s run-unit-test PASS 532s Creating nova instance adt-noble-arm64-glam2-20240313-205647-juju-7f2275-prod-proposed-migration-environment-3 from image adt/ubuntu-noble-arm64-server-20240313.img (UUID 363cdc04-8630-403e-ac93-f1c7b1a75157)...