0s autopkgtest [05:29:35]: starting date and time: 2024-03-26 05:29:35+0000
  0s autopkgtest [05:29:35]: git checkout: 4a1cd702 l/adt_testbed: don't blame the testbed for unsolvable build deps
  0s autopkgtest [05:29:35]: host juju-7f2275-prod-proposed-migration-environment-3; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.tvs557ld/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --setup-commands /home/ubuntu/autopkgtest/setup-commands/setup-testbed --apt-pocket=proposed --apt-upgrade fdroidserver --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=alsa-lib/1.2.11-1build1 at-spi2-core/2.51.90-3 cups/2.4.7-1.2ubuntu1 glib2.0/2.79.3-3ubuntu5 gnutls28/3.8.3-1.1ubuntu2 gtk+3.0/3.24.41-1.1ubuntu3 libpng1.6/1.6.43-3 nettle/3.9.1-2.2 openjdk-23/23~15ea-1 wp2latex/4.4~ds-1build1' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-3@bos03-arm64-17.secgroup --name adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-proposed-migration-environment-3 --image adt/ubuntu-noble-arm64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-3 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://ftpmaster.internal/ubuntu/
367s Creating nova instance adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-proposed-migration-environment-3 from image adt/ubuntu-noble-arm64-server-20240326.img (UUID 2d366976-4689-4c6f-acab-b55163b07c34)...
367s nova boot failed (attempt #1):
367s DEBUG (extension:189) found extension EntryPoint.parse('v1password = swiftclient.authv1:PasswordLoader')
367s DEBUG (extension:189) found extension EntryPoint.parse('noauth = cinderclient.contrib.noauth:CinderNoAuthLoader')
367s DEBUG (extension:189) found extension EntryPoint.parse('admin_token = keystoneauth1.loading._plugins.admin_token:AdminToken')
367s DEBUG (extension:189) found extension EntryPoint.parse('none = keystoneauth1.loading._plugins.noauth:NoAuth')
367s DEBUG (extension:189) found extension EntryPoint.parse('password = keystoneauth1.loading._plugins.identity.generic:Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('token = keystoneauth1.loading._plugins.identity.generic:Token')
367s DEBUG (extension:189) found extension EntryPoint.parse('v2password = keystoneauth1.loading._plugins.identity.v2:Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('v2token = keystoneauth1.loading._plugins.identity.v2:Token')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3adfspassword = keystoneauth1.extras._saml2._loading:ADFSPassword')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3applicationcredential = keystoneauth1.loading._plugins.identity.v3:ApplicationCredential')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3fedkerb = keystoneauth1.extras.kerberos._loading:MappedKerberos')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3kerberos = keystoneauth1.extras.kerberos._loading:Kerberos')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3multifactor = keystoneauth1.loading._plugins.identity.v3:MultiFactor')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oauth1 = keystoneauth1.extras.oauth1._loading:V3OAuth1')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcaccesstoken = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectAccessToken')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcauthcode = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectAuthorizationCode')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcclientcredentials = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectClientCredentials')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcpassword = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectPassword')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3password = keystoneauth1.loading._plugins.identity.v3:Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3samlpassword = keystoneauth1.extras._saml2._loading:Saml2Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3token = keystoneauth1.loading._plugins.identity.v3:Token')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3tokenlessauth = keystoneauth1.loading._plugins.identity.v3:TokenlessAuth')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3totp = keystoneauth1.loading._plugins.identity.v3:TOTP')
367s DEBUG (session:517) REQ: curl -g -i -X GET https://keystone.ps6.canonical.com:5000/v3 -H "Accept: application/json" -H "User-Agent: nova keystoneauth1/4.0.0 python-requests/2.22.0 CPython/3.8.10"
367s DEBUG (connectionpool:962) Starting new HTTPS connection (1): keystone.ps6.canonical.com:5000
367s DEBUG (connectionpool:429) https://keystone.ps6.canonical.com:5000 "GET /v3 HTTP/1.1" 200 267
367s DEBUG (session:548) RESP: [200] Connection: Keep-Alive Content-Length: 267 Content-Type: application/json Date: Tue, 26 Mar 2024 05:29:56 GMT Keep-Alive: timeout=75, max=1000 Server: Apache/2.4.52 (Ubuntu) Vary: X-Auth-Token x-openstack-request-id: req-0ffe6118-4bb1-497d-a798-5e15da12fd32
367s DEBUG (session:580) RESP BODY: {"version": {"id": "v3.14", "status": "stable", "updated": "2020-04-07T00:00:00Z", "links": [{"rel": "self", "href": "https://keystone.ps6.canonical.com:5000/v3/"}], "media-types": [{"base": "application/json", "type": "application/vnd.openstack.identity-v3+json"}]}}
367s DEBUG (session:946) GET call to https://keystone.ps6.canonical.com:5000/v3 used request id req-0ffe6118-4bb1-497d-a798-5e15da12fd32
367s DEBUG (base:182) Making authentication request to https://keystone.ps6.canonical.com:5000/v3/auth/tokens
367s DEBUG (connectionpool:429) https://keystone.ps6.canonical.com:5000 "POST /v3/auth/tokens HTTP/1.1" 201 12445
367s DEBUG (base:187) {"token": {"methods": ["password"], "user": {"domain": {"id": "default", "name": "Default"}, "id": "369f50a481564a2c9433776a4ebd224d", "name": "prod-proposed-migration-arm64", "password_expires_at": null}, "audit_ids": ["HgMNp5GIRKi0ttiN3rGoqg"], "expires_at": "2024-03-27T05:29:57.000000Z", "issued_at": "2024-03-26T05:29:57.000000Z", "project": {"domain": {"id": "default", "name": "Default"}, "id": "bd8b3df3f03d43a0a9303b7c0434fdab", "name": "prod-proposed-migration-arm64_project"}, "is_domain": false, "roles": [{"id": "86bf3043974746c2bf52c2a9f362f986", "name": "reader"}, {"id": "15cf997650e345b7b21c02b5cdb7d84a", "name": "member"}], "is_admin_project": false, "catalog": [{"endpoints": [{"id": "213cdf38198c4581bd5b7d6d0836923b", "interface": "internal", "region_id": "prodstack6", "url": "https://radosgw-internal.ps6.canonical.com:443/", "region": "prodstack6"}, {"id": "67061eee26944a1a8009f9d07be19738", "interface": "public", "region_id": "prodstack6", "url": "https://radosgw.ps6.canonical.com:443/", "region": "prodstack6"}, {"id": "fc88c52c749a47d08a24a2c7efbde01b", "interface": "admin", "region_id": "prodstack6", "url": "https://radosgw-admin.ps6.canonical.com:443/", "region": "prodstack6"}], "id": "06e4714942634054bf9aa11715312b4e", "type": "s3", "name": "s3"}, {"endpoints": [{"id": "8aa44c94b63746bd9b37f1008ad55fa8", "interface": "admin", "region_id": "prodstack6", "url": "https://aodh-admin.ps6.canonical.com:8042", "region": "prodstack6"}, {"id": "92cf08a80a0242ebbca8ec893cf332b1", "interface": "public", "region_id": "prodstack6", "url": "https://aodh.ps6.canonical.com:8042", "region": "prodstack6"}, {"id": "d8139c6e11ae4edcb78981c12bd53212", "interface": "internal", "region_id": "prodstack6", "url": "https://aodh-internal.ps6.canonical.com:8042", "region": "prodstack6"}], "id": "2fb939b0b969435c8f0c5fa4edb4de94", "type": "alarming", "name": "aodh"}, {"endpoints": [{"id": "a49fcc80e658411885f88cdd8432a571", "interface": "internal", "region_id": "prodstack6", "url": "https://heat-internal.ps6.canonical.com:8000/v1", "region": "prodstack6"}, {"id": "b23866fddba8415885b06c064c34b94b", "interface": "public", "region_id": "prodstack6", "url": "https://heat.ps6.canonical.com:8000/v1", "region": "prodstack6"}, {"id": "f84ae55197f94b8392a678f35c82ca26", "interface": "admin", "region_id": "prodstack6", "url": "https://heat-admin.ps6.canonical.com:8000/v1", "region": "prodstack6"}], "id": "3d4b59f7dab644b2b527e8e96b697545", "type": "cloudformation", "name": "heat-cfn"}, {"endpoints": [{"id": "2e0143334c6241169f45f1c11970c6bc", "interface": "public", "region_id": "prodstack6", "url": "https://heat.ps6.canonical.com:8004/v1/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "5e19c32243c04a3faf1e5f9ab900c260", "interface": "internal", "region_id": "prodstack6", "url": "https://heat-internal.ps6.canonical.com:8004/v1/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "b3fc5c88ec8543a691fec75726b86967", "interface": "admin", "region_id": "prodstack6", "url": "https://heat-admin.ps6.canonical.com:8004/v1/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}], "id": "43b926205044476b8093b18d8ce0a9e4", "type": "orchestration", "name": "heat"}, {"endpoints": [{"id": "a47569b96e5b4146a312e4673504557c", "interface": "public", "region_id": "prodstack6", "url": "https://glance.ps6.canonical.com:9292", "region": "prodstack6"}, {"id": "bba35c4ab04f4114a2a34e65568537bd", "interface": "internal", "region_id": "prodstack6", "url": "https://glance-internal.ps6.canonical.com:9292", "region": "prodstack6"}, {"id": "ef769f1117c74a62a279131486c89628", "interface": "admin", "region_id": "prodstack6", "url": "https://glance-admin.ps6.canonical.com:9292", "region": "prodstack6"}], "id": "49de724549524bd78e9cd46a4477226f", "type": "image", "name": "glance"}, {"endpoints": [{"id": "a1a41e9a1e2d42e5b6cd5380cd1e21bf", "interface": "admin", "region_id": "prodstack6", "url": "https://cinder-admin.ps6.canonical.com:8776/v3/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "d2309a99724b4111827482c68a832c0c", "interface": "public", "region_id": "prodstack6", "url": "https://cinder.ps6.canonical.com:8776/v3/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "f8a02e3949ff42afa772eb5e74dbef9f", "interface": "internal", "region_id": "prodstack6", "url": "https://cinder-internal.ps6.canonical.com:8776/v3/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}], "id": "5bf6578a631349e3af4bf36d7adb18e1", "type": "volumev3", "name": "cinderv3"}, {"endpoints": [{"id": "01d84128f36444e9b01549b86bd69116", "interface": "admin", "region_id": "prodstack6", "url": "https://barbican-admin.ps6.canonical.com:9312", "region": "prodstack6"}, {"id": "0ce4a8777e0b40a88f7fc0f77e34a605", "interface": "public", "region_id": "prodstack6", "url": "https://barbican.ps6.canonical.com:9311", "region": "prodstack6"}, {"id": "f507ba49e4a7435cb330234217c92449", "interface": "internal", "region_id": "prodstack6", "url": "https://barbican-internal.ps6.canonical.com:9311", "region": "prodstack6"}], "id": "62cb1c3d9f6c45979c13516a6b3ff114", "type": "key-manager", "name": "barbican"}, {"endpoints": [{"id": "3cb6121bd8f14da8aa2fba7be823a2b4", "interface": "internal", "region_id": "prodstack6", "url": "https://neutron-internal.ps6.canonical.com:9696", "region": "prodstack6"}, {"id": "46ba11d133fe4e8f9e8f9097ba737682", "interface": "admin", "region_id": "prodstack6", "url": "https://neutron-admin.ps6.canonical.com:9696", "region": "prodstack6"}, {"id": "d872eb6aa23d40009165aa3dcdce3948", "interface": "public", "region_id": "prodstack6", "url": "https://neutron.ps6.canonical.com:9696", "region": "prodstack6"}], "id": "759cb6fdfbc146dd8b9d1ba444c4b9db", "type": "network", "name": "neutron"}, {"endpoints": [{"id": "4349d565f72446da9699269f85df5e8b", "interface": "internal", "region_id": "prodstack6", "url": "https://manila-internal.ps6.canonical.com:8786/v2/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "a483dcc58f5e415e9ec739c94474e609", "interface": "public", "region_id": "prodstack6", "url": "https://manila.ps6.canonical.com:8786/v2/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "c1f14236723e42878562d8dd63d5a6a0", "interface": "admin", "region_id": "prodstack6", "url": "https://manila-admin.ps6.canonical.com:8786/v2/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}], "id": "93fc4008035946deb1f433c2dd905a5d", "type": "sharev2", "name": "manilav2"}, {"endpoints": [{"id": "0fa148793c7249c8b187b6b4ff425731", "interface": "internal", "region_id": "prodstack6", "url": "https://radosgw-internal.ps6.canonical.com:443/swift/v1/AUTH_e4b04ca58d734ed0aa29e306adad4f79/simplestreams/data", "region": "prodstack6"}, {"id": "555ade266a6b4bcc81b6e5abf607aec5", "interface": "public", "region_id": "prodstack6", "url": "https://radosgw.ps6.canonical.com:443/swift/v1/AUTH_e4b04ca58d734ed0aa29e306adad4f79/simplestreams/data", "region": "prodstack6"}, {"id": "7dad1a7b1552465686424fc014463173", "interface": "admin", "region_id": "prodstack6", "url": "https://radosgw-admin.ps6.canonical.com:443/swift/simplestreams/data", "region": "prodstack6"}], "id": "977dd359af1a4fcc91a9daf4dc33b0f3", "type": "product-streams", "name": "image-stream"}, {"endpoints": [{"id": "12d30eabcdec4831bd15273d55b1cbab", "interface": "internal", "region_id": "prodstack6", "url": "https://manila-internal.ps6.canonical.com:8786/v1/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "29d35b2b483346479f1ff1a13604d50e", "interface": "admin", "region_id": "prodstack6", "url": "https://manila-admin.ps6.canonical.com:8786/v1/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "4aa1422b8f5945d8aed9ba6a8d670e5c", "interface": "public", "region_id": "prodstack6", "url": "https://manila.ps6.canonical.com:8786/v1/bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}], "id": "ac5e4f28fa794cde99f1d7ffc1b664e5", "type": "share", "name": "manila"}, {"endpoints": [{"id": "c7db93d54a684d8caeae1d9e18a59118", "interface": "admin", "region_id": "prodstack6", "url": "https://nova-admin.ps6.canonical.com:8774/v2.1", "region": "prodstack6"}, {"id": "dd7a796f401b477f9f1b5bbc05747d8d", "interface": "public", "region_id": "prodstack6", "url": "https://nova.ps6.canonical.com:8774/v2.1", "region": "prodstack6"}, {"id": "e7ecb038d830462ea67b0b463af5e013", "interface": "internal", "region_id": "prodstack6", "url": "https://nova-internal.ps6.canonical.com:8774/v2.1", "region": "prodstack6"}], "id": "b4519af08e174d4a8333a2d14ac3ba3b", "type": "compute", "name": "nova"}, {"endpoints": [{"id": "02ef5b6154934ffd97d8b5b8e4d70d2a", "interface": "internal", "region_id": "prodstack6", "url": "https://radosgw-internal.ps6.canonical.com:443/swift/v1/AUTH_bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "2741abe526e94842a4fa801423ba1ef0", "interface": "public", "region_id": "prodstack6", "url": "https://radosgw.ps6.canonical.com:443/swift/v1/AUTH_bd8b3df3f03d43a0a9303b7c0434fdab", "region": "prodstack6"}, {"id": "3742f9406c604516933d6fd8c29e0880", "interface": "admin", "region_id": "prodstack6", "url": "https://radosgw-admin.ps6.canonical.com:443/swift", "region": "prodstack6"}], "id": "c7f07a7b3b3c408c96200dfd1d1a0f6f", "type": "object-store", "name": "swift"}, {"endpoints": [{"id": "06d4ed6c160a43f2b7fa7f80ad1dc709", "interface": "internal", "region_id": "prodstack6", "url": "https://designate-internal.ps6.canonical.com:9001", "region": "prodstack6"}, {"id": "1e240624a50c4ca0aaa6ef63cbc94f1b", "interface": "admin", "region_id": "prodstack6", "url": "https://designate-admin.ps6.canonical.com:9001", "region": "prodstack6"}, {"id": "f94d7d17997a43fd9c63b34c43301c6e", "interface": "public", "region_id": "prodstack6", "url": "https://designate.ps6.canonical.com:9001", "region": "prodstack6"}], "id": "cf82013d63844fedbe96bcacb6bd1fef", "type": "dns", "name": "designate"}, {"endpoints": [{"id": "4a688340be464710bfa60bf3f88f41c4", "interface": "admin", "region_id": "prodstack6", "url": "https://gnocchi-admin.ps6.canonical.com:8041", "region": "prodstack6"}, {"id": "a5a95506c96d4716adb4efc3ac9051be", "interface": "public", "region_id": "prodstack6", "url": "https://gnocchi.ps6.canonical.com:8041", "region": "prodstack6"}, {"id": "eebc17a086834f8fa8bb6b35c8061a8c", "interface": "internal", "region_id": "prodstack6", "url": "https://gnocchi-internal.ps6.canonical.com:8041", "region": "prodstack6"}], "id": "d10589e854a446a5b852593f33f170a7", "type": "metric", "name": "gnocchi"}, {"endpoints": [{"id": "08f66df28d0f47f3bec12f29e06d85ac", "interface": "admin", "region_id": "prodstack6", "url": "https://keystone-admin.ps6.canonical.com:35357/v3", "region": "prodstack6"}, {"id": "46d270b45ceb42db902f4d241afa6a70", "interface": "public", "region_id": "prodstack6", "url": "https://keystone.ps6.canonical.com:5000/v3", "region": "prodstack6"}, {"id": "a4addee11d9349cfa46ec6660dbad947", "interface": "internal", "region_id": "prodstack6", "url": "https://keystone-internal.ps6.canonical.com:5000/v3", "region": "prodstack6"}], "id": "deb38a775a9b4e87a8de9e3eed779882", "type": "identity", "name": "keystone"}, {"endpoints": [{"id": "18b4af5f40664babb94e884c6a53ccf3", "interface": "admin", "region_id": "prodstack6", "url": "https://octavia-admin.ps6.canonical.com:9876", "region": "prodstack6"}, {"id": "2b6f7ba7f9944ee1aebd6dccc5223b2d", "interface": "internal", "region_id": "prodstack6", "url": "https://octavia-internal.ps6.canonical.com:9876", "region": "prodstack6"}, {"id": "5e3012e9c79e4890be4d964b6208f5c6", "interface": "public", "region_id": "prodstack6", "url": "https://octavia.ps6.canonical.com:9876", "region": "prodstack6"}], "id": "e00337be20d54948b66a1c3109b885c6", "type": "load-balancer", "name": "octavia"}, {"endpoints": [{"id": "2d2942b35f3041389ad810f679d02f22", "interface": "public", "region_id": "prodstack6", "url": "https://placement.ps6.canonical.com:8778", "region": "prodstack6"}, {"id": "2e3beaac7ac14284b72e2592820ad725", "interface": "admin", "region_id": "prodstack6", "url": "https://placement-admin.ps6.canonical.com:8778", "region": "prodstack6"}, {"id": "91060f6df9ae444f81808adf40540d94", "interface": "internal", "region_id": "prodstack6", "url": "https://placement-internal.ps6.canonical.com:8778", "region": "prodstack6"}], "id": "edc6e37f154f4c0ab3dd4d52b82bf873", "type": "placement", "name": "placement"}]}}
367s REQ: curl -g -i -X GET https://nova.ps6.canonical.com:8774/v2.1 -H "Accept: application/json" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3"
367s DEBUG (session:517) REQ: curl -g -i -X GET https://nova.ps6.canonical.com:8774/v2.1 -H "Accept: application/json" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3"
367s DEBUG (connectionpool:962) Starting new HTTPS connection (1): nova.ps6.canonical.com:8774
367s DEBUG (connectionpool:429) https://nova.ps6.canonical.com:8774 "GET /v2.1 HTTP/1.1" 302 0
367s RESP: [302] Connection: Keep-Alive Content-Length: 0 Content-Type: text/plain; charset=utf8 Date: Tue, 26 Mar 2024 05:29:57 GMT Keep-Alive: timeout=75, max=1000 Location: https://nova.ps6.canonical.com:8774/v2.1/ Server: Apache/2.4.52 (Ubuntu) x-compute-request-id: req-04e12aa3-3191-4a35-8db7-2b96af4f028d x-openstack-request-id: req-04e12aa3-3191-4a35-8db7-2b96af4f028d
367s DEBUG (session:548) RESP: [302] Connection: Keep-Alive Content-Length: 0 Content-Type: text/plain; charset=utf8 Date: Tue, 26 Mar 2024 05:29:57 GMT Keep-Alive: timeout=75, max=1000 Location: https://nova.ps6.canonical.com:8774/v2.1/ Server: Apache/2.4.52 (Ubuntu) x-compute-request-id: req-04e12aa3-3191-4a35-8db7-2b96af4f028d x-openstack-request-id: req-04e12aa3-3191-4a35-8db7-2b96af4f028d
367s RESP BODY: Omitted, Content-Type is set to text/plain; charset=utf8. Only application/json responses have their bodies logged.
367s DEBUG (session:580) RESP BODY: Omitted, Content-Type is set to text/plain; charset=utf8. Only application/json responses have their bodies logged.
367s DEBUG (connectionpool:429) https://nova.ps6.canonical.com:8774 "GET /v2.1/ HTTP/1.1" 200 397
367s RESP: [200] Connection: Keep-Alive Content-Length: 397 Content-Type: application/json Date: Tue, 26 Mar 2024 05:29:57 GMT Keep-Alive: timeout=75, max=999 OpenStack-API-Version: compute 2.1 Server: Apache/2.4.52 (Ubuntu) Vary: OpenStack-API-Version,X-OpenStack-Nova-API-Version X-OpenStack-Nova-API-Version: 2.1 x-compute-request-id: req-6cf0b9cf-ac1f-48c0-93b5-7dae489e365b x-openstack-request-id: req-6cf0b9cf-ac1f-48c0-93b5-7dae489e365b
367s DEBUG (session:548) RESP: [200] Connection: Keep-Alive Content-Length: 397 Content-Type: application/json Date: Tue, 26 Mar 2024 05:29:57 GMT Keep-Alive: timeout=75, max=999 OpenStack-API-Version: compute 2.1 Server: Apache/2.4.52 (Ubuntu) Vary: OpenStack-API-Version,X-OpenStack-Nova-API-Version X-OpenStack-Nova-API-Version: 2.1 x-compute-request-id: req-6cf0b9cf-ac1f-48c0-93b5-7dae489e365b x-openstack-request-id: req-6cf0b9cf-ac1f-48c0-93b5-7dae489e365b
367s RESP BODY: {"version": {"id": "v2.1", "status": "CURRENT", "version": "2.90", "min_version": "2.1", "updated": "2013-07-23T11:33:21Z", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/"}, {"rel": "describedby", "type": "text/html", "href": "http://docs.openstack.org/"}], "media-types": [{"base": "application/json", "type": "application/vnd.openstack.compute+json;version=2.1"}]}}
367s DEBUG (session:580) RESP BODY: {"version": {"id": "v2.1", "status": "CURRENT", "version": "2.90", "min_version": "2.1", "updated": "2013-07-23T11:33:21Z", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/"}, {"rel": "describedby", "type": "text/html", "href": "http://docs.openstack.org/"}], "media-types": [{"base": "application/json", "type": "application/vnd.openstack.compute+json;version=2.1"}]}}
367s GET call to compute for https://nova.ps6.canonical.com:8774/v2.1/ used request id req-6cf0b9cf-ac1f-48c0-93b5-7dae489e365b
367s DEBUG (session:936) GET call to compute for https://nova.ps6.canonical.com:8774/v2.1/ used request id req-6cf0b9cf-ac1f-48c0-93b5-7dae489e365b
367s DEBUG (extension:189) found extension EntryPoint.parse('v1password = swiftclient.authv1:PasswordLoader')
367s DEBUG (extension:189) found extension EntryPoint.parse('noauth = cinderclient.contrib.noauth:CinderNoAuthLoader')
367s DEBUG (extension:189) found extension EntryPoint.parse('admin_token = keystoneauth1.loading._plugins.admin_token:AdminToken')
367s DEBUG (extension:189) found extension EntryPoint.parse('none = keystoneauth1.loading._plugins.noauth:NoAuth')
367s DEBUG (extension:189) found extension EntryPoint.parse('password = keystoneauth1.loading._plugins.identity.generic:Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('token = keystoneauth1.loading._plugins.identity.generic:Token')
367s DEBUG (extension:189) found extension EntryPoint.parse('v2password = keystoneauth1.loading._plugins.identity.v2:Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('v2token = keystoneauth1.loading._plugins.identity.v2:Token')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3adfspassword = keystoneauth1.extras._saml2._loading:ADFSPassword')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3applicationcredential = keystoneauth1.loading._plugins.identity.v3:ApplicationCredential')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3fedkerb = keystoneauth1.extras.kerberos._loading:MappedKerberos')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3kerberos = keystoneauth1.extras.kerberos._loading:Kerberos')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3multifactor = keystoneauth1.loading._plugins.identity.v3:MultiFactor')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oauth1 = keystoneauth1.extras.oauth1._loading:V3OAuth1')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcaccesstoken = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectAccessToken')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcauthcode = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectAuthorizationCode')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcclientcredentials = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectClientCredentials')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3oidcpassword = keystoneauth1.loading._plugins.identity.v3:OpenIDConnectPassword')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3password = keystoneauth1.loading._plugins.identity.v3:Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3samlpassword = keystoneauth1.extras._saml2._loading:Saml2Password')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3token = keystoneauth1.loading._plugins.identity.v3:Token')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3tokenlessauth = keystoneauth1.loading._plugins.identity.v3:TokenlessAuth')
367s DEBUG (extension:189) found extension EntryPoint.parse('v3totp = keystoneauth1.loading._plugins.identity.v3:TOTP')
367s DEBUG (session:517) REQ: curl -g -i -X GET https://glance.ps6.canonical.com:9292/v2/images/2d366976-4689-4c6f-acab-b55163b07c34 -H "Accept: application/json" -H "OpenStack-API-Version: compute 2.87" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3" -H "X-OpenStack-Nova-API-Version: 2.87"
367s DEBUG (connectionpool:962) Starting new HTTPS connection (1): glance.ps6.canonical.com:9292
367s DEBUG (connectionpool:429) https://glance.ps6.canonical.com:9292 "GET /v2/images/2d366976-4689-4c6f-acab-b55163b07c34 HTTP/1.1" 200 1935
367s DEBUG (session:548) RESP: [200] Connection: Keep-Alive Content-Length: 1935 Content-Type: application/json Date: Tue, 26 Mar 2024 05:29:57 GMT Keep-Alive: timeout=75, max=1000 Server: Apache/2.4.52 (Ubuntu) X-Openstack-Request-Id: req-7c2da4d9-0d46-425b-a84c-73201d1980c7
367s DEBUG (session:580) RESP BODY: {"base_image_ref": "09c3944a-cd0d-425d-b22f-cde7ec51d155", "boot_roles": "reader,member", "hw_cdrom_bus": "scsi", "hw_disk_bus": "virtio", "hw_machine_type": "virt", "hw_video_model": "virtio", "hw_vif_model": "virtio", "image_location": "snapshot", "image_state": "available", "image_type": "snapshot", "instance_uuid": "da17c128-e5ee-42c1-ab78-154b089c59df", "owner_id": "bd8b3df3f03d43a0a9303b7c0434fdab", "owner_project_name": "prod-proposed-migration-arm64_project", "owner_specified.openstack.md5": "087a26f2222dab8516c553374a9d1b4d", "owner_specified.openstack.object": "images/adt/ubuntu-noble-arm64-server-20240201.img", "owner_specified.openstack.sha256": "095b278df09de76f01843de514daf3f8eb0a0cc67fee4b3491161913153619db", "owner_user_name": "prod-proposed-migration-arm64", "user_id": "369f50a481564a2c9433776a4ebd224d", "name": "adt/ubuntu-noble-arm64-server-20240326.img", "disk_format": "qcow2", "container_format": "bare", "visibility": "private", "size": 2311979008, "virtual_size": 21474836480, "status": "active", "checksum": "9259ab0e06148597edbb476a4d73477e", "protected": false, "min_ram": 0, "min_disk": 20, "owner": "bd8b3df3f03d43a0a9303b7c0434fdab", "os_hidden": false, "os_hash_algo": "sha512", "os_hash_value": "951897245260e2ccec338ff7d3325559cc24b2748331e9d9a793be044894306f113b1b9769f41820e5c9074d9fa433d35c77d5a969dcb494163f383ef9735fbe", "id": "2d366976-4689-4c6f-acab-b55163b07c34", "created_at": "2024-03-26T00:55:01Z", "updated_at": "2024-03-26T00:55:29Z", "locations": [{"url": "rbd://eea9d068-c18c-11ed-8dc0-013aacb71b80/glance/2d366976-4689-4c6f-acab-b55163b07c34/snap", "metadata": {"store": "ceph"}}], "direct_url": "rbd://eea9d068-c18c-11ed-8dc0-013aacb71b80/glance/2d366976-4689-4c6f-acab-b55163b07c34/snap", "tags": [], "self": "/v2/images/2d366976-4689-4c6f-acab-b55163b07c34", "file": "/v2/images/2d366976-4689-4c6f-acab-b55163b07c34/file", "schema": "/v2/schemas/image", "stores": "ceph"}
367s DEBUG (session:936) GET call to image for https://glance.ps6.canonical.com:9292/v2/images/2d366976-4689-4c6f-acab-b55163b07c34 used request id req-7c2da4d9-0d46-425b-a84c-73201d1980c7
367s DEBUG (session:517) REQ: curl -g -i -X GET https://nova.ps6.canonical.com:8774/v2.1/flavors/autopkgtest -H "Accept: application/json" -H "OpenStack-API-Version: compute 2.87" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3" -H "X-OpenStack-Nova-API-Version: 2.87"
367s DEBUG (connectionpool:429) https://nova.ps6.canonical.com:8774 "GET /v2.1/flavors/autopkgtest HTTP/1.1" 404 84
367s DEBUG (session:548) RESP: [404] Connection: Keep-Alive Content-Length: 84 Content-Type: application/json; charset=UTF-8 Date: Tue, 26 Mar 2024 05:29:57 GMT Keep-Alive: timeout=75, max=998 OpenStack-API-Version: compute 2.87 Server: Apache/2.4.52 (Ubuntu) Vary: OpenStack-API-Version,X-OpenStack-Nova-API-Version X-OpenStack-Nova-API-Version: 2.87 x-compute-request-id: req-71efbba6-7623-4b8a-b7b9-e81d14487e60 x-openstack-request-id: req-71efbba6-7623-4b8a-b7b9-e81d14487e60
367s DEBUG (session:580) RESP BODY: {"itemNotFound": {"code": 404, "message": "Flavor autopkgtest could not be found."}}
367s DEBUG (session:936) GET call to compute for https://nova.ps6.canonical.com:8774/v2.1/flavors/autopkgtest used request id req-71efbba6-7623-4b8a-b7b9-e81d14487e60
367s DEBUG (session:517) REQ: curl -g -i -X GET https://nova.ps6.canonical.com:8774/v2.1/flavors?is_public=None -H "Accept: application/json" -H "OpenStack-API-Version: compute 2.87" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3" -H "X-OpenStack-Nova-API-Version: 2.87"
367s DEBUG (connectionpool:429) https://nova.ps6.canonical.com:8774 "GET /v2.1/flavors?is_public=None HTTP/1.1" 200 1739
367s DEBUG (session:548) RESP: [200] Connection: Keep-Alive Content-Length: 1739 Content-Type: application/json Date: Tue, 26 Mar 2024 05:29:58 GMT Keep-Alive: timeout=75, max=997 OpenStack-API-Version: compute 2.87 Server: Apache/2.4.52 (Ubuntu) Vary: OpenStack-API-Version,X-OpenStack-Nova-API-Version X-OpenStack-Nova-API-Version: 2.87 x-compute-request-id: req-eaea4915-e678-4091-9352-209e90c8dd8e x-openstack-request-id: req-eaea4915-e678-4091-9352-209e90c8dd8e
367s DEBUG (session:580) RESP BODY: {"flavors": [{"id": "062428d9-35a1-461f-a33a-38436ed516b4", "name": "autopkgtest-cpu8-ram16-disk160-arm64", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/flavors/062428d9-35a1-461f-a33a-38436ed516b4"}, {"rel": "bookmark", "href": "https://nova.ps6.canonical.com:8774/flavors/062428d9-35a1-461f-a33a-38436ed516b4"}], "description": null}, {"id": "8d27c5f0-65c7-4018-b3f7-50463875ab09", "name": "autopkgtest", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09"}, {"rel": "bookmark", "href": "https://nova.ps6.canonical.com:8774/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09"}], "description": null}, {"id": "8ebe34fb-1390-4cc7-bbe5-0d38c80f2fb4", "name": "autopkgtest-cpu2-ram4-disk20-arm64", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/flavors/8ebe34fb-1390-4cc7-bbe5-0d38c80f2fb4"}, {"rel": "bookmark", "href": "https://nova.ps6.canonical.com:8774/flavors/8ebe34fb-1390-4cc7-bbe5-0d38c80f2fb4"}], "description": null}, {"id": "a8256f9e-53ee-4584-ad7f-60e088825b83", "name": "autopkgtest-big", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/flavors/a8256f9e-53ee-4584-ad7f-60e088825b83"}, {"rel": "bookmark", "href": "https://nova.ps6.canonical.com:8774/flavors/a8256f9e-53ee-4584-ad7f-60e088825b83"}], "description": null}, {"id": "cfc564ac-9f6e-4477-91c4-a89ccb4b744e", "name": "autopkgtest-cpu4-ram8-disk100-arm64", "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/flavors/cfc564ac-9f6e-4477-91c4-a89ccb4b744e"}, {"rel": "bookmark", "href": "https://nova.ps6.canonical.com:8774/flavors/cfc564ac-9f6e-4477-91c4-a89ccb4b744e"}], "description": null}]}
367s DEBUG (session:936) GET call to compute for https://nova.ps6.canonical.com:8774/v2.1/flavors?is_public=None used request id req-eaea4915-e678-4091-9352-209e90c8dd8e
367s DEBUG (session:517) REQ: curl -g -i -X GET https://nova.ps6.canonical.com:8774/v2.1/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09 -H "Accept: application/json" -H "OpenStack-API-Version: compute 2.87" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3" -H "X-OpenStack-Nova-API-Version: 2.87"
367s DEBUG (connectionpool:429) https://nova.ps6.canonical.com:8774 "GET /v2.1/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09 HTTP/1.1" 200 613
367s DEBUG (session:548) RESP: [200] Connection: Keep-Alive Content-Length: 613 Content-Type: application/json Date: Tue, 26 Mar 2024 05:29:58 GMT Keep-Alive: timeout=75, max=996 OpenStack-API-Version: compute 2.87 Server: Apache/2.4.52 (Ubuntu) Vary: OpenStack-API-Version,X-OpenStack-Nova-API-Version X-OpenStack-Nova-API-Version: 2.87 x-compute-request-id: req-c1c79990-9fa9-49d6-ab5a-15fe5f7c7feb x-openstack-request-id: req-c1c79990-9fa9-49d6-ab5a-15fe5f7c7feb
367s DEBUG (session:580) RESP BODY: {"flavor": {"id": "8d27c5f0-65c7-4018-b3f7-50463875ab09", "name": "autopkgtest", "ram": 4096, "disk": 20, "swap": 0, "OS-FLV-EXT-DATA:ephemeral": 0, "OS-FLV-DISABLED:disabled": false, "vcpus": 2, "os-flavor-access:is_public": false, "rxtx_factor": 1.0, "links": [{"rel": "self", "href": "https://nova.ps6.canonical.com:8774/v2.1/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09"}, {"rel": "bookmark", "href": "https://nova.ps6.canonical.com:8774/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09"}], "description": null, "extra_specs": {"aggregate_instance_extra_specs:commit": "builder-arm64", "hw_rng:allowed": "True"}}}
367s DEBUG (session:936) GET call to compute for https://nova.ps6.canonical.com:8774/v2.1/flavors/8d27c5f0-65c7-4018-b3f7-50463875ab09 used request id req-c1c79990-9fa9-49d6-ab5a-15fe5f7c7feb
367s DEBUG (session:517) REQ: curl -g -i -X POST https://nova.ps6.canonical.com:8774/v2.1/servers -H "Accept: application/json" -H "Content-Type: application/json" -H "OpenStack-API-Version: compute 2.87" -H "User-Agent: python-novaclient" -H "X-Auth-Token: {SHA256}9a9cf0d9c52a29bf02340dbd51b027b0f5eefbeb82812170188db96d968763d3" -H "X-OpenStack-Nova-API-Version: 2.87" -d '{"server": {"name": "adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-proposed-migration-environment-3", "imageRef": "2d366976-4689-4c6f-acab-b55163b07c34", "flavorRef": "8d27c5f0-65c7-4018-b3f7-50463875ab09", "user_data": "I2Nsb3VkLWNvbmZpZwpob3N0bmFtZTogYXV0b3BrZ3Rlc3QKbWFuYWdlX2V0Y19ob3N0czogdHJ1ZQphcHRfdXBkYXRlOiB0cnVlCmFwdF91cGdyYWRlOiBmYWxzZQphcHRfbWlycm9yOiBodHRwOi8vZnRwbWFzdGVyLmludGVybmFsL3VidW50dS8KCnJ1bmNtZDoKIC0gZWNobyAnQWNxdWlyZTo6TGFuZ3VhZ2VzICJub25lIjsnID4gL2V0Yy9hcHQvYXB0LmNvbmYuZC85MG5vbGFuZ3VhZ2VzCiAtIGVjaG8gJ2ZvcmNlLXVuc2FmZS1pbycgPiAvZXRjL2Rwa2cvZHBrZy5jZmcuZC9hdXRvcGtndGVzdAogLSBwcmludGYgJ1xuVEVSTT1saW51eFxuJ2h0dHBfcHJveHk9aHR0cDovL3NxdWlkLmludGVybmFsOjMxMjgnXG4naHR0cHNfcHJveHk9aHR0cDovL3NxdWlkLmludGVybmFsOjMxMjgnXG4nbm9fcHJveHk9MTI3LjAuMC4xLDEyNy4wLjEuMSxsb2dpbi51YnVudHUuY29tLGxvY2FsaG9zdCxsb2NhbGRvbWFpbixub3ZhbG9jYWwsaW50ZXJuYWwsYXJjaGl2ZS51YnVudHUuY29tLHBvcnRzLnVidW50dS5jb20sc2VjdXJpdHkudWJ1bnR1LmNvbSxkZGVicy51YnVudHUuY29tLGNoYW5nZWxvZ3MudWJ1bnR1LmNvbSxsYXVuY2hwYWRsaWJyYXJpYW4ubmV0LGxhdW5jaHBhZGNvbnRlbnQubmV0LGxhdW5jaHBhZC5uZXQsMTAuMjQuMC4wLzI0LGtleXN0b25lLnBzNS5jYW5vbmljYWwuY29tLG9iamVjdHN0b3JhZ2UucHJvZHN0YWNrNS5jYW5vbmljYWwuY29tJ1xuJyA+PiAvZXRjL2Vudmlyb25tZW50CiAtIHNlZCAtaSAtciAnL14xMjcuMC4xLjEvIHMvYXV0b3BrZ3Rlc3QtW14gXStcLi9hdXRvcGtndGVzdFwuLycgL2V0Yy9ob3N0cwo=", "key_name": "testbed-juju-7f2275-prod-proposed-migration-environment-3", "min_count": 1, "max_count": 1, "security_groups": [{"name": "autopkgtest-juju-7f2275-prod-proposed-migration-environment-3@bos03-arm64-17.secgroup"}], "networks": [{"uuid": "6ea4839c-9760-4b54-ab7d-70a6312667d1"}]}}'
367s DEBUG (connectionpool:429) https://nova.ps6.canonical.com:8774 "POST /v2.1/servers HTTP/1.1" 403 115
367s DEBUG (session:548) RESP: [403] Connection: Keep-Alive Content-Length: 115 Content-Type: application/json; charset=UTF-8 Date: Tue, 26 Mar 2024 05:29:58 GMT Keep-Alive: timeout=75, max=995 OpenStack-API-Version: compute 2.87 Server: Apache/2.4.52 (Ubuntu) Vary: OpenStack-API-Version,X-OpenStack-Nova-API-Version X-OpenStack-Nova-API-Version: 2.87 x-compute-request-id: req-130a8236-d3ff-4479-848f-9290a018fe30 x-openstack-request-id: req-130a8236-d3ff-4479-848f-9290a018fe30
367s DEBUG (session:580) RESP BODY: {"forbidden": {"code": 403, "message": "Quota exceeded for cores: Requested 2, but already used 140 of 140 cores"}}
367s DEBUG (session:936) POST call to compute for https://nova.ps6.canonical.com:8774/v2.1/servers used request id req-130a8236-d3ff-4479-848f-9290a018fe30
367s DEBUG (shell:822) Quota exceeded for cores: Requested 2, but already used 140 of 140 cores (HTTP 403) (Request-ID: req-130a8236-d3ff-4479-848f-9290a018fe30)
367s Traceback (most recent call last):
367s   File "/usr/lib/python3/dist-packages/novaclient/shell.py", line 820, in main
367s     OpenStackComputeShell().main(argv)
367s   File "/usr/lib/python3/dist-packages/novaclient/shell.py", line 742, in main
367s     args.func(self.cs, args)
367s   File "/usr/lib/python3/dist-packages/novaclient/v2/shell.py", line 971, in do_boot
367s     server = cs.servers.create(*boot_args, **boot_kwargs)
367s   File "/usr/lib/python3/dist-packages/novaclient/v2/servers.py", line 1477, in create
367s     return self._boot(response_key, *boot_args, **boot_kwargs)
367s   File "/usr/lib/python3/dist-packages/novaclient/v2/servers.py", line 836, in _boot
367s     return self._create('/servers', body, response_key,
367s   File "/usr/lib/python3/dist-packages/novaclient/base.py", line 363, in _create
367s     resp, body = self.api.client.post(url, body=body)
367s   File "/usr/lib/python3/dist-packages/keystoneauth1/adapter.py", line 392, in post
367s     return self.request(url, 'POST', **kwargs)
367s   File "/usr/lib/python3/dist-packages/novaclient/client.py", line 78, in request
367s     raise exceptions.from_response(resp, body, url, method)
367s novaclient.exceptions.Forbidden: Quota exceeded for cores: Requested 2, but already used 140 of 140 cores (HTTP 403) (Request-ID: req-130a8236-d3ff-4479-848f-9290a018fe30)
367s ERROR (Forbidden): Quota exceeded for cores: Requested 2, but already used 140 of 140 cores (HTTP 403) (Request-ID: req-130a8236-d3ff-4479-848f-9290a018fe30)
369s autopkgtest [05:35:44]: testbed dpkg architecture: arm64
369s autopkgtest [05:35:44]: testbed apt version: 2.7.12
369s autopkgtest [05:35:44]: @@@@@@@@@@@@@@@@@@@@ test bed setup
370s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB]
370s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [56.0 kB]
370s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [4000 kB]
371s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [7592 B]
371s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [495 kB]
371s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 Packages [713 kB]
371s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 c-n-f Metadata [3144 B]
371s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 Packages [43.0 kB]
371s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 c-n-f Metadata [116 B]
371s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 Packages [4307 kB]
371s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 c-n-f Metadata [8528 B]
371s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 Packages [70.5 kB]
371s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 c-n-f Metadata [116 B]
372s Fetched 9820 kB in 2s (5695 kB/s)
373s Reading package lists...
375s Reading package lists...
375s Building dependency tree...
375s Reading state information...
375s Calculating upgrade...
376s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
376s Reading package lists...
376s Building dependency tree...
376s Reading state information...
377s 0 upgraded, 0 newly installed, 0 to remove and 240 not upgraded.
377s sh: Attempting to set up Debian/Ubuntu apt sources automatically
377s sh: Distribution appears to be Ubuntu
378s Reading package lists...
378s Building dependency tree...
378s Reading state information...
379s eatmydata is already the newest version (131-1).
379s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
379s Reading package lists...
379s Building dependency tree...
379s Reading state information...
379s dbus is already the newest version (1.14.10-4ubuntu1).
379s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
379s Reading package lists...
380s Building dependency tree...
380s Reading state information...
381s rng-tools-debian is already the newest version (2.4).
381s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
381s Reading package lists...
381s Building dependency tree...
381s Reading state information...
381s The following packages will be REMOVED:
381s   cloud-init* python3-configobj* python3-debconf*
382s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded.
382s After this operation, 3256 kB disk space will be freed.
382s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 74819 files and directories currently installed.)
382s Removing cloud-init (24.1.2-0ubuntu1) ...
382s Removing python3-configobj (5.0.8-3) ...
382s Removing python3-debconf (1.5.86) ...
383s Processing triggers for man-db (2.12.0-3) ...
383s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 74430 files and directories currently installed.)
383s Purging configuration files for cloud-init (24.1.2-0ubuntu1) ...
384s dpkg: warning: while removing cloud-init, directory '/etc/cloud/cloud.cfg.d' not empty so not removed
384s Processing triggers for rsyslog (8.2312.0-3ubuntu3) ...
384s invoke-rc.d: policy-rc.d denied execution of try-restart.
384s Reading package lists...
385s Building dependency tree...
385s Reading state information...
385s linux-generic is already the newest version (6.8.0-11.11+1).
385s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
386s Hit:1 http://ftpmaster.internal/ubuntu noble InRelease
386s Hit:2 http://ftpmaster.internal/ubuntu noble-updates InRelease
386s Hit:3 http://ftpmaster.internal/ubuntu noble-security InRelease
388s Reading package lists...
388s Reading package lists...
388s Building dependency tree...
388s Reading state information...
388s Calculating upgrade...
388s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
389s Reading package lists...
389s Building dependency tree...
389s Reading state information...
389s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
389s autopkgtest [05:36:04]: rebooting testbed after setup commands that affected boot
416s autopkgtest [05:36:31]: testbed running kernel: Linux 6.8.0-11-generic #11-Ubuntu SMP PREEMPT_DYNAMIC Wed Feb 14 02:53:31 UTC 2024
419s autopkgtest [05:36:34]: @@@@@@@@@@@@@@@@@@@@ apt-source fdroidserver
421s Get:1 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (dsc) [2534 B]
421s Get:2 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (tar) [4993 kB]
421s Get:3 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (asc) [488 B]
421s Get:4 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (diff) [20.9 kB]
422s gpgv: Signature made Fri Jan 26 08:13:42 2024 UTC
422s gpgv:                using RSA key 73B299CBD4EEADDCC017E87A5BFFDCC258E69433
422s gpgv: Can't check signature: No public key
422s dpkg-source: warning: cannot verify inline signature for ./fdroidserver_2.2.1-2.dsc: no acceptable signature found
422s autopkgtest [05:36:37]: testing package fdroidserver version 2.2.1-2
422s autopkgtest [05:36:37]: build not needed
425s autopkgtest [05:36:40]: test command1: preparing testbed
427s Reading package lists...
427s Building dependency tree...
427s Reading state information...
428s Starting pkgProblemResolver with broken count: 0
428s Starting 2 pkgProblemResolver with broken count: 0
428s Done
428s The following additional packages will be installed:
428s   adwaita-icon-theme androguard android-libart android-libbacktrace
428s   android-libbase android-liblog android-libnativebridge
428s   android-libnativeloader android-libziparchive apksigner at-spi2-common blt
428s   ca-certificates-java default-jdk-headless default-jre default-jre-headless
428s   dexdump fdroidserver fontconfig fontconfig-config fonts-dejavu-core
428s   fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache
428s   hicolor-icon-theme humanity-icon-theme java-common libann0 libapksig-java
428s   libasound2 libasound2-data libatk1.0-0 libatomic1 libavahi-client3
428s   libavahi-common-data libavahi-common3 libblas3 libcairo2 libcdt5 libcgraph6
428s   libcups2 libdatrie1 libdeflate0 libdrm-amdgpu1 libdrm-nouveau2
428s   libdrm-radeon1 liberror-perl libfontconfig1 libgd3 libgdk-pixbuf-2.0-0
428s   libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1 libgl1-mesa-dri
428s   libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 libgraphite2-3
428s   libgtk2.0-0 libgtk2.0-common libgts-0.7-5 libgvc6 libgvpr2 libharfbuzz0b
428s   libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 libjs-jquery
428s   libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 liblerc4
428s   libllvm17 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0
428s   libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0
428s   libpython3.11-minimal libpython3.11-stdlib libqhull-r8.0 libraqm0
428s   libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 libtiff6
428s   libtk8.6 libvulkan1 libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 libxaw7
428s   libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 libxcb-randr0
428s   libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 libxcomposite1
428s   libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 libxinerama1 libxmu6
428s   libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 libxss1 libxt6
428s   libxtst6 libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre
428s   openjdk-21-jre-headless python-matplotlib-data python3-appdirs python3-args
428s   python3-asn1crypto python3-asttokens python3-bcrypt python3-brotli
428s   python3-click python3-clint python3-colorama python3-contourpy
428s   python3-cycler python3-dateutil python3-decorator python3-defusedxml
428s   python3-distutils python3-executing python3-fonttools python3-fs python3-git
428s   python3-gitdb python3-ipython python3-jedi python3-kiwisolver
428s   python3-lib2to3 python3-libcloud python3-lockfile python3-lxml python3-lz4
428s   python3-magic python3-matplotlib python3-matplotlib-inline python3-mpmath
428s   python3-nacl python3-networkx python3-numpy python3-oscrypto
428s   python3-packaging python3-paramiko python3-parso python3-pathspec
428s   python3-pexpect python3-pil python3-pil.imagetk python3-png
428s   python3-prompt-toolkit python3-ptyprocess python3-pure-eval python3-pyasn1
428s   python3-pyasn1-modules python3-pydot python3-qrcode python3-ruamel.yaml
428s   python3-ruamel.yaml.clib python3-scipy python3-setuptools python3-simplejson
428s   python3-smmap python3-stack-data python3-sympy python3-tk python3-traitlets
428s   python3-ufolib2 python3-unicodedata2 python3-wcwidth python3.11
428s   python3.11-minimal tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint
428s Suggested packages:
428s   blt-demo gradle ipfs-cid vagrant vagrant-cachier vagrant-libvirt qemu-kvm
428s   git-daemon-run | git-daemon-sysvinit git-doc git-email git-gui gitk gitweb
428s   git-cvs git-mediawiki git-svn gsfonts graphviz-doc libasound2-plugins
428s   alsa-utils cups-common libgd-tools gvfs libjs-jquery-ui-docs liblcms2-utils
428s   pcscd tcl8.6 tk8.6 openjdk-21-demo openjdk-21-source libnss-mdns
428s   fonts-dejavu-extra fonts-ipafont-gothic fonts-ipafont-mincho
428s   fonts-wqy-microhei | fonts-wqy-zenhei fonts-indic python-cycler-doc
428s   python-git-doc python-ipython-doc python-lockfile-doc python-lxml-doc
428s   cm-super-minimal dvipng ffmpeg fonts-staypuft ghostscript gir1.2-gtk-3.0
428s   inkscape ipython3 librsvg2-common python3-cairocffi python3-gi-cairo
428s   python3-gobject python3-pyqt5 python3-sip python3-tornado
428s   texlive-extra-utils texlive-latex-extra python-mpmath-doc python3-gmpy2
428s   python-nacl-doc python-networkx-doc python3-gdal python3-pygraphviz gcc
428s   gfortran python3-dev python3-pytest python3-gssapi python3-invoke
428s   python-pexpect-doc python-pil-doc python-scipy-doc python-setuptools-doc
428s   texlive-fonts-extra python-sympy-doc tix python3-tk-dbg python3.11-venv
428s   python3.11-doc binfmt-support
428s Recommended packages:
428s   librsvg2-common python3-pyperclip python3-pyqt5 android-sdk opensc s3cmd
428s   fonts-liberation2 alsa-ucm-conf alsa-topology-conf libgdk-pixbuf2.0-bin
428s   libgl1-amber-dri libgail-common libgtk2.0-bin libgts-bin javascript-common
428s   mesa-vulkan-drivers | vulkan-icd libatk-wrapper-java-jni fonts-dejavu-extra
428s   python3-bs4 python3-cssselect python3-html5lib python3-olefile g++
428s   | c++-compiler isympy-common
428s The following NEW packages will be installed:
428s   adwaita-icon-theme androguard android-libart android-libbacktrace
428s   android-libbase android-liblog android-libnativebridge
428s   android-libnativeloader android-libziparchive apksigner at-spi2-common
428s   autopkgtest-satdep blt ca-certificates-java default-jdk-headless default-jre
428s   default-jre-headless dexdump fdroidserver fontconfig fontconfig-config
428s   fonts-dejavu-core fonts-dejavu-mono fonts-lyx git git-man graphviz
428s   gtk-update-icon-cache hicolor-icon-theme humanity-icon-theme java-common
428s   libann0 libapksig-java libasound2 libasound2-data libatk1.0-0 libatomic1
428s   libavahi-client3 libavahi-common-data libavahi-common3 libblas3 libcairo2
428s   libcdt5 libcgraph6 libcups2 libdatrie1 libdeflate0 libdrm-amdgpu1
428s   libdrm-nouveau2 libdrm-radeon1 liberror-perl libfontconfig1 libgd3
428s   libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1
428s   libgl1-mesa-dri libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1
428s   libgraphite2-3 libgtk2.0-0 libgtk2.0-common libgts-0.7-5 libgvc6 libgvpr2
428s   libharfbuzz0b libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8
428s   libjs-jquery libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2
428s   liblerc4 libllvm17 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0
428s   libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0
428s   libpython3.11-minimal libpython3.11-stdlib libqhull-r8.0 libraqm0
428s   libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 libtiff6
428s   libtk8.6 libvulkan1 libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 libxaw7
428s   libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 libxcb-randr0
428s   libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 libxcomposite1
428s   libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 libxinerama1 libxmu6
428s   libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 libxss1 libxt6
428s   libxtst6 libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre
428s   openjdk-21-jre-headless python-matplotlib-data python3-appdirs python3-args
428s   python3-asn1crypto python3-asttokens python3-bcrypt python3-brotli
428s   python3-click python3-clint python3-colorama python3-contourpy
428s   python3-cycler python3-dateutil python3-decorator python3-defusedxml
428s   python3-distutils python3-executing python3-fonttools python3-fs python3-git
428s   python3-gitdb python3-ipython python3-jedi python3-kiwisolver
428s   python3-lib2to3 python3-libcloud python3-lockfile python3-lxml python3-lz4
428s   python3-magic python3-matplotlib python3-matplotlib-inline python3-mpmath
428s   python3-nacl python3-networkx python3-numpy python3-oscrypto
428s   python3-packaging python3-paramiko python3-parso python3-pathspec
428s   python3-pexpect python3-pil python3-pil.imagetk python3-png
428s   python3-prompt-toolkit python3-ptyprocess python3-pure-eval python3-pyasn1
428s   python3-pyasn1-modules python3-pydot python3-qrcode python3-ruamel.yaml
428s   python3-ruamel.yaml.clib python3-scipy python3-setuptools python3-simplejson
428s   python3-smmap python3-stack-data python3-sympy python3-tk python3-traitlets
428s   python3-ufolib2 python3-unicodedata2 python3-wcwidth python3.11
428s   python3.11-minimal tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint
429s 0 upgraded, 211 newly installed, 0 to remove and 0 not upgraded.
429s Need to get 292 MB/292 MB of archives.
429s After this operation, 1002 MB of additional disk space will be used.
429s Get:1 /tmp/autopkgtest.tyZAgp/1-autopkgtest-satdep.deb autopkgtest-satdep arm64 0 [736 B]
429s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 libpython3.11-minimal arm64 3.11.8-1 [837 kB]
429s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 python3.11-minimal arm64 3.11.8-1 [2150 kB]
429s Get:4 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [7624 B]
429s Get:5 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg-turbo8 arm64 2.1.5-2ubuntu1 [160 kB]
429s Get:6 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg8 arm64 8c-2ubuntu11 [2148 B]
429s Get:7 http://ftpmaster.internal/ubuntu noble/main arm64 libdeflate0 arm64 1.19-1 [43.4 kB]
429s Get:8 http://ftpmaster.internal/ubuntu noble/main arm64 libjbig0 arm64 2.1-6.1ubuntu1 [28.9 kB]
429s Get:9 http://ftpmaster.internal/ubuntu noble/main arm64 liblerc4 arm64 4.0.0+ds-4ubuntu1 [153 kB]
429s Get:10 http://ftpmaster.internal/ubuntu noble/main arm64 libsharpyuv0 arm64 1.3.2-0.4 [14.4 kB]
429s Get:11 http://ftpmaster.internal/ubuntu noble/main arm64 libwebp7 arm64 1.3.2-0.4 [191 kB]
429s Get:12 http://ftpmaster.internal/ubuntu noble/main arm64 libtiff6 arm64 4.5.1+git230720-3ubuntu1 [226 kB]
429s Get:13 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.10+dfsg-3 [144 kB]
429s Get:14 http://ftpmaster.internal/ubuntu noble/main arm64 gtk-update-icon-cache arm64 3.24.40-2ubuntu1 [50.5 kB]
429s Get:15 http://ftpmaster.internal/ubuntu noble/main arm64 hicolor-icon-theme all 0.17-2 [9976 B]
429s Get:16 http://ftpmaster.internal/ubuntu noble/main arm64 humanity-icon-theme all 0.6.16 [1282 kB]
429s Get:17 http://ftpmaster.internal/ubuntu noble/main arm64 ubuntu-mono all 24.04-0ubuntu1 [151 kB]
429s Get:18 http://ftpmaster.internal/ubuntu noble/main arm64 adwaita-icon-theme all 46~rc-1 [723 kB]
429s Get:19 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asn1crypto all 1.5.1-3 [79.7 kB]
429s Get:20 http://ftpmaster.internal/ubuntu noble/main arm64 python3-colorama all 0.4.6-4 [32.1 kB]
429s Get:21 http://ftpmaster.internal/ubuntu noble/main arm64 python3-click all 8.1.6-1 [79.0 kB]
429s Get:22 http://ftpmaster.internal/ubuntu noble/main arm64 python3-decorator all 5.1.1-5 [10.1 kB]
429s Get:23 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-parso all 0.8.3-1 [67.2 kB]
429s Get:24 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-jedi all 0.18.2-1ubuntu1 [692 kB]
429s Get:25 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-traitlets all 5.5.0-2 [85.0 kB]
429s Get:26 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib-inline all 0.1.6-2 [8784 B]
429s Get:27 http://ftpmaster.internal/ubuntu noble/main arm64 python3-ptyprocess all 0.7.0-5 [15.1 kB]
429s Get:28 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pexpect all 4.9-2 [48.1 kB]
429s Get:29 http://ftpmaster.internal/ubuntu noble/main arm64 python3-wcwidth all 0.2.5+dfsg1-1.1ubuntu1 [22.5 kB]
429s Get:30 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-prompt-toolkit all 3.0.43-1 [256 kB]
429s Get:31 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asttokens all 2.4.1-1 [20.9 kB]
430s Get:32 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-executing all 2.0.1-0.1 [23.3 kB]
430s Get:33 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pure-eval all 0.2.2-1 [11.3 kB]
430s Get:34 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-stack-data all 0.6.3-1 [22.0 kB]
430s Get:35 http://ftpmaster.internal/ubuntu noble/main arm64 python3-lib2to3 all 3.11.5-1 [79.0 kB]
430s Get:36 http://ftpmaster.internal/ubuntu noble/main arm64 python3-distutils all 3.11.5-1 [131 kB]
430s Get:37 http://ftpmaster.internal/ubuntu noble/main arm64 python3-setuptools all 68.1.2-2 [396 kB]
430s Get:38 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ipython all 8.20.0-1 [561 kB]
430s Get:39 http://ftpmaster.internal/ubuntu noble/main arm64 libxslt1.1 arm64 1.1.39-0exp1 [166 kB]
430s Get:40 http://ftpmaster.internal/ubuntu noble/main arm64 python3-lxml arm64 5.1.0-1 [2042 kB]
430s Get:41 http://ftpmaster.internal/ubuntu noble/main arm64 python3-magic all 2:0.4.27-2 [13.4 kB]
430s Get:42 http://ftpmaster.internal/ubuntu noble/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [328 kB]
430s Get:43 http://ftpmaster.internal/ubuntu noble/universe arm64 libjs-jquery-ui all 1.13.2+dfsg-1 [252 kB]
430s Get:44 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-mono all 2.37-8 [502 kB]
430s Get:45 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-core all 2.37-8 [835 kB]
430s Get:46 http://ftpmaster.internal/ubuntu noble/universe arm64 fonts-lyx all 2.4.0~RC3-1 [170 kB]
430s Get:47 http://ftpmaster.internal/ubuntu noble/universe arm64 python-matplotlib-data all 3.6.3-1ubuntu3 [2936 kB]
430s Get:48 http://ftpmaster.internal/ubuntu noble/main arm64 python3-dateutil all 2.8.2-3 [79.2 kB]
430s Get:49 http://ftpmaster.internal/ubuntu noble/main arm64 libgomp1 arm64 14-20240303-1ubuntu1 [144 kB]
430s Get:50 http://ftpmaster.internal/ubuntu noble/main arm64 libimagequant0 arm64 2.18.0-1 [37.0 kB]
430s Get:51 http://ftpmaster.internal/ubuntu noble/main arm64 liblcms2-2 arm64 2.14-2 [159 kB]
430s Get:52 http://ftpmaster.internal/ubuntu noble/main arm64 libopenjp2-7 arm64 2.5.0-2 [170 kB]
430s Get:53 http://ftpmaster.internal/ubuntu noble/main arm64 libgraphite2-3 arm64 1.3.14-2 [81.5 kB]
430s Get:54 http://ftpmaster.internal/ubuntu noble/main arm64 libharfbuzz0b arm64 8.3.0-2 [463 kB]
430s Get:55 http://ftpmaster.internal/ubuntu noble/main arm64 libraqm0 arm64 0.10.1-1 [14.4 kB]
430s Get:56 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpdemux2 arm64 1.3.2-0.4 [12.3 kB]
430s Get:57 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpmux3 arm64 1.3.2-0.4 [25.0 kB]
430s Get:58 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pil arm64 10.2.0-1 [477 kB]
430s Get:59 http://ftpmaster.internal/ubuntu noble/main arm64 libtcl8.6 arm64 8.6.13+dfsg-2 [980 kB]
430s Get:60 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig-config arm64 2.15.0-1ubuntu1 [37.0 kB]
430s Get:61 http://ftpmaster.internal/ubuntu noble/main arm64 libfontconfig1 arm64 2.15.0-1ubuntu1 [142 kB]
430s Get:62 http://ftpmaster.internal/ubuntu noble/main arm64 libxrender1 arm64 1:0.9.10-1.1 [19.1 kB]
430s Get:63 http://ftpmaster.internal/ubuntu noble/main arm64 libxft2 arm64 2.3.6-1 [43.3 kB]
430s Get:64 http://ftpmaster.internal/ubuntu noble/main arm64 x11-common all 1:7.7+23ubuntu2 [23.4 kB]
430s Get:65 http://ftpmaster.internal/ubuntu noble/main arm64 libxss1 arm64 1:1.2.3-1build2 [8252 B]
430s Get:66 http://ftpmaster.internal/ubuntu noble/main arm64 libtk8.6 arm64 8.6.14-1 [767 kB]
430s Get:67 http://ftpmaster.internal/ubuntu noble/main arm64 tk8.6-blt2.5 arm64 2.5.3+dfsg-7 [618 kB]
430s Get:68 http://ftpmaster.internal/ubuntu noble/main arm64 blt arm64 2.5.3+dfsg-7 [4826 B]
430s Get:69 http://ftpmaster.internal/ubuntu noble/main arm64 python3-tk arm64 3.11.5-1 [112 kB]
430s Get:70 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pil.imagetk arm64 10.2.0-1 [9708 B]
430s Get:71 http://ftpmaster.internal/ubuntu noble/main arm64 libpython3.11-stdlib arm64 3.11.8-1 [1913 kB]
430s Get:72 http://ftpmaster.internal/ubuntu noble/main arm64 python3.11 arm64 3.11.8-1 [589 kB]
430s Get:73 http://ftpmaster.internal/ubuntu noble/main arm64 libblas3 arm64 3.12.0-3 [143 kB]
430s Get:74 http://ftpmaster.internal/ubuntu noble/main arm64 libgfortran5 arm64 14-20240303-1ubuntu1 [444 kB]
430s Get:75 http://ftpmaster.internal/ubuntu noble/main arm64 liblapack3 arm64 3.12.0-3 [2241 kB]
430s Get:76 http://ftpmaster.internal/ubuntu noble/main arm64 python3-numpy arm64 1:1.24.2-2 [4525 kB]
430s Get:77 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-contourpy arm64 1.0.7-1build2 [244 kB]
430s Get:78 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-cycler all 0.11.0-2 [8202 B]
430s Get:79 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-brotli arm64 1.1.0-2 [345 kB]
430s Get:80 http://ftpmaster.internal/ubuntu noble/universe arm64 liblbfgsb0 arm64 3.0+dfsg.4-1 [27.7 kB]
430s Get:81 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-scipy arm64 1.11.4-6 [18.6 MB]
431s Get:82 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ufolib2 all 0.16.0+dfsg1-1 [33.5 kB]
431s Get:83 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-mpmath all 1.2.1-3 [421 kB]
431s Get:84 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-sympy all 1.12-7 [3966 kB]
431s Get:85 http://ftpmaster.internal/ubuntu noble/main arm64 python3-appdirs all 1.4.4-4 [10.9 kB]
431s Get:86 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fs all 2.4.16-3 [91.1 kB]
431s Get:87 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lz4 arm64 4.0.2+dfsg-1build2 [28.4 kB]
431s Get:88 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-unicodedata2 arm64 15.1.0+ds-1 [362 kB]
431s Get:89 http://ftpmaster.internal/ubuntu noble/universe arm64 unicode-data all 15.1.0-1 [8878 kB]
431s Get:90 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fonttools arm64 4.46.0-1 [1625 kB]
431s Get:91 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-kiwisolver arm64 1.4.4-2 [48.5 kB]
431s Get:92 http://ftpmaster.internal/ubuntu noble/main arm64 python3-packaging all 23.2-1 [40.6 kB]
431s Get:93 http://ftpmaster.internal/ubuntu noble/universe arm64 libqhull-r8.0 arm64 2020.2-6 [188 kB]
431s Get:94 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib arm64 3.6.3-1ubuntu3 [7291 kB]
431s Get:95 http://ftpmaster.internal/ubuntu noble/main arm64 python3-networkx all 2.8.8-1ubuntu1 [1468 kB]
431s Get:96 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-oscrypto all 1.3.0-5 [168 kB]
431s Get:97 http://ftpmaster.internal/ubuntu noble/universe arm64 libann0 arm64 1.1.2+doc-9 [25.1 kB]
431s Get:98 http://ftpmaster.internal/ubuntu noble/universe arm64 libcdt5 arm64 2.42.2-8build1 [20.3 kB]
431s Get:99 http://ftpmaster.internal/ubuntu noble/universe arm64 libcgraph6 arm64 2.42.2-8build1 [44.8 kB]
431s Get:100 http://ftpmaster.internal/ubuntu noble/main arm64 libxpm4 arm64 1:3.5.17-1 [34.5 kB]
431s Get:101 http://ftpmaster.internal/ubuntu noble/main arm64 libgd3 arm64 2.3.3-9ubuntu1 [119 kB]
431s Get:102 http://ftpmaster.internal/ubuntu noble/universe arm64 libgts-0.7-5 arm64 0.7.6+darcs121130-5 [157 kB]
431s Get:103 http://ftpmaster.internal/ubuntu noble/main arm64 libpixman-1-0 arm64 0.42.2-1 [193 kB]
432s Get:104 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-render0 arm64 1.15-1 [16.1 kB]
432s Get:105 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-shm0 arm64 1.15-1 [5780 B]
432s Get:106 http://ftpmaster.internal/ubuntu noble/main arm64 libcairo2 arm64 1.18.0-1 [550 kB]
432s Get:107 http://ftpmaster.internal/ubuntu noble/main arm64 libltdl7 arm64 2.4.7-7 [40.3 kB]
432s Get:108 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig arm64 2.15.0-1ubuntu1 [190 kB]
432s Get:109 http://ftpmaster.internal/ubuntu noble/main arm64 libthai-data all 0.1.29-2 [158 kB]
432s Get:110 http://ftpmaster.internal/ubuntu noble/main arm64 libdatrie1 arm64 0.2.13-3 [21.7 kB]
432s Get:111 http://ftpmaster.internal/ubuntu noble/main arm64 libthai0 arm64 0.1.29-2 [18.1 kB]
432s Get:112 http://ftpmaster.internal/ubuntu noble/main arm64 libpango-1.0-0 arm64 1.51.0+ds-4 [226 kB]
432s Get:113 http://ftpmaster.internal/ubuntu noble/main arm64 libpangoft2-1.0-0 arm64 1.51.0+ds-4 [41.2 kB]
432s Get:114 http://ftpmaster.internal/ubuntu noble/main arm64 libpangocairo-1.0-0 arm64 1.51.0+ds-4 [27.6 kB]
432s Get:115 http://ftpmaster.internal/ubuntu noble/universe arm64 libpathplan4 arm64 2.42.2-8build1 [22.6 kB]
432s Get:116 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvc6 arm64 2.42.2-8build1 [692 kB]
432s Get:117 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvpr2 arm64 2.42.2-8build1 [187 kB]
432s Get:118 http://ftpmaster.internal/ubuntu noble/universe arm64 liblab-gamut1 arm64 2.42.2-8build1 [1860 kB]
432s Get:119 http://ftpmaster.internal/ubuntu noble/main arm64 libice6 arm64 2:1.0.10-1build2 [41.7 kB]
432s Get:120 http://ftpmaster.internal/ubuntu noble/main arm64 libsm6 arm64 2:1.2.3-1build2 [16.1 kB]
432s Get:121 http://ftpmaster.internal/ubuntu noble/main arm64 libxt6 arm64 1:1.2.1-1.1 [167 kB]
432s Get:122 http://ftpmaster.internal/ubuntu noble/main arm64 libxmu6 arm64 2:1.1.3-3 [48.9 kB]
432s Get:123 http://ftpmaster.internal/ubuntu noble/main arm64 libxaw7 arm64 2:1.0.14-1 [184 kB]
432s Get:124 http://ftpmaster.internal/ubuntu noble/universe arm64 graphviz arm64 2.42.2-8build1 [613 kB]
432s Get:125 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pydot all 1.4.2-2 [24.4 kB]
432s Get:126 http://ftpmaster.internal/ubuntu noble/universe arm64 androguard all 3.4.0~a1-10 [36.7 MB]
433s Get:127 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libart arm64 13.0.0+r63-2 [2124 kB]
433s Get:128 http://ftpmaster.internal/ubuntu noble/universe arm64 android-liblog arm64 1:33.0.3-2 [35.2 kB]
433s Get:129 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libbase arm64 1:33.0.3-2 [93.2 kB]
433s Get:130 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libbacktrace arm64 1:33.0.3-2 [226 kB]
433s Get:131 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libnativebridge arm64 1:13.0.0+r63-2 [14.4 kB]
433s Get:132 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libnativeloader arm64 1:13.0.0+r63-2 [6304 B]
433s Get:133 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libziparchive arm64 1:33.0.3-2 [38.4 kB]
433s Get:134 http://ftpmaster.internal/ubuntu noble/main arm64 ca-certificates-java all 20240118 [11.6 kB]
433s Get:135 http://ftpmaster.internal/ubuntu noble/main arm64 java-common all 0.75+exp1 [6798 B]
433s Get:136 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common-data arm64 0.8-13ubuntu2 [29.5 kB]
433s Get:137 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common3 arm64 0.8-13ubuntu2 [23.2 kB]
433s Get:138 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-client3 arm64 0.8-13ubuntu2 [27.3 kB]
433s Get:139 http://ftpmaster.internal/ubuntu noble/main arm64 libcups2 arm64 2.4.6-0ubuntu3 [270 kB]
433s Get:140 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2-data all 1.2.10-3build1 [20.7 kB]
433s Get:141 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2 arm64 1.2.10-3build1 [386 kB]
433s Get:142 http://ftpmaster.internal/ubuntu noble/main arm64 libpcsclite1 arm64 2.0.0-1 [21.2 kB]
433s Get:143 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre-headless arm64 21.0.2+13-2 [45.8 MB]
434s Get:144 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre-headless arm64 2:1.21-75+exp1 [3096 B]
434s Get:145 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-common all 2.24.33-2ubuntu2 [125 kB]
434s Get:146 http://ftpmaster.internal/ubuntu noble/main arm64 at-spi2-common all 2.50.0-1 [7864 B]
434s Get:147 http://ftpmaster.internal/ubuntu noble/main arm64 libatk1.0-0 arm64 2.50.0-1 [53.8 kB]
434s Get:148 http://ftpmaster.internal/ubuntu noble/main arm64 libxcomposite1 arm64 1:0.4.5-1build2 [7080 B]
434s Get:149 http://ftpmaster.internal/ubuntu noble/main arm64 libxfixes3 arm64 1:6.0.0-2 [11.0 kB]
434s Get:150 http://ftpmaster.internal/ubuntu noble/main arm64 libxcursor1 arm64 1:1.2.1-1 [21.3 kB]
434s Get:151 http://ftpmaster.internal/ubuntu noble/main arm64 libxdamage1 arm64 1:1.1.6-1 [6032 B]
434s Get:152 http://ftpmaster.internal/ubuntu noble/main arm64 libxi6 arm64 2:1.8.1-1 [31.9 kB]
434s Get:153 http://ftpmaster.internal/ubuntu noble/main arm64 libxinerama1 arm64 2:1.1.4-3 [7056 B]
434s Get:154 http://ftpmaster.internal/ubuntu noble/main arm64 libxrandr2 arm64 2:1.5.2-2 [19.6 kB]
434s Get:155 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-0 arm64 2.24.33-2ubuntu2 [1981 kB]
434s Get:156 http://ftpmaster.internal/ubuntu noble/main arm64 libglvnd0 arm64 1.7.0-1 [60.0 kB]
434s Get:157 http://ftpmaster.internal/ubuntu noble/main arm64 libglapi-mesa arm64 24.0.1-1ubuntu1 [57.8 kB]
434s Get:158 http://ftpmaster.internal/ubuntu noble/main arm64 libx11-xcb1 arm64 2:1.8.7-1 [7836 B]
434s Get:159 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri2-0 arm64 1.15-1 [7244 B]
434s Get:160 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri3-0 arm64 1.15-1 [7108 B]
434s Get:161 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-glx0 arm64 1.15-1 [25.2 kB]
434s Get:162 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-present0 arm64 1.15-1 [5732 B]
434s Get:163 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-randr0 arm64 1.15-1 [18.2 kB]
434s Get:164 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-sync1 arm64 1.15-1 [9412 B]
434s Get:165 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-xfixes0 arm64 1.15-1 [10.3 kB]
434s Get:166 http://ftpmaster.internal/ubuntu noble/main arm64 libxshmfence1 arm64 1.3-1build4 [5444 B]
434s Get:167 http://ftpmaster.internal/ubuntu noble/main arm64 libxxf86vm1 arm64 1:1.1.4-1build3 [10.3 kB]
434s Get:168 http://ftpmaster.internal/ubuntu noble/main arm64 libvulkan1 arm64 1.3.275.0-1 [150 kB]
434s Get:169 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-amdgpu1 arm64 2.4.120-2 [20.4 kB]
434s Get:170 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-nouveau2 arm64 2.4.120-2 [17.8 kB]
434s Get:171 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-radeon1 arm64 2.4.120-2 [20.9 kB]
434s Get:172 http://ftpmaster.internal/ubuntu noble/main arm64 libllvm17 arm64 1:17.0.6-5build1 [25.0 MB]
435s Get:173 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1-mesa-dri arm64 24.0.1-1ubuntu1 [8226 kB]
435s Get:174 http://ftpmaster.internal/ubuntu noble/main arm64 libglx-mesa0 arm64 24.0.1-1ubuntu1 [166 kB]
435s Get:175 http://ftpmaster.internal/ubuntu noble/main arm64 libglx0 arm64 1.7.0-1 [32.4 kB]
435s Get:176 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1 arm64 1.7.0-1 [107 kB]
435s Get:177 http://ftpmaster.internal/ubuntu noble/main arm64 libgif7 arm64 5.2.1-2.5 [34.2 kB]
435s Get:178 http://ftpmaster.internal/ubuntu noble/main arm64 libxtst6 arm64 2:1.2.3-1.1 [13.7 kB]
435s Get:179 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre arm64 21.0.2+13-2 [226 kB]
435s Get:180 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre arm64 2:1.21-75+exp1 [922 B]
435s Get:181 http://ftpmaster.internal/ubuntu noble/universe arm64 libapksig-java all 31.0.2-1ubuntu1 [406 kB]
435s Get:182 http://ftpmaster.internal/ubuntu noble/universe arm64 apksigner all 31.0.2-1ubuntu1 [444 kB]
435s Get:183 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jdk-headless arm64 21.0.2+13-2 [81.6 MB]
437s Get:184 http://ftpmaster.internal/ubuntu noble/main arm64 default-jdk-headless arm64 2:1.21-75+exp1 [960 B]
437s Get:185 http://ftpmaster.internal/ubuntu noble/main arm64 libatomic1 arm64 14-20240303-1ubuntu1 [11.4 kB]
437s Get:186 http://ftpmaster.internal/ubuntu noble/universe arm64 dexdump arm64 13.0.0+r63-2 [38.6 kB]
437s Get:187 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-args all 0.1.0-5 [6082 B]
437s Get:188 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-clint all 0.5.1-4 [27.8 kB]
437s Get:189 http://ftpmaster.internal/ubuntu noble/main arm64 python3-defusedxml all 0.7.1-2 [42.0 kB]
437s Get:190 http://ftpmaster.internal/ubuntu noble/main arm64 liberror-perl all 0.17029-2 [25.6 kB]
437s Get:191 http://ftpmaster.internal/ubuntu noble/main arm64 git-man all 1:2.43.0-1ubuntu1 [1100 kB]
437s Get:192 http://ftpmaster.internal/ubuntu noble/main arm64 git arm64 1:2.43.0-1ubuntu1 [3786 kB]
437s Get:193 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-smmap all 6.0.0-1 [20.5 kB]
437s Get:194 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-gitdb all 4.0.11-1 [46.2 kB]
437s Get:195 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-git all 3.1.37-3 [138 kB]
437s Get:196 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lockfile all 1:0.12.2-3 [13.7 kB]
437s Get:197 http://ftpmaster.internal/ubuntu noble/main arm64 python3-simplejson arm64 3.19.2-1build1 [61.4 kB]
437s Get:198 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-libcloud all 3.4.1-5 [751 kB]
437s Get:199 http://ftpmaster.internal/ubuntu noble/main arm64 python3-bcrypt arm64 3.2.2-1 [28.8 kB]
437s Get:200 http://ftpmaster.internal/ubuntu noble/main arm64 libsodium23 arm64 1.0.18-1build2 [123 kB]
437s Get:201 http://ftpmaster.internal/ubuntu noble/main arm64 python3-nacl arm64 1.5.0-4 [55.5 kB]
437s Get:202 http://ftpmaster.internal/ubuntu noble/main arm64 python3-paramiko all 2.12.0-2ubuntu4 [137 kB]
437s Get:203 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1 all 0.4.8-4 [51.2 kB]
437s Get:204 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1-modules all 0.2.8-1 [68.0 kB]
437s Get:205 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-png all 0.20231004.0-2 [30.2 kB]
437s Get:206 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-qrcode all 7.4.2-4 [40.1 kB]
437s Get:207 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml.clib arm64 0.2.8-1 [187 kB]
438s Get:208 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml all 0.17.21-1 [86.6 kB]
438s Get:209 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pathspec all 0.12.1-1 [24.5 kB]
438s Get:210 http://ftpmaster.internal/ubuntu noble/universe arm64 yamllint all 1.33.0-1 [47.2 kB]
438s Get:211 http://ftpmaster.internal/ubuntu noble/universe arm64 fdroidserver all 2.2.1-2 [362 kB]
439s Fetched 292 MB in 9s (32.2 MB/s)
439s Selecting previously unselected package libpython3.11-minimal:arm64.
439s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 74375 files and directories currently installed.)
439s Preparing to unpack .../000-libpython3.11-minimal_3.11.8-1_arm64.deb ...
439s Unpacking libpython3.11-minimal:arm64 (3.11.8-1) ...
439s Selecting previously unselected package python3.11-minimal.
439s Preparing to unpack .../001-python3.11-minimal_3.11.8-1_arm64.deb ...
439s Unpacking python3.11-minimal (3.11.8-1) ...
439s Selecting previously unselected package libgdk-pixbuf2.0-common.
439s Preparing to unpack .../002-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ...
439s Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ...
439s Selecting previously unselected package libjpeg-turbo8:arm64.
439s Preparing to unpack .../003-libjpeg-turbo8_2.1.5-2ubuntu1_arm64.deb ...
439s Unpacking libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ...
439s Selecting previously unselected package libjpeg8:arm64.
439s Preparing to unpack .../004-libjpeg8_8c-2ubuntu11_arm64.deb ...
439s Unpacking libjpeg8:arm64 (8c-2ubuntu11) ...
439s Selecting previously unselected package libdeflate0:arm64.
439s Preparing to unpack .../005-libdeflate0_1.19-1_arm64.deb ...
439s Unpacking libdeflate0:arm64 (1.19-1) ...
439s Selecting previously unselected package libjbig0:arm64.
439s Preparing to unpack .../006-libjbig0_2.1-6.1ubuntu1_arm64.deb ...
439s Unpacking libjbig0:arm64 (2.1-6.1ubuntu1) ...
439s Selecting previously unselected package liblerc4:arm64.
439s Preparing to unpack .../007-liblerc4_4.0.0+ds-4ubuntu1_arm64.deb ...
439s Unpacking liblerc4:arm64 (4.0.0+ds-4ubuntu1) ...
439s Selecting previously unselected package libsharpyuv0:arm64.
439s Preparing to unpack .../008-libsharpyuv0_1.3.2-0.4_arm64.deb ...
439s Unpacking libsharpyuv0:arm64 (1.3.2-0.4) ...
439s Selecting previously unselected package libwebp7:arm64.
439s Preparing to unpack .../009-libwebp7_1.3.2-0.4_arm64.deb ...
439s Unpacking libwebp7:arm64 (1.3.2-0.4) ...
439s Selecting previously unselected package libtiff6:arm64.
439s Preparing to unpack .../010-libtiff6_4.5.1+git230720-3ubuntu1_arm64.deb ...
439s Unpacking libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ...
439s Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64.
439s Preparing to unpack .../011-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3_arm64.deb ...
439s Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ...
439s Selecting previously unselected package gtk-update-icon-cache.
439s Preparing to unpack .../012-gtk-update-icon-cache_3.24.40-2ubuntu1_arm64.deb ...
439s Unpacking gtk-update-icon-cache (3.24.40-2ubuntu1) ...
439s Selecting previously unselected package hicolor-icon-theme.
439s Preparing to unpack .../013-hicolor-icon-theme_0.17-2_all.deb ...
439s Unpacking hicolor-icon-theme (0.17-2) ...
439s Selecting previously unselected package humanity-icon-theme.
439s Preparing to unpack .../014-humanity-icon-theme_0.6.16_all.deb ...
439s Unpacking humanity-icon-theme (0.6.16) ...
440s Selecting previously unselected package ubuntu-mono.
440s Preparing to unpack .../015-ubuntu-mono_24.04-0ubuntu1_all.deb ...
440s Unpacking ubuntu-mono (24.04-0ubuntu1) ...
440s Selecting previously unselected package adwaita-icon-theme.
440s Preparing to unpack .../016-adwaita-icon-theme_46~rc-1_all.deb ...
440s Unpacking adwaita-icon-theme (46~rc-1) ...
440s Selecting previously unselected package python3-asn1crypto.
440s Preparing to unpack .../017-python3-asn1crypto_1.5.1-3_all.deb ...
440s Unpacking python3-asn1crypto (1.5.1-3) ...
440s Selecting previously unselected package python3-colorama.
440s Preparing to unpack .../018-python3-colorama_0.4.6-4_all.deb ...
440s Unpacking python3-colorama (0.4.6-4) ...
440s Selecting previously unselected package python3-click.
440s Preparing to unpack .../019-python3-click_8.1.6-1_all.deb ...
440s Unpacking python3-click (8.1.6-1) ...
440s Selecting previously unselected package python3-decorator.
440s Preparing to unpack .../020-python3-decorator_5.1.1-5_all.deb ...
440s Unpacking python3-decorator (5.1.1-5) ...
440s Selecting previously unselected package python3-parso.
440s Preparing to unpack .../021-python3-parso_0.8.3-1_all.deb ...
440s Unpacking python3-parso (0.8.3-1) ...
440s Selecting previously unselected package python3-jedi.
440s Preparing to unpack .../022-python3-jedi_0.18.2-1ubuntu1_all.deb ...
440s Unpacking python3-jedi (0.18.2-1ubuntu1) ...
441s Selecting previously unselected package python3-traitlets.
441s Preparing to unpack .../023-python3-traitlets_5.5.0-2_all.deb ...
441s Unpacking python3-traitlets (5.5.0-2) ...
441s Selecting previously unselected package python3-matplotlib-inline.
441s Preparing to unpack .../024-python3-matplotlib-inline_0.1.6-2_all.deb ...
441s Unpacking python3-matplotlib-inline (0.1.6-2) ...
441s Selecting previously unselected package python3-ptyprocess.
441s Preparing to unpack .../025-python3-ptyprocess_0.7.0-5_all.deb ...
441s Unpacking python3-ptyprocess (0.7.0-5) ...
441s Selecting previously unselected package python3-pexpect.
441s Preparing to unpack .../026-python3-pexpect_4.9-2_all.deb ...
441s Unpacking python3-pexpect (4.9-2) ...
441s Selecting previously unselected package python3-wcwidth.
441s Preparing to unpack .../027-python3-wcwidth_0.2.5+dfsg1-1.1ubuntu1_all.deb ...
441s Unpacking python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ...
441s Selecting previously unselected package python3-prompt-toolkit.
441s Preparing to unpack .../028-python3-prompt-toolkit_3.0.43-1_all.deb ...
441s Unpacking python3-prompt-toolkit (3.0.43-1) ...
441s Selecting previously unselected package python3-asttokens.
441s Preparing to unpack .../029-python3-asttokens_2.4.1-1_all.deb ...
441s Unpacking python3-asttokens (2.4.1-1) ...
441s Selecting previously unselected package python3-executing.
441s Preparing to unpack .../030-python3-executing_2.0.1-0.1_all.deb ...
441s Unpacking python3-executing (2.0.1-0.1) ...
441s Selecting previously unselected package python3-pure-eval.
441s Preparing to unpack .../031-python3-pure-eval_0.2.2-1_all.deb ...
441s Unpacking python3-pure-eval (0.2.2-1) ...
441s Selecting previously unselected package python3-stack-data.
441s Preparing to unpack .../032-python3-stack-data_0.6.3-1_all.deb ...
441s Unpacking python3-stack-data (0.6.3-1) ...
441s Selecting previously unselected package python3-lib2to3.
441s Preparing to unpack .../033-python3-lib2to3_3.11.5-1_all.deb ...
441s Unpacking python3-lib2to3 (3.11.5-1) ...
441s Selecting previously unselected package python3-distutils.
441s Preparing to unpack .../034-python3-distutils_3.11.5-1_all.deb ...
441s Unpacking python3-distutils (3.11.5-1) ...
441s Selecting previously unselected package python3-setuptools.
441s Preparing to unpack .../035-python3-setuptools_68.1.2-2_all.deb ...
441s Unpacking python3-setuptools (68.1.2-2) ...
441s Selecting previously unselected package python3-ipython.
441s Preparing to unpack .../036-python3-ipython_8.20.0-1_all.deb ...
441s Unpacking python3-ipython (8.20.0-1) ...
441s Selecting previously unselected package libxslt1.1:arm64.
441s Preparing to unpack .../037-libxslt1.1_1.1.39-0exp1_arm64.deb ...
441s Unpacking libxslt1.1:arm64 (1.1.39-0exp1) ...
441s Selecting previously unselected package python3-lxml:arm64.
441s Preparing to unpack .../038-python3-lxml_5.1.0-1_arm64.deb ...
441s Unpacking python3-lxml:arm64 (5.1.0-1) ...
441s Selecting previously unselected package python3-magic.
441s Preparing to unpack .../039-python3-magic_2%3a0.4.27-2_all.deb ...
441s Unpacking python3-magic (2:0.4.27-2) ...
441s Selecting previously unselected package libjs-jquery.
441s Preparing to unpack .../040-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ...
441s Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
441s Selecting previously unselected package libjs-jquery-ui.
441s Preparing to unpack .../041-libjs-jquery-ui_1.13.2+dfsg-1_all.deb ...
441s Unpacking libjs-jquery-ui (1.13.2+dfsg-1) ...
441s Selecting previously unselected package fonts-dejavu-mono.
441s Preparing to unpack .../042-fonts-dejavu-mono_2.37-8_all.deb ...
441s Unpacking fonts-dejavu-mono (2.37-8) ...
441s Selecting previously unselected package fonts-dejavu-core.
441s Preparing to unpack .../043-fonts-dejavu-core_2.37-8_all.deb ...
442s Unpacking fonts-dejavu-core (2.37-8) ...
442s Selecting previously unselected package fonts-lyx.
442s Preparing to unpack .../044-fonts-lyx_2.4.0~RC3-1_all.deb ...
442s Unpacking fonts-lyx (2.4.0~RC3-1) ...
442s Selecting previously unselected package python-matplotlib-data.
442s Preparing to unpack .../045-python-matplotlib-data_3.6.3-1ubuntu3_all.deb ...
442s Unpacking python-matplotlib-data (3.6.3-1ubuntu3) ...
442s Selecting previously unselected package python3-dateutil.
442s Preparing to unpack .../046-python3-dateutil_2.8.2-3_all.deb ...
442s Unpacking python3-dateutil (2.8.2-3) ...
442s Selecting previously unselected package libgomp1:arm64.
442s Preparing to unpack .../047-libgomp1_14-20240303-1ubuntu1_arm64.deb ...
442s Unpacking libgomp1:arm64 (14-20240303-1ubuntu1) ...
442s Selecting previously unselected package libimagequant0:arm64.
442s Preparing to unpack .../048-libimagequant0_2.18.0-1_arm64.deb ...
442s Unpacking libimagequant0:arm64 (2.18.0-1) ...
442s Selecting previously unselected package liblcms2-2:arm64.
442s Preparing to unpack .../049-liblcms2-2_2.14-2_arm64.deb ...
442s Unpacking liblcms2-2:arm64 (2.14-2) ...
442s Selecting previously unselected package libopenjp2-7:arm64.
442s Preparing to unpack .../050-libopenjp2-7_2.5.0-2_arm64.deb ...
442s Unpacking libopenjp2-7:arm64 (2.5.0-2) ...
442s Selecting previously unselected package libgraphite2-3:arm64.
442s Preparing to unpack .../051-libgraphite2-3_1.3.14-2_arm64.deb ...
442s Unpacking libgraphite2-3:arm64 (1.3.14-2) ...
442s Selecting previously unselected package libharfbuzz0b:arm64.
442s Preparing to unpack .../052-libharfbuzz0b_8.3.0-2_arm64.deb ...
442s Unpacking libharfbuzz0b:arm64 (8.3.0-2) ...
442s Selecting previously unselected package libraqm0:arm64.
442s Preparing to unpack .../053-libraqm0_0.10.1-1_arm64.deb ...
442s Unpacking libraqm0:arm64 (0.10.1-1) ...
442s Selecting previously unselected package libwebpdemux2:arm64.
442s Preparing to unpack .../054-libwebpdemux2_1.3.2-0.4_arm64.deb ...
442s Unpacking libwebpdemux2:arm64 (1.3.2-0.4) ...
442s Selecting previously unselected package libwebpmux3:arm64.
442s Preparing to unpack .../055-libwebpmux3_1.3.2-0.4_arm64.deb ...
442s Unpacking libwebpmux3:arm64 (1.3.2-0.4) ...
442s Selecting previously unselected package python3-pil:arm64.
442s Preparing to unpack .../056-python3-pil_10.2.0-1_arm64.deb ...
442s Unpacking python3-pil:arm64 (10.2.0-1) ...
442s Selecting previously unselected package libtcl8.6:arm64.
442s Preparing to unpack .../057-libtcl8.6_8.6.13+dfsg-2_arm64.deb ...
442s Unpacking libtcl8.6:arm64 (8.6.13+dfsg-2) ...
442s Selecting previously unselected package fontconfig-config.
442s Preparing to unpack .../058-fontconfig-config_2.15.0-1ubuntu1_arm64.deb ...
442s Unpacking fontconfig-config (2.15.0-1ubuntu1) ...
442s Selecting previously unselected package libfontconfig1:arm64.
442s Preparing to unpack .../059-libfontconfig1_2.15.0-1ubuntu1_arm64.deb ...
442s Unpacking libfontconfig1:arm64 (2.15.0-1ubuntu1) ...
442s Selecting previously unselected package libxrender1:arm64.
442s Preparing to unpack .../060-libxrender1_1%3a0.9.10-1.1_arm64.deb ...
442s Unpacking libxrender1:arm64 (1:0.9.10-1.1) ...
442s Selecting previously unselected package libxft2:arm64.
442s Preparing to unpack .../061-libxft2_2.3.6-1_arm64.deb ...
442s Unpacking libxft2:arm64 (2.3.6-1) ...
442s Selecting previously unselected package x11-common.
442s Preparing to unpack .../062-x11-common_1%3a7.7+23ubuntu2_all.deb ...
442s Unpacking x11-common (1:7.7+23ubuntu2) ...
442s Selecting previously unselected package libxss1:arm64.
442s Preparing to unpack .../063-libxss1_1%3a1.2.3-1build2_arm64.deb ...
442s Unpacking libxss1:arm64 (1:1.2.3-1build2) ...
442s Selecting previously unselected package libtk8.6:arm64.
442s Preparing to unpack .../064-libtk8.6_8.6.14-1_arm64.deb ...
442s Unpacking libtk8.6:arm64 (8.6.14-1) ...
443s Selecting previously unselected package tk8.6-blt2.5.
443s Preparing to unpack .../065-tk8.6-blt2.5_2.5.3+dfsg-7_arm64.deb ...
443s Unpacking tk8.6-blt2.5 (2.5.3+dfsg-7) ...
443s Selecting previously unselected package blt.
443s Preparing to unpack .../066-blt_2.5.3+dfsg-7_arm64.deb ...
443s Unpacking blt (2.5.3+dfsg-7) ...
443s Selecting previously unselected package python3-tk:arm64.
443s Preparing to unpack .../067-python3-tk_3.11.5-1_arm64.deb ...
443s Unpacking python3-tk:arm64 (3.11.5-1) ...
443s Selecting previously unselected package python3-pil.imagetk:arm64.
443s Preparing to unpack .../068-python3-pil.imagetk_10.2.0-1_arm64.deb ...
443s Unpacking python3-pil.imagetk:arm64 (10.2.0-1) ...
443s Selecting previously unselected package libpython3.11-stdlib:arm64.
443s Preparing to unpack .../069-libpython3.11-stdlib_3.11.8-1_arm64.deb ...
443s Unpacking libpython3.11-stdlib:arm64 (3.11.8-1) ...
443s Selecting previously unselected package python3.11.
443s Preparing to unpack .../070-python3.11_3.11.8-1_arm64.deb ...
443s Unpacking python3.11 (3.11.8-1) ...
443s Selecting previously unselected package libblas3:arm64.
443s Preparing to unpack .../071-libblas3_3.12.0-3_arm64.deb ...
443s Unpacking libblas3:arm64 (3.12.0-3) ...
443s Selecting previously unselected package libgfortran5:arm64.
443s Preparing to unpack .../072-libgfortran5_14-20240303-1ubuntu1_arm64.deb ...
443s Unpacking libgfortran5:arm64 (14-20240303-1ubuntu1) ...
443s Selecting previously unselected package liblapack3:arm64.
443s Preparing to unpack .../073-liblapack3_3.12.0-3_arm64.deb ...
443s Unpacking liblapack3:arm64 (3.12.0-3) ...
443s Selecting previously unselected package python3-numpy.
443s Preparing to unpack .../074-python3-numpy_1%3a1.24.2-2_arm64.deb ...
443s Unpacking python3-numpy (1:1.24.2-2) ...
443s Selecting previously unselected package python3-contourpy.
443s Preparing to unpack .../075-python3-contourpy_1.0.7-1build2_arm64.deb ...
443s Unpacking python3-contourpy (1.0.7-1build2) ...
443s Selecting previously unselected package python3-cycler.
443s Preparing to unpack .../076-python3-cycler_0.11.0-2_all.deb ...
443s Unpacking python3-cycler (0.11.0-2) ...
443s Selecting previously unselected package python3-brotli.
443s Preparing to unpack .../077-python3-brotli_1.1.0-2_arm64.deb ...
443s Unpacking python3-brotli (1.1.0-2) ...
443s Selecting previously unselected package liblbfgsb0:arm64.
443s Preparing to unpack .../078-liblbfgsb0_3.0+dfsg.4-1_arm64.deb ...
443s Unpacking liblbfgsb0:arm64 (3.0+dfsg.4-1) ...
443s Selecting previously unselected package python3-scipy.
443s Preparing to unpack .../079-python3-scipy_1.11.4-6_arm64.deb ...
443s Unpacking python3-scipy (1.11.4-6) ...
444s Selecting previously unselected package python3-ufolib2.
444s Preparing to unpack .../080-python3-ufolib2_0.16.0+dfsg1-1_all.deb ...
444s Unpacking python3-ufolib2 (0.16.0+dfsg1-1) ...
444s Selecting previously unselected package python3-mpmath.
444s Preparing to unpack .../081-python3-mpmath_1.2.1-3_all.deb ...
444s Unpacking python3-mpmath (1.2.1-3) ...
444s Selecting previously unselected package python3-sympy.
444s Preparing to unpack .../082-python3-sympy_1.12-7_all.deb ...
444s Unpacking python3-sympy (1.12-7) ...
444s Selecting previously unselected package python3-appdirs.
444s Preparing to unpack .../083-python3-appdirs_1.4.4-4_all.deb ...
444s Unpacking python3-appdirs (1.4.4-4) ...
444s Selecting previously unselected package python3-fs.
444s Preparing to unpack .../084-python3-fs_2.4.16-3_all.deb ...
444s Unpacking python3-fs (2.4.16-3) ...
444s Selecting previously unselected package python3-lz4.
444s Preparing to unpack .../085-python3-lz4_4.0.2+dfsg-1build2_arm64.deb ...
444s Unpacking python3-lz4 (4.0.2+dfsg-1build2) ...
444s Selecting previously unselected package python3-unicodedata2.
444s Preparing to unpack .../086-python3-unicodedata2_15.1.0+ds-1_arm64.deb ...
444s Unpacking python3-unicodedata2 (15.1.0+ds-1) ...
444s Selecting previously unselected package unicode-data.
444s Preparing to unpack .../087-unicode-data_15.1.0-1_all.deb ...
444s Unpacking unicode-data (15.1.0-1) ...
444s Selecting previously unselected package python3-fonttools.
444s Preparing to unpack .../088-python3-fonttools_4.46.0-1_arm64.deb ...
444s Unpacking python3-fonttools (4.46.0-1) ...
444s Selecting previously unselected package python3-kiwisolver.
444s Preparing to unpack .../089-python3-kiwisolver_1.4.4-2_arm64.deb ...
444s Unpacking python3-kiwisolver (1.4.4-2) ...
444s Selecting previously unselected package python3-packaging.
444s Preparing to unpack .../090-python3-packaging_23.2-1_all.deb ...
444s Unpacking python3-packaging (23.2-1) ...
444s Selecting previously unselected package libqhull-r8.0:arm64.
445s Preparing to unpack .../091-libqhull-r8.0_2020.2-6_arm64.deb ...
445s Unpacking libqhull-r8.0:arm64 (2020.2-6) ...
445s Selecting previously unselected package python3-matplotlib.
445s Preparing to unpack .../092-python3-matplotlib_3.6.3-1ubuntu3_arm64.deb ...
445s Unpacking python3-matplotlib (3.6.3-1ubuntu3) ...
445s Selecting previously unselected package python3-networkx.
445s Preparing to unpack .../093-python3-networkx_2.8.8-1ubuntu1_all.deb ...
445s Unpacking python3-networkx (2.8.8-1ubuntu1) ...
445s Selecting previously unselected package python3-oscrypto.
445s Preparing to unpack .../094-python3-oscrypto_1.3.0-5_all.deb ...
445s Unpacking python3-oscrypto (1.3.0-5) ...
445s Selecting previously unselected package libann0.
445s Preparing to unpack .../095-libann0_1.1.2+doc-9_arm64.deb ...
445s Unpacking libann0 (1.1.2+doc-9) ...
445s Selecting previously unselected package libcdt5:arm64.
445s Preparing to unpack .../096-libcdt5_2.42.2-8build1_arm64.deb ...
445s Unpacking libcdt5:arm64 (2.42.2-8build1) ...
445s Selecting previously unselected package libcgraph6:arm64.
445s Preparing to unpack .../097-libcgraph6_2.42.2-8build1_arm64.deb ...
445s Unpacking libcgraph6:arm64 (2.42.2-8build1) ...
445s Selecting previously unselected package libxpm4:arm64.
445s Preparing to unpack .../098-libxpm4_1%3a3.5.17-1_arm64.deb ...
445s Unpacking libxpm4:arm64 (1:3.5.17-1) ...
445s Selecting previously unselected package libgd3:arm64.
445s Preparing to unpack .../099-libgd3_2.3.3-9ubuntu1_arm64.deb ...
445s Unpacking libgd3:arm64 (2.3.3-9ubuntu1) ...
445s Selecting previously unselected package libgts-0.7-5:arm64.
445s Preparing to unpack .../100-libgts-0.7-5_0.7.6+darcs121130-5_arm64.deb ...
445s Unpacking libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ...
445s Selecting previously unselected package libpixman-1-0:arm64.
445s Preparing to unpack .../101-libpixman-1-0_0.42.2-1_arm64.deb ...
445s Unpacking libpixman-1-0:arm64 (0.42.2-1) ...
445s Selecting previously unselected package libxcb-render0:arm64.
445s Preparing to unpack .../102-libxcb-render0_1.15-1_arm64.deb ...
445s Unpacking libxcb-render0:arm64 (1.15-1) ...
445s Selecting previously unselected package libxcb-shm0:arm64.
445s Preparing to unpack .../103-libxcb-shm0_1.15-1_arm64.deb ...
445s Unpacking libxcb-shm0:arm64 (1.15-1) ...
445s Selecting previously unselected package libcairo2:arm64.
445s Preparing to unpack .../104-libcairo2_1.18.0-1_arm64.deb ...
445s Unpacking libcairo2:arm64 (1.18.0-1) ...
445s Selecting previously unselected package libltdl7:arm64.
445s Preparing to unpack .../105-libltdl7_2.4.7-7_arm64.deb ...
445s Unpacking libltdl7:arm64 (2.4.7-7) ...
445s Selecting previously unselected package fontconfig.
445s Preparing to unpack .../106-fontconfig_2.15.0-1ubuntu1_arm64.deb ...
445s Unpacking fontconfig (2.15.0-1ubuntu1) ...
445s Selecting previously unselected package libthai-data.
445s Preparing to unpack .../107-libthai-data_0.1.29-2_all.deb ...
445s Unpacking libthai-data (0.1.29-2) ...
445s Selecting previously unselected package libdatrie1:arm64.
445s Preparing to unpack .../108-libdatrie1_0.2.13-3_arm64.deb ...
445s Unpacking libdatrie1:arm64 (0.2.13-3) ...
445s Selecting previously unselected package libthai0:arm64.
445s Preparing to unpack .../109-libthai0_0.1.29-2_arm64.deb ...
445s Unpacking libthai0:arm64 (0.1.29-2) ...
445s Selecting previously unselected package libpango-1.0-0:arm64.
445s Preparing to unpack .../110-libpango-1.0-0_1.51.0+ds-4_arm64.deb ...
445s Unpacking libpango-1.0-0:arm64 (1.51.0+ds-4) ...
445s Selecting previously unselected package libpangoft2-1.0-0:arm64.
445s Preparing to unpack .../111-libpangoft2-1.0-0_1.51.0+ds-4_arm64.deb ...
445s Unpacking libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ...
445s Selecting previously unselected package libpangocairo-1.0-0:arm64.
445s Preparing to unpack .../112-libpangocairo-1.0-0_1.51.0+ds-4_arm64.deb ...
445s Unpacking libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ...
445s Selecting previously unselected package libpathplan4:arm64.
445s Preparing to unpack .../113-libpathplan4_2.42.2-8build1_arm64.deb ...
445s Unpacking libpathplan4:arm64 (2.42.2-8build1) ...
446s Selecting previously unselected package libgvc6.
446s Preparing to unpack .../114-libgvc6_2.42.2-8build1_arm64.deb ...
446s Unpacking libgvc6 (2.42.2-8build1) ...
446s Selecting previously unselected package libgvpr2:arm64.
446s Preparing to unpack .../115-libgvpr2_2.42.2-8build1_arm64.deb ...
446s Unpacking libgvpr2:arm64 (2.42.2-8build1) ...
446s Selecting previously unselected package liblab-gamut1:arm64.
446s Preparing to unpack .../116-liblab-gamut1_2.42.2-8build1_arm64.deb ...
446s Unpacking liblab-gamut1:arm64 (2.42.2-8build1) ...
446s Selecting previously unselected package libice6:arm64.
446s Preparing to unpack .../117-libice6_2%3a1.0.10-1build2_arm64.deb ...
446s Unpacking libice6:arm64 (2:1.0.10-1build2) ...
446s Selecting previously unselected package libsm6:arm64.
446s Preparing to unpack .../118-libsm6_2%3a1.2.3-1build2_arm64.deb ...
446s Unpacking libsm6:arm64 (2:1.2.3-1build2) ...
446s Selecting previously unselected package libxt6:arm64.
446s Preparing to unpack .../119-libxt6_1%3a1.2.1-1.1_arm64.deb ...
446s Unpacking libxt6:arm64 (1:1.2.1-1.1) ...
446s Selecting previously unselected package libxmu6:arm64.
446s Preparing to unpack .../120-libxmu6_2%3a1.1.3-3_arm64.deb ...
446s Unpacking libxmu6:arm64 (2:1.1.3-3) ...
446s Selecting previously unselected package libxaw7:arm64.
446s Preparing to unpack .../121-libxaw7_2%3a1.0.14-1_arm64.deb ...
446s Unpacking libxaw7:arm64 (2:1.0.14-1) ...
446s Selecting previously unselected package graphviz.
446s Preparing to unpack .../122-graphviz_2.42.2-8build1_arm64.deb ...
446s Unpacking graphviz (2.42.2-8build1) ...
446s Selecting previously unselected package python3-pydot.
446s Preparing to unpack .../123-python3-pydot_1.4.2-2_all.deb ...
446s Unpacking python3-pydot (1.4.2-2) ...
446s Selecting previously unselected package androguard.
446s Preparing to unpack .../124-androguard_3.4.0~a1-10_all.deb ...
446s Unpacking androguard (3.4.0~a1-10) ...
446s Selecting previously unselected package android-libart:arm64.
446s Preparing to unpack .../125-android-libart_13.0.0+r63-2_arm64.deb ...
446s Unpacking android-libart:arm64 (13.0.0+r63-2) ...
446s Selecting previously unselected package android-liblog:arm64.
446s Preparing to unpack .../126-android-liblog_1%3a33.0.3-2_arm64.deb ...
446s Unpacking android-liblog:arm64 (1:33.0.3-2) ...
446s Selecting previously unselected package android-libbase:arm64.
446s Preparing to unpack .../127-android-libbase_1%3a33.0.3-2_arm64.deb ...
446s Unpacking android-libbase:arm64 (1:33.0.3-2) ...
446s Selecting previously unselected package android-libbacktrace:arm64.
447s Preparing to unpack .../128-android-libbacktrace_1%3a33.0.3-2_arm64.deb ...
447s Unpacking android-libbacktrace:arm64 (1:33.0.3-2) ...
447s Selecting previously unselected package android-libnativebridge:arm64.
447s Preparing to unpack .../129-android-libnativebridge_1%3a13.0.0+r63-2_arm64.deb ...
447s Unpacking android-libnativebridge:arm64 (1:13.0.0+r63-2) ...
447s Selecting previously unselected package android-libnativeloader:arm64.
447s Preparing to unpack .../130-android-libnativeloader_1%3a13.0.0+r63-2_arm64.deb ...
447s Unpacking android-libnativeloader:arm64 (1:13.0.0+r63-2) ...
447s Selecting previously unselected package android-libziparchive:arm64.
447s Preparing to unpack .../131-android-libziparchive_1%3a33.0.3-2_arm64.deb ...
447s Unpacking android-libziparchive:arm64 (1:33.0.3-2) ...
447s Selecting previously unselected package ca-certificates-java.
447s Preparing to unpack .../132-ca-certificates-java_20240118_all.deb ...
447s Unpacking ca-certificates-java (20240118) ...
447s Selecting previously unselected package java-common.
447s Preparing to unpack .../133-java-common_0.75+exp1_all.deb ...
447s Unpacking java-common (0.75+exp1) ...
447s Selecting previously unselected package libavahi-common-data:arm64.
447s Preparing to unpack .../134-libavahi-common-data_0.8-13ubuntu2_arm64.deb ...
447s Unpacking libavahi-common-data:arm64 (0.8-13ubuntu2) ...
447s Selecting previously unselected package libavahi-common3:arm64.
447s Preparing to unpack .../135-libavahi-common3_0.8-13ubuntu2_arm64.deb ...
447s Unpacking libavahi-common3:arm64 (0.8-13ubuntu2) ...
447s Selecting previously unselected package libavahi-client3:arm64.
447s Preparing to unpack .../136-libavahi-client3_0.8-13ubuntu2_arm64.deb ...
447s Unpacking libavahi-client3:arm64 (0.8-13ubuntu2) ...
447s Selecting previously unselected package libcups2:arm64.
447s Preparing to unpack .../137-libcups2_2.4.6-0ubuntu3_arm64.deb ...
447s Unpacking libcups2:arm64 (2.4.6-0ubuntu3) ...
447s Selecting previously unselected package libasound2-data.
447s Preparing to unpack .../138-libasound2-data_1.2.10-3build1_all.deb ...
447s Unpacking libasound2-data (1.2.10-3build1) ...
447s Selecting previously unselected package libasound2:arm64.
447s Preparing to unpack .../139-libasound2_1.2.10-3build1_arm64.deb ...
447s Unpacking libasound2:arm64 (1.2.10-3build1) ...
447s Selecting previously unselected package libpcsclite1:arm64.
447s Preparing to unpack .../140-libpcsclite1_2.0.0-1_arm64.deb ...
447s Unpacking libpcsclite1:arm64 (2.0.0-1) ...
447s Selecting previously unselected package openjdk-21-jre-headless:arm64.
447s Preparing to unpack .../141-openjdk-21-jre-headless_21.0.2+13-2_arm64.deb ...
447s Unpacking openjdk-21-jre-headless:arm64 (21.0.2+13-2) ...
448s Selecting previously unselected package default-jre-headless.
448s Preparing to unpack .../142-default-jre-headless_2%3a1.21-75+exp1_arm64.deb ...
448s Unpacking default-jre-headless (2:1.21-75+exp1) ...
448s Selecting previously unselected package libgtk2.0-common.
448s Preparing to unpack .../143-libgtk2.0-common_2.24.33-2ubuntu2_all.deb ...
448s Unpacking libgtk2.0-common (2.24.33-2ubuntu2) ...
448s Selecting previously unselected package at-spi2-common.
448s Preparing to unpack .../144-at-spi2-common_2.50.0-1_all.deb ...
448s Unpacking at-spi2-common (2.50.0-1) ...
448s Selecting previously unselected package libatk1.0-0:arm64.
448s Preparing to unpack .../145-libatk1.0-0_2.50.0-1_arm64.deb ...
448s Unpacking libatk1.0-0:arm64 (2.50.0-1) ...
448s Selecting previously unselected package libxcomposite1:arm64.
448s Preparing to unpack .../146-libxcomposite1_1%3a0.4.5-1build2_arm64.deb ...
448s Unpacking libxcomposite1:arm64 (1:0.4.5-1build2) ...
448s Selecting previously unselected package libxfixes3:arm64.
448s Preparing to unpack .../147-libxfixes3_1%3a6.0.0-2_arm64.deb ...
448s Unpacking libxfixes3:arm64 (1:6.0.0-2) ...
448s Selecting previously unselected package libxcursor1:arm64.
448s Preparing to unpack .../148-libxcursor1_1%3a1.2.1-1_arm64.deb ...
448s Unpacking libxcursor1:arm64 (1:1.2.1-1) ...
448s Selecting previously unselected package libxdamage1:arm64.
448s Preparing to unpack .../149-libxdamage1_1%3a1.1.6-1_arm64.deb ...
448s Unpacking libxdamage1:arm64 (1:1.1.6-1) ...
448s Selecting previously unselected package libxi6:arm64.
448s Preparing to unpack .../150-libxi6_2%3a1.8.1-1_arm64.deb ...
448s Unpacking libxi6:arm64 (2:1.8.1-1) ...
448s Selecting previously unselected package libxinerama1:arm64.
448s Preparing to unpack .../151-libxinerama1_2%3a1.1.4-3_arm64.deb ...
448s Unpacking libxinerama1:arm64 (2:1.1.4-3) ...
448s Selecting previously unselected package libxrandr2:arm64.
448s Preparing to unpack .../152-libxrandr2_2%3a1.5.2-2_arm64.deb ...
448s Unpacking libxrandr2:arm64 (2:1.5.2-2) ...
448s Selecting previously unselected package libgtk2.0-0:arm64.
448s Preparing to unpack .../153-libgtk2.0-0_2.24.33-2ubuntu2_arm64.deb ...
448s Unpacking libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ...
448s Selecting previously unselected package libglvnd0:arm64.
448s Preparing to unpack .../154-libglvnd0_1.7.0-1_arm64.deb ...
448s Unpacking libglvnd0:arm64 (1.7.0-1) ...
448s Selecting previously unselected package libglapi-mesa:arm64.
448s Preparing to unpack .../155-libglapi-mesa_24.0.1-1ubuntu1_arm64.deb ...
448s Unpacking libglapi-mesa:arm64 (24.0.1-1ubuntu1) ...
448s Selecting previously unselected package libx11-xcb1:arm64.
448s Preparing to unpack .../156-libx11-xcb1_2%3a1.8.7-1_arm64.deb ...
448s Unpacking libx11-xcb1:arm64 (2:1.8.7-1) ...
448s Selecting previously unselected package libxcb-dri2-0:arm64.
448s Preparing to unpack .../157-libxcb-dri2-0_1.15-1_arm64.deb ...
448s Unpacking libxcb-dri2-0:arm64 (1.15-1) ...
448s Selecting previously unselected package libxcb-dri3-0:arm64.
448s Preparing to unpack .../158-libxcb-dri3-0_1.15-1_arm64.deb ...
448s Unpacking libxcb-dri3-0:arm64 (1.15-1) ...
448s Selecting previously unselected package libxcb-glx0:arm64.
448s Preparing to unpack .../159-libxcb-glx0_1.15-1_arm64.deb ...
448s Unpacking libxcb-glx0:arm64 (1.15-1) ...
448s Selecting previously unselected package libxcb-present0:arm64.
449s Preparing to unpack .../160-libxcb-present0_1.15-1_arm64.deb ...
449s Unpacking libxcb-present0:arm64 (1.15-1) ...
449s Selecting previously unselected package libxcb-randr0:arm64.
449s Preparing to unpack .../161-libxcb-randr0_1.15-1_arm64.deb ...
449s Unpacking libxcb-randr0:arm64 (1.15-1) ...
449s Selecting previously unselected package libxcb-sync1:arm64.
449s Preparing to unpack .../162-libxcb-sync1_1.15-1_arm64.deb ...
449s Unpacking libxcb-sync1:arm64 (1.15-1) ...
449s Selecting previously unselected package libxcb-xfixes0:arm64.
449s Preparing to unpack .../163-libxcb-xfixes0_1.15-1_arm64.deb ...
449s Unpacking libxcb-xfixes0:arm64 (1.15-1) ...
449s Selecting previously unselected package libxshmfence1:arm64.
449s Preparing to unpack .../164-libxshmfence1_1.3-1build4_arm64.deb ...
449s Unpacking libxshmfence1:arm64 (1.3-1build4) ...
449s Selecting previously unselected package libxxf86vm1:arm64.
449s Preparing to unpack .../165-libxxf86vm1_1%3a1.1.4-1build3_arm64.deb ...
449s Unpacking libxxf86vm1:arm64 (1:1.1.4-1build3) ...
449s Selecting previously unselected package libvulkan1:arm64.
449s Preparing to unpack .../166-libvulkan1_1.3.275.0-1_arm64.deb ...
449s Unpacking libvulkan1:arm64 (1.3.275.0-1) ...
449s Selecting previously unselected package libdrm-amdgpu1:arm64.
449s Preparing to unpack .../167-libdrm-amdgpu1_2.4.120-2_arm64.deb ...
449s Unpacking libdrm-amdgpu1:arm64 (2.4.120-2) ...
449s Selecting previously unselected package libdrm-nouveau2:arm64.
449s Preparing to unpack .../168-libdrm-nouveau2_2.4.120-2_arm64.deb ...
449s Unpacking libdrm-nouveau2:arm64 (2.4.120-2) ...
449s Selecting previously unselected package libdrm-radeon1:arm64.
449s Preparing to unpack .../169-libdrm-radeon1_2.4.120-2_arm64.deb ...
449s Unpacking libdrm-radeon1:arm64 (2.4.120-2) ...
449s Selecting previously unselected package libllvm17:arm64.
449s Preparing to unpack .../170-libllvm17_1%3a17.0.6-5build1_arm64.deb ...
449s Unpacking libllvm17:arm64 (1:17.0.6-5build1) ...
449s Selecting previously unselected package libgl1-mesa-dri:arm64.
449s Preparing to unpack .../171-libgl1-mesa-dri_24.0.1-1ubuntu1_arm64.deb ...
449s Unpacking libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ...
450s Selecting previously unselected package libglx-mesa0:arm64.
450s Preparing to unpack .../172-libglx-mesa0_24.0.1-1ubuntu1_arm64.deb ...
450s Unpacking libglx-mesa0:arm64 (24.0.1-1ubuntu1) ...
450s Selecting previously unselected package libglx0:arm64.
450s Preparing to unpack .../173-libglx0_1.7.0-1_arm64.deb ...
450s Unpacking libglx0:arm64 (1.7.0-1) ...
450s Selecting previously unselected package libgl1:arm64.
450s Preparing to unpack .../174-libgl1_1.7.0-1_arm64.deb ...
450s Unpacking libgl1:arm64 (1.7.0-1) ...
450s Selecting previously unselected package libgif7:arm64.
450s Preparing to unpack .../175-libgif7_5.2.1-2.5_arm64.deb ...
450s Unpacking libgif7:arm64 (5.2.1-2.5) ...
450s Selecting previously unselected package libxtst6:arm64.
450s Preparing to unpack .../176-libxtst6_2%3a1.2.3-1.1_arm64.deb ...
450s Unpacking libxtst6:arm64 (2:1.2.3-1.1) ...
450s Selecting previously unselected package openjdk-21-jre:arm64.
450s Preparing to unpack .../177-openjdk-21-jre_21.0.2+13-2_arm64.deb ...
450s Unpacking openjdk-21-jre:arm64 (21.0.2+13-2) ...
450s Selecting previously unselected package default-jre.
450s Preparing to unpack .../178-default-jre_2%3a1.21-75+exp1_arm64.deb ...
450s Unpacking default-jre (2:1.21-75+exp1) ...
450s Selecting previously unselected package libapksig-java.
450s Preparing to unpack .../179-libapksig-java_31.0.2-1ubuntu1_all.deb ...
450s Unpacking libapksig-java (31.0.2-1ubuntu1) ...
450s Selecting previously unselected package apksigner.
450s Preparing to unpack .../180-apksigner_31.0.2-1ubuntu1_all.deb ...
450s Unpacking apksigner (31.0.2-1ubuntu1) ...
450s Selecting previously unselected package openjdk-21-jdk-headless:arm64.
450s Preparing to unpack .../181-openjdk-21-jdk-headless_21.0.2+13-2_arm64.deb ...
450s Unpacking openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ...
450s Selecting previously unselected package default-jdk-headless.
450s Preparing to unpack .../182-default-jdk-headless_2%3a1.21-75+exp1_arm64.deb ...
450s Unpacking default-jdk-headless (2:1.21-75+exp1) ...
450s Selecting previously unselected package libatomic1:arm64.
450s Preparing to unpack .../183-libatomic1_14-20240303-1ubuntu1_arm64.deb ...
450s Unpacking libatomic1:arm64 (14-20240303-1ubuntu1) ...
450s Selecting previously unselected package dexdump.
450s Preparing to unpack .../184-dexdump_13.0.0+r63-2_arm64.deb ...
450s Unpacking dexdump (13.0.0+r63-2) ...
450s Selecting previously unselected package python3-args.
450s Preparing to unpack .../185-python3-args_0.1.0-5_all.deb ...
450s Unpacking python3-args (0.1.0-5) ...
450s Selecting previously unselected package python3-clint.
450s Preparing to unpack .../186-python3-clint_0.5.1-4_all.deb ...
450s Unpacking python3-clint (0.5.1-4) ...
451s Selecting previously unselected package python3-defusedxml.
451s Preparing to unpack .../187-python3-defusedxml_0.7.1-2_all.deb ...
451s Unpacking python3-defusedxml (0.7.1-2) ...
451s Selecting previously unselected package liberror-perl.
451s Preparing to unpack .../188-liberror-perl_0.17029-2_all.deb ...
451s Unpacking liberror-perl (0.17029-2) ...
451s Selecting previously unselected package git-man.
451s Preparing to unpack .../189-git-man_1%3a2.43.0-1ubuntu1_all.deb ...
451s Unpacking git-man (1:2.43.0-1ubuntu1) ...
451s Selecting previously unselected package git.
451s Preparing to unpack .../190-git_1%3a2.43.0-1ubuntu1_arm64.deb ...
451s Unpacking git (1:2.43.0-1ubuntu1) ...
451s Selecting previously unselected package python3-smmap.
451s Preparing to unpack .../191-python3-smmap_6.0.0-1_all.deb ...
451s Unpacking python3-smmap (6.0.0-1) ...
451s Selecting previously unselected package python3-gitdb.
451s Preparing to unpack .../192-python3-gitdb_4.0.11-1_all.deb ...
451s Unpacking python3-gitdb (4.0.11-1) ...
451s Selecting previously unselected package python3-git.
451s Preparing to unpack .../193-python3-git_3.1.37-3_all.deb ...
451s Unpacking python3-git (3.1.37-3) ...
451s Selecting previously unselected package python3-lockfile.
451s Preparing to unpack .../194-python3-lockfile_1%3a0.12.2-3_all.deb ...
451s Unpacking python3-lockfile (1:0.12.2-3) ...
451s Selecting previously unselected package python3-simplejson.
451s Preparing to unpack .../195-python3-simplejson_3.19.2-1build1_arm64.deb ...
451s Unpacking python3-simplejson (3.19.2-1build1) ...
451s Selecting previously unselected package python3-libcloud.
451s Preparing to unpack .../196-python3-libcloud_3.4.1-5_all.deb ...
451s Unpacking python3-libcloud (3.4.1-5) ...
451s Selecting previously unselected package python3-bcrypt.
451s Preparing to unpack .../197-python3-bcrypt_3.2.2-1_arm64.deb ...
451s Unpacking python3-bcrypt (3.2.2-1) ...
451s Selecting previously unselected package libsodium23:arm64.
451s Preparing to unpack .../198-libsodium23_1.0.18-1build2_arm64.deb ...
451s Unpacking libsodium23:arm64 (1.0.18-1build2) ...
451s Selecting previously unselected package python3-nacl.
451s Preparing to unpack .../199-python3-nacl_1.5.0-4_arm64.deb ...
451s Unpacking python3-nacl (1.5.0-4) ...
451s Selecting previously unselected package python3-paramiko.
451s Preparing to unpack .../200-python3-paramiko_2.12.0-2ubuntu4_all.deb ...
451s Unpacking python3-paramiko (2.12.0-2ubuntu4) ...
451s Selecting previously unselected package python3-pyasn1.
451s Preparing to unpack .../201-python3-pyasn1_0.4.8-4_all.deb ...
451s Unpacking python3-pyasn1 (0.4.8-4) ...
451s Selecting previously unselected package python3-pyasn1-modules.
451s Preparing to unpack .../202-python3-pyasn1-modules_0.2.8-1_all.deb ...
451s Unpacking python3-pyasn1-modules (0.2.8-1) ...
451s Selecting previously unselected package python3-png.
451s Preparing to unpack .../203-python3-png_0.20231004.0-2_all.deb ...
451s Unpacking python3-png (0.20231004.0-2) ...
451s Selecting previously unselected package python3-qrcode.
451s Preparing to unpack .../204-python3-qrcode_7.4.2-4_all.deb ...
451s Unpacking python3-qrcode (7.4.2-4) ...
451s Selecting previously unselected package python3-ruamel.yaml.clib:arm64.
451s Preparing to unpack .../205-python3-ruamel.yaml.clib_0.2.8-1_arm64.deb ...
451s Unpacking python3-ruamel.yaml.clib:arm64 (0.2.8-1) ...
451s Selecting previously unselected package python3-ruamel.yaml.
451s Preparing to unpack .../206-python3-ruamel.yaml_0.17.21-1_all.deb ...
451s Unpacking python3-ruamel.yaml (0.17.21-1) ...
451s Selecting previously unselected package python3-pathspec.
451s Preparing to unpack .../207-python3-pathspec_0.12.1-1_all.deb ...
451s Unpacking python3-pathspec (0.12.1-1) ...
451s Selecting previously unselected package yamllint.
451s Preparing to unpack .../208-yamllint_1.33.0-1_all.deb ...
451s Unpacking yamllint (1.33.0-1) ...
451s Selecting previously unselected package fdroidserver.
451s Preparing to unpack .../209-fdroidserver_2.2.1-2_all.deb ...
451s Unpacking fdroidserver (2.2.1-2) ...
452s Selecting previously unselected package autopkgtest-satdep.
452s Preparing to unpack .../210-1-autopkgtest-satdep.deb ...
452s Unpacking autopkgtest-satdep (0) ...
452s Setting up libgraphite2-3:arm64 (1.3.14-2) ...
452s Setting up libxcb-dri3-0:arm64 (1.15-1) ...
452s Setting up liblcms2-2:arm64 (2.14-2) ...
452s Setting up libpixman-1-0:arm64 (0.42.2-1) ...
452s Setting up python3-lockfile (1:0.12.2-3) ...
452s Setting up libsharpyuv0:arm64 (1.3.2-0.4) ...
452s Setting up libx11-xcb1:arm64 (2:1.8.7-1) ...
452s Setting up python3-pure-eval (0.2.2-1) ...
452s Setting up libdrm-nouveau2:arm64 (2.4.120-2) ...
452s Setting up libsodium23:arm64 (1.0.18-1build2) ...
452s Setting up libxdamage1:arm64 (1:1.1.6-1) ...
452s Setting up libxcb-xfixes0:arm64 (1.15-1) ...
452s Setting up liblerc4:arm64 (4.0.0+ds-4ubuntu1) ...
452s Setting up libxpm4:arm64 (1:3.5.17-1) ...
452s Setting up hicolor-icon-theme (0.17-2) ...
452s Setting up libxi6:arm64 (2:1.8.1-1) ...
452s Setting up android-liblog:arm64 (1:33.0.3-2) ...
452s Setting up java-common (0.75+exp1) ...
452s Setting up libxrender1:arm64 (1:0.9.10-1.1) ...
452s Setting up libdatrie1:arm64 (0.2.13-3) ...
452s Setting up python3-parso (0.8.3-1) ...
452s Setting up python3-colorama (0.4.6-4) ...
452s Setting up python3-lz4 (4.0.2+dfsg-1build2) ...
452s Setting up libxcb-render0:arm64 (1.15-1) ...
452s Setting up python3-defusedxml (0.7.1-2) ...
452s Setting up python3-asttokens (2.4.1-1) ...
452s Setting up libdrm-radeon1:arm64 (2.4.120-2) ...
452s Setting up libglvnd0:arm64 (1.7.0-1) ...
452s Setting up python3-unicodedata2 (15.1.0+ds-1) ...
452s Setting up fonts-lyx (2.4.0~RC3-1) ...
452s Setting up libxcb-glx0:arm64 (1.15-1) ...
452s Setting up python3-bcrypt (3.2.2-1) ...
453s Setting up liblab-gamut1:arm64 (2.42.2-8build1) ...
453s Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ...
453s Setting up python3-ruamel.yaml.clib:arm64 (0.2.8-1) ...
453s Setting up x11-common (1:7.7+23ubuntu2) ...
453s Setting up libdeflate0:arm64 (1.19-1) ...
453s Setting up libqhull-r8.0:arm64 (2020.2-6) ...
453s Setting up libxcb-shm0:arm64 (1.15-1) ...
453s Setting up libgomp1:arm64 (14-20240303-1ubuntu1) ...
453s Setting up python3-click (8.1.6-1) ...
453s Setting up python3-networkx (2.8.8-1ubuntu1) ...
454s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:556: SyntaxWarning: invalid octal escape sequence '\420'
454s   "graph [edge [ source u'u\4200' target u'u\4200' ] "
454s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:557: SyntaxWarning: invalid octal escape sequence '\420'
454s   + "node [ id u'u\4200' label b ] ]"
454s Setting up libjbig0:arm64 (2.1-6.1ubuntu1) ...
454s Setting up android-libart:arm64 (13.0.0+r63-2) ...
454s Setting up libxxf86vm1:arm64 (1:1.1.4-1build3) ...
454s Setting up python3-png (0.20231004.0-2) ...
454s Setting up libxcb-present0:arm64 (1.15-1) ...
454s Setting up liberror-perl (0.17029-2) ...
454s Setting up unicode-data (15.1.0-1) ...
454s Setting up libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ...
454s Setting up python3-simplejson (3.19.2-1build1) ...
454s Setting up libasound2-data (1.2.10-3build1) ...
454s Setting up python3-decorator (5.1.1-5) ...
454s Setting up libblas3:arm64 (3.12.0-3) ...
454s update-alternatives: using /usr/lib/aarch64-linux-gnu/blas/libblas.so.3 to provide /usr/lib/aarch64-linux-gnu/libblas.so.3 (libblas.so.3-aarch64-linux-gnu) in auto mode
454s Setting up python3-packaging (23.2-1) ...
455s Setting up python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ...
455s Setting up python3-args (0.1.0-5) ...
455s Setting up libxfixes3:arm64 (1:6.0.0-2) ...
455s Setting up libxcb-sync1:arm64 (1.15-1) ...
455s Setting up python3-executing (2.0.1-0.1) ...
455s Setting up libpathplan4:arm64 (2.42.2-8build1) ...
455s Setting up python3-brotli (1.1.0-2) ...
455s Setting up libavahi-common-data:arm64 (0.8-13ubuntu2) ...
455s Setting up libann0 (1.1.2+doc-9) ...
455s Setting up python3-cycler (0.11.0-2) ...
455s Setting up libxinerama1:arm64 (2:1.1.4-3) ...
455s Setting up libimagequant0:arm64 (2.18.0-1) ...
455s Setting up fonts-dejavu-mono (2.37-8) ...
455s Setting up python3-kiwisolver (1.4.4-2) ...
455s Setting up libatomic1:arm64 (14-20240303-1ubuntu1) ...
455s Setting up libxrandr2:arm64 (2:1.5.2-2) ...
455s Setting up libtcl8.6:arm64 (8.6.13+dfsg-2) ...
455s Setting up fonts-dejavu-core (2.37-8) ...
455s Setting up libpcsclite1:arm64 (2.0.0-1) ...
455s Setting up libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ...
455s Setting up libltdl7:arm64 (2.4.7-7) ...
455s Setting up libglapi-mesa:arm64 (24.0.1-1ubuntu1) ...
455s Setting up libgfortran5:arm64 (14-20240303-1ubuntu1) ...
455s Setting up libvulkan1:arm64 (1.3.275.0-1) ...
455s Setting up libwebp7:arm64 (1.3.2-0.4) ...
455s Setting up libxcb-dri2-0:arm64 (1.15-1) ...
455s Setting up python3-ruamel.yaml (0.17.21-1) ...
455s Setting up libgif7:arm64 (5.2.1-2.5) ...
455s Setting up libxshmfence1:arm64 (1.3-1build4) ...
455s Setting up at-spi2-common (2.50.0-1) ...
455s Setting up libxcb-randr0:arm64 (1.15-1) ...
456s Setting up python3-traitlets (5.5.0-2) ...
456s Setting up libasound2:arm64 (1.2.10-3build1) ...
456s Setting up libxslt1.1:arm64 (1.1.39-0exp1) ...
456s Setting up python3-pyasn1 (0.4.8-4) ...
456s Setting up libopenjp2-7:arm64 (2.5.0-2) ...
456s Setting up git-man (1:2.43.0-1ubuntu1) ...
456s Setting up libharfbuzz0b:arm64 (8.3.0-2) ...
456s Setting up libthai-data (0.1.29-2) ...
456s Setting up python3-dateutil (2.8.2-3) ...
456s Setting up libgtk2.0-common (2.24.33-2ubuntu2) ...
456s Setting up libcdt5:arm64 (2.42.2-8build1) ...
456s Setting up libatk1.0-0:arm64 (2.50.0-1) ...
456s Setting up libcgraph6:arm64 (2.42.2-8build1) ...
456s Setting up libpython3.11-minimal:arm64 (3.11.8-1) ...
456s Setting up libxss1:arm64 (1:1.2.3-1build2) ...
456s Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
456s Setting up ca-certificates-java (20240118) ...
456s No JRE found. Skipping Java certificates setup.
456s Setting up python3-mpmath (1.2.1-3) ...
456s Setting up python3-magic (2:0.4.27-2) ...
457s Setting up android-libbase:arm64 (1:33.0.3-2) ...
457s Setting up python-matplotlib-data (3.6.3-1ubuntu3) ...
457s Setting up libwebpmux3:arm64 (1.3.2-0.4) ...
457s Setting up python3-pathspec (0.12.1-1) ...
457s Setting up python3-lib2to3 (3.11.5-1) ...
457s Setting up libllvm17:arm64 (1:17.0.6-5build1) ...
457s Setting up python3-appdirs (1.4.4-4) ...
457s Setting up python3-smmap (6.0.0-1) ...
457s Setting up libxcomposite1:arm64 (1:0.4.5-1build2) ...
457s Setting up python3-stack-data (0.6.3-1) ...
457s Setting up python3-asn1crypto (1.5.1-3) ...
457s Setting up python3-nacl (1.5.0-4) ...
458s Setting up libapksig-java (31.0.2-1ubuntu1) ...
458s Setting up python3-ptyprocess (0.7.0-5) ...
458s Setting up libdrm-amdgpu1:arm64 (2.4.120-2) ...
458s Setting up libjpeg8:arm64 (8c-2ubuntu11) ...
458s Setting up python3-prompt-toolkit (3.0.43-1) ...
458s Setting up python3-distutils (3.11.5-1) ...
458s python3.12: can't get files for byte-compilation
458s Setting up python3.11-minimal (3.11.8-1) ...
459s Setting up python3-sympy (1.12-7) ...
464s Setting up android-libnativebridge:arm64 (1:13.0.0+r63-2) ...
464s Setting up libice6:arm64 (2:1.0.10-1build2) ...
464s Setting up liblapack3:arm64 (3.12.0-3) ...
464s update-alternatives: using /usr/lib/aarch64-linux-gnu/lapack/liblapack.so.3 to provide /usr/lib/aarch64-linux-gnu/liblapack.so.3 (liblapack.so.3-aarch64-linux-gnu) in auto mode
464s Setting up python3-clint (0.5.1-4) ...
464s /usr/lib/python3/dist-packages/clint/packages/appdirs.py:82: SyntaxWarning: invalid escape sequence '\D'
464s   """Return full path to the user-shared data dir for this application.
464s /usr/lib/python3/dist-packages/clint/packages/colorama/ansitowin32.py:43: SyntaxWarning: invalid escape sequence '\['
464s   ANSI_RE = re.compile('\033\[((?:\d|;)*)([a-zA-Z])')
464s /usr/lib/python3/dist-packages/clint/textui/colored.py:118: SyntaxWarning: invalid escape sequence '\$'
464s   strip = re.compile("([^-_a-zA-Z0-9!@#%&=,/'\";:~`\$\^\*\(\)\+\[\]\.\{\}\|\?\<\>\\]+|[^\s]+)")
464s Setting up android-libziparchive:arm64 (1:33.0.3-2) ...
464s Setting up python3-setuptools (68.1.2-2) ...
464s Setting up python3-jedi (0.18.2-1ubuntu1) ...
464s Setting up fontconfig-config (2.15.0-1ubuntu1) ...
465s Setting up libxtst6:arm64 (2:1.2.3-1.1) ...
465s Setting up libwebpdemux2:arm64 (1.3.2-0.4) ...
465s Setting up libpython3.11-stdlib:arm64 (3.11.8-1) ...
465s Setting up libxcursor1:arm64 (1:1.2.1-1) ...
465s Setting up libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ...
465s Setting up libavahi-common3:arm64 (0.8-13ubuntu2) ...
465s Setting up python3-libcloud (3.4.1-5) ...
465s Setting up python3-gitdb (4.0.11-1) ...
466s Setting up python3-matplotlib-inline (0.1.6-2) ...
466s Setting up python3-fs (2.4.16-3) ...
466s Setting up libthai0:arm64 (0.1.29-2) ...
466s Setting up yamllint (1.33.0-1) ...
466s Setting up python3-oscrypto (1.3.0-5) ...
466s Setting up libjs-jquery-ui (1.13.2+dfsg-1) ...
466s Setting up python3-pexpect (4.9-2) ...
466s Setting up python3-pyasn1-modules (0.2.8-1) ...
467s Setting up libraqm0:arm64 (0.10.1-1) ...
467s Setting up android-libnativeloader:arm64 (1:13.0.0+r63-2) ...
467s Setting up git (1:2.43.0-1ubuntu1) ...
467s Setting up android-libbacktrace:arm64 (1:33.0.3-2) ...
467s Setting up libgvpr2:arm64 (2.42.2-8build1) ...
467s Setting up python3-lxml:arm64 (5.1.0-1) ...
467s Setting up libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ...
467s Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ...
467s Setting up libfontconfig1:arm64 (2.15.0-1ubuntu1) ...
467s Setting up python3-paramiko (2.12.0-2ubuntu4) ...
467s Setting up libsm6:arm64 (2:1.2.3-1build2) ...
467s Setting up libavahi-client3:arm64 (0.8-13ubuntu2) ...
467s Setting up liblbfgsb0:arm64 (3.0+dfsg.4-1) ...
467s Setting up gtk-update-icon-cache (3.24.40-2ubuntu1) ...
467s Setting up python3.11 (3.11.8-1) ...
468s Setting up fontconfig (2.15.0-1ubuntu1) ...
470s Regenerating fonts cache... done.
470s Setting up libxft2:arm64 (2.3.6-1) ...
470s Setting up libglx-mesa0:arm64 (24.0.1-1ubuntu1) ...
470s Setting up libglx0:arm64 (1.7.0-1) ...
470s Setting up libtk8.6:arm64 (8.6.14-1) ...
470s Setting up libpango-1.0-0:arm64 (1.51.0+ds-4) ...
470s Setting up libcairo2:arm64 (1.18.0-1) ...
470s Setting up python3-pil:arm64 (10.2.0-1) ...
470s Setting up dexdump (13.0.0+r63-2) ...
470s Setting up libgl1:arm64 (1.7.0-1) ...
470s Setting up python3-ipython (8.20.0-1) ...
471s Setting up python3-git (3.1.37-3) ...
471s Setting up libgd3:arm64 (2.3.3-9ubuntu1) ...
471s Setting up libxt6:arm64 (1:1.2.1-1.1) ...
471s Setting up python3-numpy (1:1.24.2-2) ...
473s Setting up libcups2:arm64 (2.4.6-0ubuntu3) ...
473s Setting up python3-contourpy (1.0.7-1build2) ...
473s Setting up python3-qrcode (7.4.2-4) ...
473s update-alternatives: using /usr/bin/python3-qr to provide /usr/bin/qr (qr) in auto mode
473s Setting up libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ...
473s Setting up libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ...
473s Setting up tk8.6-blt2.5 (2.5.3+dfsg-7) ...
473s Setting up libxmu6:arm64 (2:1.1.3-3) ...
473s Setting up python3-scipy (1.11.4-6) ...
475s Setting up openjdk-21-jre-headless:arm64 (21.0.2+13-2) ...
475s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode
475s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode
475s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode
475s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode
475s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode
475s Setting up blt (2.5.3+dfsg-7) ...
475s Setting up python3-tk:arm64 (3.11.5-1) ...
476s Setting up libxaw7:arm64 (2:1.0.14-1) ...
476s Setting up python3-pil.imagetk:arm64 (10.2.0-1) ...
476s Setting up libgvc6 (2.42.2-8build1) ...
476s Setting up graphviz (2.42.2-8build1) ...
476s Setting up python3-pydot (1.4.2-2) ...
476s Setting up python3-fonttools (4.46.0-1) ...
477s Setting up adwaita-icon-theme (46~rc-1) ...
477s update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode
477s Setting up python3-ufolib2 (0.16.0+dfsg1-1) ...
477s Setting up python3-matplotlib (3.6.3-1ubuntu3) ...
478s Setting up libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ...
478s Setting up androguard (3.4.0~a1-10) ...
478s /usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:1027: SyntaxWarning: invalid escape sequence '\>'
478s   """
479s Setting up humanity-icon-theme (0.6.16) ...
479s Setting up ubuntu-mono (24.04-0ubuntu1) ...
479s Processing triggers for systemd (255.2-3ubuntu2) ...
479s Processing triggers for man-db (2.12.0-3) ...
480s Processing triggers for libc-bin (2.39-0ubuntu6) ...
480s Processing triggers for ca-certificates-java (20240118) ...
481s Adding debian:ACCVRAIZ1.pem
481s Adding debian:AC_RAIZ_FNMT-RCM.pem
481s Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem
481s Adding debian:ANF_Secure_Server_Root_CA.pem
481s Adding debian:Actalis_Authentication_Root_CA.pem
481s Adding debian:AffirmTrust_Commercial.pem
481s Adding debian:AffirmTrust_Networking.pem
481s Adding debian:AffirmTrust_Premium.pem
481s Adding debian:AffirmTrust_Premium_ECC.pem
481s Adding debian:Amazon_Root_CA_1.pem
481s Adding debian:Amazon_Root_CA_2.pem
481s Adding debian:Amazon_Root_CA_3.pem
481s Adding debian:Amazon_Root_CA_4.pem
481s Adding debian:Atos_TrustedRoot_2011.pem
481s Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem
481s Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem
481s Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem
481s Adding debian:BJCA_Global_Root_CA1.pem
481s Adding debian:BJCA_Global_Root_CA2.pem
481s Adding debian:Baltimore_CyberTrust_Root.pem
481s Adding debian:Buypass_Class_2_Root_CA.pem
481s Adding debian:Buypass_Class_3_Root_CA.pem
481s Adding debian:CA_Disig_Root_R2.pem
481s Adding debian:CFCA_EV_ROOT.pem
481s Adding debian:COMODO_Certification_Authority.pem
481s Adding debian:COMODO_ECC_Certification_Authority.pem
481s Adding debian:COMODO_RSA_Certification_Authority.pem
481s Adding debian:Certainly_Root_E1.pem
481s Adding debian:Certainly_Root_R1.pem
481s Adding debian:Certigna.pem
481s Adding debian:Certigna_Root_CA.pem
481s Adding debian:Certum_EC-384_CA.pem
481s Adding debian:Certum_Trusted_Network_CA.pem
481s Adding debian:Certum_Trusted_Network_CA_2.pem
481s Adding debian:Certum_Trusted_Root_CA.pem
481s Adding debian:CommScope_Public_Trust_ECC_Root-01.pem
481s Adding debian:CommScope_Public_Trust_ECC_Root-02.pem
481s Adding debian:CommScope_Public_Trust_RSA_Root-01.pem
481s Adding debian:CommScope_Public_Trust_RSA_Root-02.pem
481s Adding debian:Comodo_AAA_Services_root.pem
481s Adding debian:D-TRUST_BR_Root_CA_1_2020.pem
481s Adding debian:D-TRUST_EV_Root_CA_1_2020.pem
481s Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem
481s Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem
481s Adding debian:DigiCert_Assured_ID_Root_CA.pem
481s Adding debian:DigiCert_Assured_ID_Root_G2.pem
481s Adding debian:DigiCert_Assured_ID_Root_G3.pem
481s Adding debian:DigiCert_Global_Root_CA.pem
481s Adding debian:DigiCert_Global_Root_G2.pem
481s Adding debian:DigiCert_Global_Root_G3.pem
481s Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem
481s Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem
481s Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem
481s Adding debian:DigiCert_Trusted_Root_G4.pem
481s Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem
481s Adding debian:Entrust_Root_Certification_Authority.pem
481s Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem
481s Adding debian:Entrust_Root_Certification_Authority_-_G2.pem
481s Adding debian:Entrust_Root_Certification_Authority_-_G4.pem
481s Adding debian:GDCA_TrustAUTH_R5_ROOT.pem
481s Adding debian:GLOBALTRUST_2020.pem
481s Adding debian:GTS_Root_R1.pem
481s Adding debian:GTS_Root_R2.pem
481s Adding debian:GTS_Root_R3.pem
481s Adding debian:GTS_Root_R4.pem
481s Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem
481s Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem
481s Adding debian:GlobalSign_Root_CA.pem
481s Adding debian:GlobalSign_Root_CA_-_R3.pem
481s Adding debian:GlobalSign_Root_CA_-_R6.pem
481s Adding debian:GlobalSign_Root_E46.pem
481s Adding debian:GlobalSign_Root_R46.pem
481s Adding debian:Go_Daddy_Class_2_CA.pem
481s Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem
481s Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem
481s Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem
481s Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem
481s Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem
481s Adding debian:HiPKI_Root_CA_-_G1.pem
481s Adding debian:Hongkong_Post_Root_CA_3.pem
481s Adding debian:ISRG_Root_X1.pem
481s Adding debian:ISRG_Root_X2.pem
481s Adding debian:IdenTrust_Commercial_Root_CA_1.pem
481s Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem
481s Adding debian:Izenpe.com.pem
481s Adding debian:Microsec_e-Szigno_Root_CA_2009.pem
481s Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem
481s Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem
481s Adding debian:NAVER_Global_Root_Certification_Authority.pem
481s Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem
481s Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem
481s Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem
481s Adding debian:QuoVadis_Root_CA_1_G3.pem
481s Adding debian:QuoVadis_Root_CA_2.pem
481s Adding debian:QuoVadis_Root_CA_2_G3.pem
481s Adding debian:QuoVadis_Root_CA_3.pem
481s Adding debian:QuoVadis_Root_CA_3_G3.pem
481s Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem
481s Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem
481s Adding debian:SSL.com_Root_Certification_Authority_ECC.pem
481s Adding debian:SSL.com_Root_Certification_Authority_RSA.pem
481s Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem
481s Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem
481s Adding debian:SZAFIR_ROOT_CA2.pem
481s Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem
481s Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem
481s Adding debian:SecureSign_RootCA11.pem
481s Adding debian:SecureTrust_CA.pem
481s Adding debian:Secure_Global_CA.pem
481s Adding debian:Security_Communication_ECC_RootCA1.pem
481s Adding debian:Security_Communication_RootCA2.pem
481s Adding debian:Security_Communication_RootCA3.pem
481s Adding debian:Security_Communication_Root_CA.pem
481s Adding debian:Starfield_Class_2_CA.pem
481s Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem
481s Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem
481s Adding debian:SwissSign_Gold_CA_-_G2.pem
481s Adding debian:SwissSign_Silver_CA_-_G2.pem
481s Adding debian:T-TeleSec_GlobalRoot_Class_2.pem
481s Adding debian:T-TeleSec_GlobalRoot_Class_3.pem
481s Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem
481s Adding debian:TWCA_Global_Root_CA.pem
481s Adding debian:TWCA_Root_Certification_Authority.pem
481s Adding debian:TeliaSonera_Root_CA_v1.pem
481s Adding debian:Telia_Root_CA_v2.pem
481s Adding debian:TrustAsia_Global_Root_CA_G3.pem
481s Adding debian:TrustAsia_Global_Root_CA_G4.pem
481s Adding debian:Trustwave_Global_Certification_Authority.pem
481s Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem
481s Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem
481s Adding debian:TunTrust_Root_CA.pem
481s Adding debian:UCA_Extended_Validation_Root.pem
481s Adding debian:UCA_Global_G2_Root.pem
481s Adding debian:USERTrust_ECC_Certification_Authority.pem
481s Adding debian:USERTrust_RSA_Certification_Authority.pem
481s Adding debian:XRamp_Global_CA_Root.pem
481s Adding debian:certSIGN_ROOT_CA.pem
481s Adding debian:certSIGN_Root_CA_G2.pem
481s Adding debian:e-Szigno_Root_CA_2017.pem
481s Adding debian:ePKI_Root_Certification_Authority.pem
481s Adding debian:emSign_ECC_Root_CA_-_C3.pem
481s Adding debian:emSign_ECC_Root_CA_-_G3.pem
481s Adding debian:emSign_Root_CA_-_C1.pem
481s Adding debian:emSign_Root_CA_-_G1.pem
481s Adding debian:vTrus_ECC_Root_CA.pem
481s Adding debian:vTrus_Root_CA.pem
481s done.
481s Setting up openjdk-21-jre:arm64 (21.0.2+13-2) ...
481s Setting up openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ...
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode
481s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode
481s Setting up default-jre-headless (2:1.21-75+exp1) ...
481s Setting up apksigner (31.0.2-1ubuntu1) ...
481s Setting up fdroidserver (2.2.1-2) ...
481s Setting up default-jre (2:1.21-75+exp1) ...
481s Setting up default-jdk-headless (2:1.21-75+exp1) ...
481s Setting up autopkgtest-satdep (0) ...
489s (Reading database ... 103154 files and directories currently installed.)
489s Removing autopkgtest-satdep (0) ...
490s autopkgtest [05:37:45]: test command1: echo Depends; export LANG=C.UTF-8 ANDROID_HOME=/usr/lib/android-sdk TRAVIS_OS_NAME=osx; fdroid=/usr/bin/fdroid ./tests/run-tests
490s autopkgtest [05:37:45]: test command1: [-----------------------
490s Depends
490s Using ANDROID_HOME=/usr/lib/android-sdk
490s Setting Workspace to /tmp/autopkgtest.tyZAgp/build.nAO/src
490s + echo_header 'run commit hooks'
490s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src
490s + test -x ./hooks/pre-commit
490s + echo_header 'run unit tests'
490s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/tests
490s + for testcase in $WORKSPACE/tests/*.TestCase
490s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/build.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
490s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/build.TestCase
490s ==============================================================================
490s run commit hooks
490s ==============================================================================
490s run unit tests
491s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/build.TestCase:641: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
491s   newSuite.addTest(unittest.makeSuite(BuildTest))
491s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
491s INFO:root:Getting source for revision 1.0
491s INFO:root:Creating local.properties file at /tmp/tmpdhhiy3p7/local.properties
491s DEBUG:root:Removing debuggable flags from /tmp/tmpdhhiy3p7
491s INFO:root:Scanning source for common problems...
491s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar
491s INFO:root:Removing shared library at baz.so
491s INFO:root:Ignoring Android AAR library at foo.aar
491s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0
491s DEBUG:root:Checking /tmp/tmpdhhiy3p7/mocked.app.id.apk
491s .WARNING:root:Android NDK version 'r21e' could not be found!
491s WARNING:root:Configured versions:
491s WARNING:root:Android NDK version 'r21e' could not be found!
491s WARNING:root:Configured versions:
491s INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r21e-linux-x86_64.zip
491s INFO:root:Unzipping to /tmp/tmpykxp7mjn/ndk
491s INFO:root:Set NDK r21e (21.4.7075529) up
491s INFO:root:Getting source for revision 1.0
491s INFO:root:Creating local.properties file at /tmp/tmpp35qh_ys/local.properties
491s DEBUG:root:Removing debuggable flags from /tmp/tmpp35qh_ys
491s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0
491s DEBUG:root:Checking /tmp/tmpp35qh_ys/mocked.app.id.apk
491s .DEBUG:root:Fetched buildserverid from VM: 0123456789abcdef0123456789abcdefcafebabe
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Connecting to virtual machine...
491s INFO:root:Preparing server for build...
491s DEBUG:root:rsyncing /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver to <MagicMock name='SSHClient().open_sftp().getcwd()' id='261011860602560'>
491s INFO:root:Starting build...
491s INFO:root:...getting exit status
491s DEBUG:root:retrieved fake.id_123_toolsversion.log
491s INFO:root:Retrieving build output...
491s INFO:root:destroying buildserver after build
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s .DEBUG:root:Reading 'config.yml'
491s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
491s INFO:root:Creating log directory
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Creating build directory
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:Getting git vcs interface for 
491s DEBUG:root:Checking info.guardianproject.checkey:123
491s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk
491s INFO:root:compared built binary to supplied reference binary successfully
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:success: info.guardianproject.checkey
491s INFO:root:Finished
491s INFO:root:1 build succeeded
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:Getting git vcs interface for 
491s DEBUG:root:Checking info.guardianproject.checkey:123
491s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk
491s DEBUG:root:removing unsigned/info.guardianproject.checkey_123.apk
491s DEBUG:root:removing unsigned/binaries/info.guardianproject.checkey_123.binary.apk
491s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed
491s ==== detail begin ====
491s failed
491s ==== detail end ====
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Build for app info.guardianproject.checkey:123 failed
491s INFO:root:Finished
491s INFO:root:1 build failed
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:Getting git vcs interface for 
491s DEBUG:root:Checking info.guardianproject.checkey:123
491s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk
491s INFO:root:compared built binary to supplied reference binary successfully
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:success: info.guardianproject.checkey
491s INFO:root:Finished
491s INFO:root:1 build succeeded
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:Getting git vcs interface for 
491s DEBUG:root:Checking info.guardianproject.checkey:123
491s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk
491s WARNING:root:Keeping failed build "tmp/info.guardianproject.checkey_123.apk"
491s DEBUG:root:removing tmp/binaries/info.guardianproject.checkey_123.binary.apk
491s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed
491s ==== detail begin ====
491s failed
491s ==== detail end ====
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s INFO:root:Build for app info.guardianproject.checkey:123 failed
491s INFO:root:Finished
491s INFO:root:1 build failed
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s DEBUG:root:skip deploying full build logs: not enabled in config
491s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
491s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
491s INFO:androguard.apk:APK file was successfully validated!
491s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
491s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
491s INFO:androguard.apk:APK file was successfully validated!
491s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
491s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
491s INFO:root:Getting source for revision master
491s INFO:root:Creating local.properties file at build/local.properties
491s DEBUG:root:Removing debuggable flags from build
491s DEBUG:root:scanner is configured to use signature data from: 'suss'
491s ERROR:root:Found Java JAR file at libs/android-support-v4r11.jar
491s INFO:root:Getting source for revision master
491s INFO:root:Updating local.properties file at build/local.properties
491s DEBUG:root:Removing debuggable flags from build
491s INFO:root:Collecting prebuilt libraries
491s INFO:root:...installing extlib android/android-support-v4r11.jar
491s INFO:root:Ignoring Java JAR file at libs/android-support-v4r11.jar
491s .
491s ----------------------------------------------------------------------
491s Ran 6 tests in 0.268s
491s 
491s OK
491s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
491s FakeFDroidPopen ['sudo', 'passwd', '--lock', 'root'] {}
491s FakeFDroidPopen ['sudo', 'SUDO_FORCE_REMOVE=yes', 'dpkg', '--purge', 'sudo'] {}
492s + for testcase in $WORKSPACE/tests/*.TestCase
492s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/checkupdates.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
492s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/checkupdates.TestCase
492s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/checkupdates.TestCase:350: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
492s   newSuite.addTest(unittest.makeSuite(CheckupdatesTest))
492s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/common.py:4098: DeprecationWarning: ast.Num is deprecated and will be removed in Python 3.14; use ast.Constant instead
492s   if isinstance(node, ast.Num):  # <number>
492s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/common.py:4099: DeprecationWarning: Attribute n is deprecated and will be removed in Python 3.14; use value instead
492s   return node.n
492s DEBUG:root:Applied vercode operation: 10109 -> 101091
492s DEBUG:root:Applied vercode operation: 10109 -> 101093
492s DEBUG:root:...updating - old vercode=101083, new vercode=101093
492s INFO:root:...updating to version 1.1.9 (101093)
492s INFO:root:...auto-generating build for 1.1.9
492s INFO:root:...auto-generating build for 1.1.9
492s INFO:root:Commiting update for metadata/loop.starts.shooting.yml
492s .DEBUG:root:...updating - old vercode=10108, new vercode=10109
492s INFO:root:...updating to version 1.1.9 (10109)
492s INFO:root:...auto-generating build for 1.1.9
492s INFO:root:Commiting update for metadata/loop.starts.shooting.yml
492s .DEBUG:root:...updating - old vercode=10108, new vercode=10109
492s INFO:root:...updating to version 1.1.9 (10109)
492s INFO:root:...auto-generating build for 1.1.9.10109-fdroid
492s INFO:root:Commiting update for metadata/loop.starts.shooting.yml
492s .DEBUG:root:...requesting https://a.net/b.txt
492s DEBUG:root:...requesting https://d.net/e.txt
492s ..DEBUG:root:...requesting https://a.net/b.txt
492s DEBUG:root:...requesting https://d.net/e.txt
492s INFO:root:Version 1.1.9-beta for loop.starts.shooting is ignored
492s .DEBUG:root:All tags: 1.1.9,1.1.8
492s DEBUG:root:Check tag: '1.1.9'
492s DEBUG:root:UpdateCheckData found version 1.1.9 (10109)
492s DEBUG:root:Check tag: '1.1.8'
492s DEBUG:root:UpdateCheckData found version 1.1.9 (10109)
492s DEBUG:root:All tags: 1.1.9,1.1.8
492s DEBUG:root:Check tag: '1.1.9'
492s DEBUG:root:UpdateCheckData found version 1.1.0 (10109)
492s DEBUG:root:Check tag: '1.1.8'
492s DEBUG:root:UpdateCheckData found version 1.1.0 (10109)
492s DEBUG:root:All tags: 1.1.9,1.1.8
492s DEBUG:root:Check tag: '1.1.9'
492s DEBUG:root:UpdateCheckData found version 1.1.9 (10109)
492s DEBUG:root:Check tag: '1.1.8'
492s DEBUG:root:UpdateCheckData found version 1.1.8 (10109)
492s DEBUG:root:All tags: Android-1.1.0,1.1.8
492s DEBUG:root:Check tag: 'Android-1.1.0'
492s DEBUG:root:UpdateCheckData found version 1.1.0 (10109)
492s DEBUG:root:Check tag: '1.1.8'
492s DEBUG:root:UpdateCheckData found version 1.1.8 (10109)
492s DEBUG:root:All tags: Android-1.1.0+1
492s DEBUG:root:Check tag: 'Android-1.1.0+1'
492s DEBUG:root:UpdateCheckData found version 1.1.0 (1)
492s DEBUG:root:All tags: 2
492s DEBUG:root:Check tag: '2'
492s DEBUG:root:UpdateCheckData found version 2 (2)
492s .DEBUG:root:...updating - old vercode=10108, new vercode=10109
492s INFO:root:...updating to version 1.1.9 (10109)
492s INFO:root:Commiting update for metadata/loop.starts.shooting.yml
492s .DEBUG:root:...updating - old vercode=10108, new vercode=10109
492s INFO:root:...updating to version 1.1.9 (10109)
492s INFO:root:...auto-generating build for 1.1.9
492s INFO:root:Commiting update for metadata/loop.starts.shooting.yml
492s .
492s ----------------------------------------------------------------------
492s Ran 9 tests in 0.011s
492s 
492s OK
492s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
492s + for testcase in $WORKSPACE/tests/*.TestCase
492s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
492s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase
492s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase:2682: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
492s   newSuite.addTest(unittest.makeSuite(CommonTest))
492s .....CRITICAL:root:'repo_keyalias' not found in config.yml!
492s CRITICAL:root:'keystore' not found in config.yml!
492s CRITICAL:root:'keystorepass' not found in config.yml!
492s CRITICAL:root:'keypass' not found in config.yml!
492s ..s./tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/common.py:4098: DeprecationWarning: ast.Num is deprecated and will be removed in Python 3.14; use ast.Constant instead
492s   if isinstance(node, ast.Num):  # <number>
492s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/common.py:4099: DeprecationWarning: Attribute n is deprecated and will be removed in Python 3.14; use value instead
492s   return node.n
492s .DEBUG:root:Reading 'config.yml'
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:Reading 'config.yml'
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:Reading 'config.yml'
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:Reading 'config.yml'
492s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)!
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s WARNING:root:config.py is deprecated, use config.yml
492s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:Reading 'config.yml'
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:Reading 'config.yml'
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:Reading 'config.yml'
492s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
492s .DEBUG:root:['rsync', '--archive', '--delete-after', '--safe-links', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ssh/id_rsa', 'repo/com.example.app_4711.log.gz', 'example.com:/var/www/fdroid/repo/']
492s DEBUG:root:deployed process log repo/com.example.app_4711.log.gz to example.com:/var/www/fdroid/
492s DEBUG:root:['rsync', '--archive', '--delete-after', '--safe-links', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ssh/id_rsa', 'repo/com.example.app_4711.log.gz', 'example.com:/var/www/fbot/repo/']
492s DEBUG:root:deployed process log repo/com.example.app_4711.log.gz to example.com:/var/www/fbot/
492s .DEBUG:root:skip deploying full build logs: not enabled in config
492s DEBUG:root:skip deploying full build logs: not enabled in config
492s DEBUG:root:skip deploying full build logs: not enabled in config
492s DEBUG:root:deployed process log repo/status/running.json to example.com:/var/www/fbot/
492s DEBUG:root:deployed process log repo/status/running.json to example.com:/var/www/fbot/
493s DEBUG:root:deployed process log repo/status/fakesubcommand.json to example.com:/var/www/fbot/
493s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s DEBUG:root:> sh -c echo stdout message && echo stderr message 1>&2
493s DEBUG:root:> sh -c echo stdout message && echo stderr message 1>&2
493s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s ../tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/common.py:591: DeprecationWarning: distutils Version classes are deprecated. Use packaging.version instead.
493s   if LooseVersion(f) < LooseVersion(MINIMUM_APKSIGNER_BUILD_TOOLS_VERSION):
493s INFO:root:Using /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/ANDROID_HOME/build-tools/30.0.3/apksigner 
493s ..s.....DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s ...ERROR:androguard.axml:This does not look like an AXML file. header size does not equal 8! header size = 8308
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s ERROR:androguard.axml:This does not look like an AXML file. header size does not equal 8! header size = 8308
493s ERROR:androguard.apk:Error while parsing AndroidManifest.xml - is the file valid?
493s ...DEBUG:root:Reading 'config.yml'
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s ..INFO:root:[PosixPath('source-files/cn.wildfirechat.chat/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/settings.gradle'), PosixPath('source-files/cn.wildfirechat.chat/imagepicker/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/gradle/build_libraries.gradle'), PosixPath('source-files/cn.wildfirechat.chat/chat/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/client/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/client/src/main/AndroidManifest.xml'), PosixPath('source-files/cn.wildfirechat.chat/push/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/avenginekit/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/mars-core-release/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/emojilibrary/build.gradle')]
493s INFO:root:[PosixPath('source-files/com.anpmech.launcher/build.gradle'), PosixPath('source-files/com.anpmech.launcher/settings.gradle'), PosixPath('source-files/com.anpmech.launcher/app/build.gradle'), PosixPath('source-files/com.anpmech.launcher/app/src/main/AndroidManifest.xml')]
493s INFO:root:[PosixPath('source-files/org.tasks/build.gradle'), PosixPath('source-files/org.tasks/build.gradle.kts'), PosixPath('source-files/org.tasks/settings.gradle.kts'), PosixPath('source-files/org.tasks/buildSrc/build.gradle.kts'), PosixPath('source-files/org.tasks/app/build.gradle.kts')]
493s INFO:root:[PosixPath('source-files/ut.ewh.audiometrytest/build.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/settings.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/app/build.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/app/src/main/AndroidManifest.xml')]
493s INFO:root:[PosixPath('source-files/org.noise_planet.noisecapture/settings.gradle'), PosixPath('source-files/org.noise_planet.noisecapture/sosfilter/build.gradle'), PosixPath('source-files/org.noise_planet.noisecapture/app/build.gradle')]
493s ...INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s WARNING:androguard.core.api_specific_resources:Requested API level 30 is larger than maximum we have, returning API level 28 instead.
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
493s INFO:androguard.apk:APK file was successfully validated!
493s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
493s .WARNING:root:config.py is deprecated, use config.yml
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s .DEBUG:root:Reading 'config.yml'
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s .DEBUG:root:Reading 'config.yml'
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s ......sINFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r10e-linux-x86_64.zip
493s INFO:root:Unzipping to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_install_ndk_versions98rw6px9/ndk
493s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
493s https://dl.google.com/android/repository/android-ndk-r10e-linux-x86_64.zip /tmp/android-ndk-vhobnsda/android-ndk-r10e-linux-x86_64.zip
493s INFO:root:Set NDK r10e (r10e) up
493s INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip
493s https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip /tmp/android-ndk-slvzt7zi/android-ndk-r20-linux-x86_64.zip
493s INFO:root:Unzipping to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_install_ndk_versions98rw6px9/ndk
493s INFO:root:Set NDK r20 (r20) up
493s INFO:root:Set NDK r20 (r20) up
493s INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r23-linux.zip
493s https://dl.google.com/android/repository/android-ndk-r23-linux.zip /tmp/android-ndk-mdlac6jz/android-ndk-r23-linux.zip
493s INFO:root:Unzipping to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_install_ndk_versions98rw6px9/ndk
493s INFO:root:Set NDK r23 (23.0.7599858) up
493s INFO:root:Set NDK r23 (23.0.7599858) up
493s .INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip
493s https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip /tmp/android-ndk-gk_ju_eu/android-ndk-r20-linux-x86_64.zip
493s INFO:root:Unzipping to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/ndk
493s ERROR:root:Unexpected symlink target: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/ndk/ndk/bad_abs_link -> /etc/passwd
493s ERROR:root:Unexpected symlink target: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/ndk/ndk/bad_rel_link -> /etc/passwd
493s ERROR:root:Unexpected symlink target: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/ndk/ndk/bad_rel_link2 -> /etc/passwd
493s INFO:root:Set NDK r20 (r20) up
493s total 4
493s -rw-r--r-- 1 ubuntu ubuntu 73 Mar 26 05:37 android-ndk-r20-linux-x86_64.zip
493s lrwxrwxrwx 1 ubuntu ubuntu 32 Mar 26 05:37 basename -> android-ndk-r20-linux-x86_64.zip
493s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s ....DEBUG:root:Reading 'config.yml'
493s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
493s ....DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml'
493s DEBUG:root:..got package=org.fdroid.fdroid, version=0.94-test, vercode=940
493s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/avenginekit/build.gradle'
493s DEBUG:root:..got package=None, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/build.gradle'
493s DEBUG:root:..got package=None, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/client/build.gradle'
493s DEBUG:root:..got package=None, version=1.0, vercode=1
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/client/src/main/AndroidManifest.xml'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/emojilibrary/build.gradle'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/gradle/build_libraries.gradle'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/imagepicker/build.gradle'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/mars-core-release/build.gradle'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/push/build.gradle'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/settings.gradle'
493s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/chat/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/pagerIndicator/src/main/AndroidManifest.xml'
493s DEBUG:root:..got package=com.viewpagerindicator, version=2.4.1, vercode=65
493s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/pagerIndicator/build.gradle'
493s DEBUG:root:..got package=com.viewpagerindicator, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/oneSheeld/src/main/AndroidManifest.xml'
493s DEBUG:root:..got package=com.integreight.onesheeld, version=None, vercode=None
493s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/oneSheeld/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/dev.patrickgold.florisboard/app/build.gradle.kts'
493s DEBUG:root:Parsing manifest at 'source-files/com.ubergeek42.WeechatAndroid/app/build.gradle.kts'
493s DEBUG:root:..got package=None, version=1.8.1, vercode=10801
493s DEBUG:root:Parsing manifest at 'source-files/com.ubergeek42.WeechatAndroid/app/src/main/res/values/strings.xml'
493s WARNING:root:Problem with xml at 'source-files/com.ubergeek42.WeechatAndroid/app/src/main/res/values/strings.xml'
493s .DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml'
493s DEBUG:root:..got package=org.fdroid.fdroid, version=0.94-test, vercode=940
493s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle'
493s DEBUG:root:..got package=org.fdroid.fdroid, version=None, vercode=None
493s .DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml'
493s DEBUG:root:..got package=None, version=0.94-test, vercode=940
493s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/eu.siacs.conversations/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.nextcloud.client/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.nextcloud.client/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/at.bitfire.davdroid/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.github.jameshnsears.quoteunquote/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/com.jens.automation2/build.gradle'
493s DEBUG:root:Parsing manifest at 'source-files/de.varengold.activeTAN/build.gradle'
493s .....INFO:root:Getting source for revision master
493s INFO:root:Creating local.properties file at /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/source-files/fdroid/fdroidclient/local.properties
493s DEBUG:root:Removing debuggable flags from /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/source-files/fdroid/fdroidclient
493s INFO:root:Changing the version name
493s INFO:root:Changing the version code
493s .DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:> git rev-parse --show-toplevel
495s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:> git checkout -f 0.3
495s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:> git clean -dffx
495s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:> git rev-parse --show-toplevel
495s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:> git submodule foreach --recursive git reset --hard
495s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
495s DEBUG:root:> git reset --hard
496s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
496s DEBUG:root:> git submodule foreach --recursive git clean -dffx
496s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
496s DEBUG:root:> git clean -dffx
496s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
496s DEBUG:root:> git checkout -f 0.3
496s DEBUG:root:Directory: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/build/org.fdroid.ci.test.app
496s DEBUG:root:> git clean -dffx
496s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
496s INFO:root:Getting source for revision master
496s INFO:root:Collecting source libraries
496s DEBUG:root:Removing debuggable flags from /tmp/tmpuf4cotm5/build/srclib/FakeSrcLib
496s INFO:root:Creating local.properties file at /tmp/tmpuf4cotm5/build/com.example/local.properties
496s INFO:root:Creating local.properties file at /tmp/tmpuf4cotm5/build/com.example/baz/local.properties
496s INFO:root:Creating local.properties file at /tmp/tmpuf4cotm5/build/com.example/baz/bar/local.properties
496s DEBUG:root:Removing debuggable flags from /tmp/tmpuf4cotm5/build/com.example/baz/bar
496s INFO:root:Running 'prebuild' commands in /tmp/tmpuf4cotm5/build/com.example/baz/bar
496s DEBUG:root:Directory: /tmp/tmpuf4cotm5/build/com.example/baz/bar
496s DEBUG:root:> bash -e -u -o pipefail -x -c -- test -d /tmp/tmpuf4cotm5/build/srclib/FakeSrcLib/testdirshouldexist
496s ..INFO:root:Cleaned build.gradle of keysigning configs at source-files/com.seafile.seadroid2/app/build.gradle
496s INFO:root:Cleaned build.gradle of keysigning configs at source-files/eu.siacs.conversations/build.gradle
496s INFO:root:Cleaned build.gradle of keysigning configs at source-files/open-keychain/open-keychain/OpenKeychain/build.gradle
496s INFO:root:Cleaned build.gradle.kts of keysigning configs at source-files/org.tasks/app/build.gradle.kts
496s INFO:root:Cleaned build.gradle of keysigning configs at source-files/osmandapp/osmand/build.gradle
496s INFO:root:Cleaned build.gradle of keysigning configs at source-files/ut.ewh.audiometrytest/app/build.gradle
496s .s..DEBUG:root:skip deploying full build logs: not enabled in config
496s .DEBUG:root:skip deploying full build logs: not enabled in config
496s DEBUG:root:skip deploying full build logs: not enabled in config
496s .DEBUG:root:Getting srclib vcs interface for TransportsRennes
496s .WARNING:root:config.py is deprecated, use config.yml
496s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
496s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
497s DOES NOT VERIFY
497s ERROR: Missing META-INF/MANIFEST.MF
497s ERROR:root:
497s /tmp/tmp0hrav510/urzip-release-unsigned.apk: 
497s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp0hrav510/urzip-release-unsigned.apk --out /tmp/tmp0hrav510/urzip-release.apk
498s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp0hrav510/duplicate.permisssions_9999999-unsigned.apk --out /tmp/tmp0hrav510/duplicate.permisssions_9999999.apk
499s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
499s INFO:androguard.apk:APK file was successfully validated!
499s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
499s DOES NOT VERIFY
499s ERROR: No JAR signatures
499s ERROR:root:
499s /tmp/tmp0hrav510/minimal_targetsdk_30_unsigned.apk: 
499s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp0hrav510/minimal_targetsdk_30_unsigned.apk --out /tmp/tmp0hrav510/minimal_targetsdk_30.apk
500s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
500s INFO:androguard.apk:APK file was successfully validated!
500s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
500s WARNING:androguard.core.api_specific_resources:Requested API level 30 is larger than maximum we have, returning API level 28 instead.
500s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
500s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp0hrav510/no_targetsdk_minsdk30_unsigned.apk --out /tmp/tmp0hrav510/no_targetsdk_minsdk30_signed.apk
501s INFO:androguard.apk:Starting analysis on AndroidManifest.xml
501s INFO:androguard.apk:APK file was successfully validated!
501s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28
501s DOES NOT VERIFY
501s ERROR: No JAR signatures
501s ERROR:root:
501s /tmp/tmp0hrav510/no_targetsdk_minsdk1_unsigned.apk: 
501s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp0hrav510/no_targetsdk_minsdk1_unsigned.apk --out /tmp/tmp0hrav510/no_targetsdk_minsdk1_signed.apk
502s .WARNING:root:config.py is deprecated, use config.yml
502s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
502s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
502s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpqpd5zwvk/urzip-release-unsigned.apk --out /tmp/tmpqpd5zwvk/urzip-release.apk
502s .WARNING:root:config.py is deprecated, use config.yml
502s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
502s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
502s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpsldrpmmu/urzip-release-unsigned.apk --out /tmp/tmpsldrpmmu/urzip-release.apk
503s .WARNING:root:config.py is deprecated, use config.yml
503s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
503s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
503s DEBUG:root:> /usr/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_signjarzen19pxn/testy.jar sova -keypass:env FDROID_KEY_PASS
503s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex/testy.jar'>
503s   open(sourcefile, 'rb').read(), open(testfile, 'rb').read()
503s ResourceWarning: Enable tracemalloc to get the object allocation traceback
503s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_signjarzen19pxn/testy.jar'>
503s   open(sourcefile, 'rb').read(), open(testfile, 'rb').read()
503s ResourceWarning: Enable tracemalloc to get the object allocation traceback
503s DEBUG:root:> /usr/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_signjarzen19pxn/guardianproject.jar sova -keypass:env FDROID_KEY_PASS
504s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex/guardianproject.jar'>
504s   open(sourcefile, 'rb').read(), open(testfile, 'rb').read()
504s ResourceWarning: Enable tracemalloc to get the object allocation traceback
504s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_signjarzen19pxn/guardianproject.jar'>
504s   open(sourcefile, 'rb').read(), open(testfile, 'rb').read()
504s ResourceWarning: Enable tracemalloc to get the object allocation traceback
504s ...DEBUG:root:Directory: /tmp/tmpu2v4u09q
504s DEBUG:root:> git rev-parse --show-toplevel
505s DEBUG:root:Directory: /tmp/tmpu2v4u09q
505s DEBUG:root:> git rev-parse --show-toplevel
505s .DEBUG:root:Directory: /tmp/tmp75smq82p
505s DEBUG:root:> git rev-parse --show-toplevel
505s .WARNING:root:config.py is deprecated, use config.yml
505s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
505s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
508s DOES NOT VERIFY
508s ERROR: JAR signer CERT.RSA: JAR signature META-INF/CERT.RSA did not verify against META-INF/CERT.SF
508s ERROR:root:
508s urzip-badcert.apk: 
508s DOES NOT VERIFY
508s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: <JYBUMhOCUqbNupF0uRUilMG8psI=>, actual: <osOjbkldSAk+vTAdsdLeXI6f58c=>
508s ERROR:root:
508s urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: <xnVQzXMpgNgZtvjZJC+y28A9cjo=>, actual: <5+8iqbzUfegBixjQUeg1++LwFe4=>
508s 
508s DOES NOT VERIFY
508s ERROR: Missing META-INF/MANIFEST.MF
508s ERROR:root:
508s urzip-release-unsigned.apk: 
508s .WARNING:root:config.py is deprecated, use config.yml
508s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
508s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
509s INFO:root:...successfully verified
510s INFO:root:...successfully verified
510s /usr/lib/python3.12/zipfile/__init__.py:1598: UserWarning: Duplicate name: 'META-INF/MANIFEST.MF'
510s   return self._open_to_write(zinfo, force_zip64=force_zip64)
510s /usr/lib/python3.12/zipfile/__init__.py:1598: UserWarning: Duplicate name: 'META-INF/CERT.SF'
510s   return self._open_to_write(zinfo, force_zip64=force_zip64)
510s /usr/lib/python3.12/zipfile/__init__.py:1598: UserWarning: Duplicate name: 'META-INF/CERT.RSA'
510s   return self._open_to_write(zinfo, force_zip64=force_zip64)
510s DOES NOT VERIFY
510s ERROR: Duplicate entry: META-INF/MANIFEST.MF
510s ERROR: Duplicate entry: META-INF/CERT.SF
510s ERROR: Duplicate entry: META-INF/CERT.RSA
510s ERROR:root:
510s /tmp/tmp0shjc_0x/urzip-twosig.apk: 
511s INFO:root:...successfully verified
511s .WARNING:root:config.py is deprecated, use config.yml
511s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
511s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
511s DEBUG:root:JAR signature verified: /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex/testy.jar
512s DEBUG:root:JAR signature verified: /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex/guardianproject.jar
512s .WARNING:root:config.py is deprecated, use config.yml
512s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
512s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
512s DEBUG:root:> /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
513s DEBUG:root:JAR signature verified: repo/entry.jar
513s .WARNING:root:config.py is deprecated, use config.yml
513s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
513s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
515s .WARNING:root:config.py is deprecated, use config.yml
515s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
515s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
515s DEBUG:root:JAR signature verified: bad-unicode-πÇÇ现代通用字-български-عربي1.apk
516s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_1.apk
516s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_2.apk
517s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_3.apk
517s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_4.apk
517s DEBUG:root:JAR signature verified: org.dyndns.fules.ck_20.apk
518s DEBUG:root:JAR signature verified: urzip.apk
518s DEBUG:root:JAR signature verified: urzip-release.apk
519s ..ERROR:root:Conflicting config files! Using config.yml, ignoring config.py!
519s DEBUG:root:Reading 'config.yml'
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .WARNING:root:config.py is deprecated, use config.yml
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .DEBUG:root:Reading 'config.yml'
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .DEBUG:root:Reading 'config.yml'
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .DEBUG:root:Reading 'config.yml'
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .DEBUG:root:Reading 'config.yml'
519s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)!
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .DEBUG:root:Reading 'config.yml'
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s ..WARNING:root:config.py is deprecated, use config.yml
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s WARNING:root:config.py is deprecated, use config.yml
519s WARNING:root:unsafe permissions on 'config.py' (should be 0600)!
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s ..DEBUG:root:Reading 'config.yml'
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s DEBUG:root:Reading 'config.yml'
519s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)!
519s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
519s .
519s ----------------------------------------------------------------------
519s Ran 107 tests in 26.928s
519s 
519s OK (skipped=4)
519s apksigner: yml
519s 
519s keypass: mysecretpassword
519s 
519s 
520s + for testcase in $WORKSPACE/tests/*.TestCase
520s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/deploy.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
520s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/deploy.TestCase
520s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/deploy.TestCase:238: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
520s   newSuite.addTest(unittest.makeSuite(DeployTest))
520s .INFO:root:rsyncing repo to example.com:/var/www/fdroid
520s .INFO:root:rsyncing archive to example.com:/var/www/fdroid
520s .s
520s ----------------------------------------------------------------------
520s Ran 4 tests in 0.003s
520s 
520s OK (skipped=1)
520s + for testcase in $WORKSPACE/tests/*.TestCase
520s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/exception.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
520s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/exception.TestCase
520s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/exception.TestCase:72: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
520s   newSuite.addTest(unittest.makeSuite(ExceptionTest))
520s .
520s ----------------------------------------------------------------------
520s Ran 1 test in 0.000s
520s 
520s OK
520s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
520s + for testcase in $WORKSPACE/tests/*.TestCase
520s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/import_subcommand.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
520s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/import_subcommand.TestCase
521s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/import_subcommand.TestCase:138: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
521s   newSuite.addTest(unittest.makeSuite(ImportTest))
521s .INFO:root:tmp/importer
521s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/imagepicker/build.gradle'
521s DEBUG:root:..got package=None, version=1.0, vercode=1
521s DEBUG:root:Parsing manifest at 'tmp/importer/gradle/build_libraries.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/chat/build.gradle'
521s INFO:root:tmp/importer
521s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/app/build.gradle'
521s DEBUG:root:..got package=com.anpmech.launcher, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/app/src/main/AndroidManifest.xml'
521s DEBUG:root:..got package=com.anpmech.launcher, version=None, vercode=None
521s INFO:root:tmp/importer
521s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle'
521s DEBUG:root:..got package=None, version=None, vercode=None
521s DEBUG:root:Parsing manifest at 'tmp/importer/app/build.gradle'
521s DEBUG:root:..got package=None, version=1.65, vercode=14
521s DEBUG:root:Parsing manifest at 'tmp/importer/app/src/main/AndroidManifest.xml'
521s DEBUG:root:..got package=ut.ewh.audiometrytest, version=1.0, vercode=1
521s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
521s DEBUG:urllib3.connectionpool:Starting new HTTPS connection (1): gitlab.com:443
522s DEBUG:urllib3.connectionpool:https://gitlab.com:443 "HEAD /fdroid/ci-test-app HTTP/1.1" 200 0
522s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git tmp/importer
522s Cloning into 'tmp/importer'...
523s DEBUG:root:Directory: tmp/importer
523s DEBUG:root:> git rev-parse --show-toplevel
524s DEBUG:root:Directory: tmp/importer
524s DEBUG:root:> git checkout -f origin/HEAD
524s DEBUG:root:Directory: tmp/importer
524s DEBUG:root:> git clean -dffx
524s .
524s ----------------------------------------------------------------------
524s Ran 3 tests in 3.128s
524s 
524s OK
524s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
524s + for testcase in $WORKSPACE/tests/*.TestCase
524s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/index.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
524s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/index.TestCase
524s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/index.TestCase:670: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
524s   newSuite.addTest(unittest.makeSuite(IndexTest))
536s ........................
536s ----------------------------------------------------------------------
536s Ran 24 tests in 11.788s
536s 
536s OK
536s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
536s WARNING: skipping rest of test since html5print is missing!
536s + for testcase in $WORKSPACE/tests/*.TestCase
536s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/init.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
536s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/init.TestCase
537s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/init.TestCase:89: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
537s   newSuite.addTest(unittest.makeSuite(InitTest))
537s DEBUG:root:Reading 'config.yml'
537s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Reading 'config.yml'
537s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Reading 'config.yml'
537s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s WARNING:root:
537s Using existing keystore "/tmp/tmp1ow7srk0/keystore.jks"
537s Now set these in config.yml: keystorepass, keypass, keydname
537s 
537s INFO:root:
537s Built repo based in "/tmp/tmp1ow7srk0" with this config:
537s 
537s   Android SDK:			/usr/lib/android-sdk
537s   Keystore for signing key:	/tmp/tmp1ow7srk0/keystore.jks
537s   Alias for key in store:	sova
537s 
537s To complete the setup, add your APKs to "/tmp/tmp1ow7srk0/repo"
537s then run "fdroid update -c; fdroid update".  You might also want to edit
537s "config.yml" to set the URL, repo name, and more.  You should also set up
537s a signing key (a temporary one might have been automatically generated).
537s 
537s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
537s and https://f-droid.org/docs/Signing_Process
537s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
537s .
537s ----------------------------------------------------------------------
537s Ran 2 tests in 0.019s
537s 
537s OK
537s + for testcase in $WORKSPACE/tests/*.TestCase
537s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
537s + echo 'skipping install.TestCase, its too troublesome in CI builds'
537s + continue
537s skipping install.TestCase, its too troublesome in CI builds
537s + for testcase in $WORKSPACE/tests/*.TestCase
537s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/lint.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
537s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/lint.TestCase
537s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/lint.TestCase:345: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
537s   newSuite.addTest(unittest.makeSuite(LintTest))
537s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:fake.app: AntiFeatures must be a 'list', but it is a 'str!'
537s DEBUG:root:fake.app: AntiFeatures must be a 'list', but it is a 'str!'
537s DEBUG:root:fake.app: Categories must be a 'list', but it is a 'str!'
537s DEBUG:root:fake.app: Categories must be a 'list', but it is a 'str!'
537s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'list'!
537s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'list'!
537s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'int'!
537s ..DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Unexpected license tag "Adobe-2006"! Only use FSF or OSI approved tags from https://spdx.org/license-list
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Unexpected license tag "Apache-2.0"! Only use license tags configured in your config file
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Unexpected license tag "Apache-2.0"! Only use license tags configured in your config file
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Invalid VercodeOperation: ['o', 'p', 'e', 'n', '(', '"', '/', 'e', 't', 'c', '/', 'p', 'a', 's', 's', 'w', 'd', '"', ')']
537s DEBUG:root:Invalid VercodeOperation: ['%', 'C', ' ', '+', ' ', '1']
537s DEBUG:root:Invalid VercodeOperation: ['%', '%', 'c', ' ', '*', ' ', '1', '2', '3']
537s DEBUG:root:Invalid VercodeOperation: ['1', '2', '3', ' ', '+', ' ', '%', '%']
537s DEBUG:root:Invalid VercodeOperation: ['%', 'c', ' ', '%', ' ', '7']
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:Description at line 'This way: <style><img src="</style><img src=x onerror=alert(1)//">': Forbidden HTML tags
537s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
537s "metadata/apk/" has no matching metadata file!
537s "metadata/dump/" has no matching metadata file!
537s "metadata/org.adaway.json" is not a supported file format (use: metadata/*.yml)
537s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
537s DEBUG:root:bad urls:
537s DEBUG:root:SourceCode 'github.com/my/proj': URL must start with https:// or http://
537s DEBUG:root:SourceCode 'http://github.com/not/secure': github.com URLs should always use https://
537s DEBUG:root:SourceCode 'https://github.com/foo/bar.git': Appending .git is not necessary
537s DEBUG:root:SourceCode 'https://gitlab.com/group/subgroup/project.git': Appending .git is not necessary
537s DEBUG:root:SourceCode 'https://raw.githubusercontent.com/Seva-coder/Finder/master/ChangeLog.txt': Use /HEAD instead of /master to point at a file in the default branch
537s DEBUG:root:SourceCode 'https://github.com/scoutant/blokish/blob/master/README.md#changelog': Use /HEAD instead of /master to point at a file in the default branch
537s DEBUG:root:SourceCode 'http://htmlpreview.github.io/?https://github.com/my/project/blob/HEAD/index.html': github.io URLs should always use https://
537s DEBUG:root:SourceCode 'http://fdroid.gitlab.io/fdroid-website': gitlab.io URLs should always use https://
537s .
537s ----------------------------------------------------------------------
537s Ran 11 tests in 0.019s
537s 
537s OK
537s + for testcase in $WORKSPACE/tests/*.TestCase
537s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/main.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
537s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/main.TestCase
538s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/main.TestCase:280: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
538s   newSuite.addTest(unittest.makeSuite(MainTest))
538s ....2024-03-26 05:38:33,101 CRITICAL: Unknown exception found!
538s ....2024-03-26 05:38:33,147 CRITICAL: no APK supplied
538s ......
538s ----------------------------------------------------------------------
538s Ran 14 tests in 0.134s
538s 
538s OK
538s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
538s all good
538s all good
538s + for testcase in $WORKSPACE/tests/*.TestCase
538s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
538s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata.TestCase
538s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata.TestCase:1157: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
538s   newSuite.addTest(unittest.makeSuite(MetadataTest))
538s ..........WARNING:root:Ignoring 'Provides' in 'mock_filename.yaml' metadata because it is deprecated.
538s ........DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
539s ...............
539s ----------------------------------------------------------------------
539s Ran 33 tests in 0.447s
539s 
539s OK
539s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
539s + for testcase in $WORKSPACE/tests/*.TestCase
539s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/nightly.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
539s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/nightly.TestCase
539s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/nightly.TestCase:376: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
539s   newSuite.addTest(unittest.makeSuite(NightlyTest))
540s ..WARNING:root:overwriting existing /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore
540s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/nightly.py:314: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
540s   date=datetime.datetime.utcnow().strftime('%Y-%m-%d %H:%M:%S UTC'))
541s sending incremental file list
541s ./
541s 
541s sent 46 bytes  received 19 bytes  130.00 bytes/sec
541s total size is 0  speedup is 0.00
541s Importing keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore to /tmp/.r1x4tm6p/.keystore.p12...
541s 
541s Warning:
541s <androiddebugkey> uses the SHA1withRSA signature algorithm which is considered a security risk.
541s <androiddebugkey> uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
541s writing RSA key
543s 2024-03-26 05:38:38,018 DEBUG: Reading 'config.yml'
543s 2024-03-26 05:38:38,026 DEBUG: ipfs_cid not found, skipping CIDv1 generation
543s 2024-03-26 05:38:38,027 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
543s 2024-03-26 05:38:38,027 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
543s 2024-03-26 05:38:38,028 DEBUG: Processing urzip-debug.apk
543s 2024-03-26 05:38:38,143 INFO: Starting analysis on AndroidManifest.xml
543s 2024-03-26 05:38:38,152 INFO: APK file was successfully validated!
543s 2024-03-26 05:38:38,154 DEBUG: Getting signature of urzip-debug.apk
543s 2024-03-26 05:38:38,161 WARNING: repo/urzip-debug.apk is set to android:debuggable="true"
543s 2024-03-26 05:38:38,431 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
543s Verified using v1 scheme (JAR signing): true
543s Verified using v2 scheme (APK Signature Scheme v2): true
543s Verified using v3 scheme (APK Signature Scheme v3): true
543s Verified using v4 scheme (APK Signature Scheme v4): false
543s Verified for SourceStamp: false
543s Number of signers: 1
543s 
543s 2024-03-26 05:38:38,434 DEBUG: Density 120 not available, resizing down from 160
543s 2024-03-26 05:38:38,437 INFO: Generated skeleton metadata for info.guardianproject.urzip
543s 2024-03-26 05:38:38,439 DEBUG: Checking archiving for info.guardianproject.urzip - apks:1, keepversions:20, archapks:0
543s 2024-03-26 05:38:38,440 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
543s 
543s Warning:
543s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
543s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
543s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -deststoretype pkcs12".
544s 2024-03-26 05:38:39,148 INFO: Creating signed index with this key (SHA256):
544s 2024-03-26 05:38:39,148 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3
544s 2024-03-26 05:38:39,148 DEBUG: Directory: archive
544s 2024-03-26 05:38:39,148 DEBUG: > jar cf index.jar index.xml
544s 2024-03-26 05:38:39,349 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS
545s jar signed.
545s 
545s Warning: 
545s The signer's certificate is self-signed.
545s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
545s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
545s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
545s 2024-03-26 05:38:40,034 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
545s 2024-03-26 05:38:40,070 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS
545s jar signed.
545s 
545s Warning: 
545s The signer's certificate is self-signed.
545s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
545s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
545s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
545s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
545s 2024-03-26 05:38:40,693 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS archive/entry.jar
546s 2024-03-26 05:38:41,095 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
546s 
546s Warning:
546s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
546s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
546s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -deststoretype pkcs12".
546s 2024-03-26 05:38:41,717 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
547s 
547s Warning:
547s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
547s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
547s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -deststoretype pkcs12".
547s 2024-03-26 05:38:42,327 INFO: Creating signed index with this key (SHA256):
547s 2024-03-26 05:38:42,328 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3
547s 2024-03-26 05:38:42,328 DEBUG: Directory: repo
547s 2024-03-26 05:38:42,328 DEBUG: > jar cf index.jar index.xml
547s 2024-03-26 05:38:42,529 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS
548s jar signed.
548s 
548s Warning: 
548s The signer's certificate is self-signed.
548s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
548s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
548s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
548s 2024-03-26 05:38:43,135 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
548s 2024-03-26 05:38:43,145 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS
548s jar signed.
548s 
548s Warning: 
548s The signer's certificate is self-signed.
548s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
548s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
548s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
548s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
548s 2024-03-26 05:38:43,750 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS repo/entry.jar
549s 2024-03-26 05:38:44,053 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
549s 
549s Warning:
549s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
549s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
549s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/home/.android/debug.keystore -deststoretype pkcs12".
549s 2024-03-26 05:38:44,677 DEBUG: Outputting JSON
549s 2024-03-26 05:38:44,678 DEBUG: skip deploying full build logs: not enabled in config
549s 2024-03-26 05:38:44,678 DEBUG: skip deploying full build logs: not enabled in config
549s 2024-03-26 05:38:44,679 DEBUG: skip deploying full build logs: not enabled in config
549s 2024-03-26 05:38:44,679 INFO: Finished
549s sending incremental file list
549s created directory /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/fdroid/git-mirror/fdroid/metadata
549s ./
549s info.guardianproject.urzip.yml
549s 
549s sent 418 bytes  received 189 bytes  1,214.00 bytes/sec
549s total size is 268  speedup is 0.44
549s sending incremental file list
549s created directory /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_github_actions_7a4zewhu1711431515.936004/fdroid/git-mirror/fdroid/stats
549s ./
549s known_apks.txt
549s 
549s sent 207 bytes  received 186 bytes  786.00 bytes/sec
549s total size is 73  speedup is 0.19
549s .WARNING:root:overwriting existing /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore
549s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/nightly.py:314: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
549s   date=datetime.datetime.utcnow().strftime('%Y-%m-%d %H:%M:%S UTC'))
550s sending incremental file list
550s ./
550s 
550s sent 46 bytes  received 19 bytes  130.00 bytes/sec
550s total size is 0  speedup is 0.00
550s Importing keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore to /tmp/.1pyehgca/.keystore.p12...
550s 
550s Warning:
550s <androiddebugkey> uses the SHA1withRSA signature algorithm which is considered a security risk.
550s <androiddebugkey> uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
550s writing RSA key
551s 2024-03-26 05:38:46,438 DEBUG: Reading 'config.yml'
551s 2024-03-26 05:38:46,441 DEBUG: ipfs_cid not found, skipping CIDv1 generation
551s 2024-03-26 05:38:46,441 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
551s 2024-03-26 05:38:46,442 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
551s 2024-03-26 05:38:46,443 DEBUG: Processing urzip-debug.apk
551s 2024-03-26 05:38:46,536 INFO: Starting analysis on AndroidManifest.xml
551s 2024-03-26 05:38:46,545 INFO: APK file was successfully validated!
551s 2024-03-26 05:38:46,547 DEBUG: Getting signature of urzip-debug.apk
551s 2024-03-26 05:38:46,554 WARNING: repo/urzip-debug.apk is set to android:debuggable="true"
551s 2024-03-26 05:38:46,846 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
551s Verified using v1 scheme (JAR signing): true
551s Verified using v2 scheme (APK Signature Scheme v2): true
551s Verified using v3 scheme (APK Signature Scheme v3): true
551s Verified using v4 scheme (APK Signature Scheme v4): false
551s Verified for SourceStamp: false
551s Number of signers: 1
551s 
551s 2024-03-26 05:38:46,849 DEBUG: Density 120 not available, resizing down from 160
551s 2024-03-26 05:38:46,852 INFO: Generated skeleton metadata for info.guardianproject.urzip
551s 2024-03-26 05:38:46,854 DEBUG: Checking archiving for info.guardianproject.urzip - apks:1, keepversions:20, archapks:0
551s 2024-03-26 05:38:46,855 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
552s 
552s Warning:
552s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
552s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
552s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -deststoretype pkcs12".
552s 2024-03-26 05:38:47,559 INFO: Creating signed index with this key (SHA256):
552s 2024-03-26 05:38:47,559 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3
552s 2024-03-26 05:38:47,559 DEBUG: Directory: archive
552s 2024-03-26 05:38:47,559 DEBUG: > jar cf index.jar index.xml
552s 2024-03-26 05:38:47,861 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS
553s jar signed.
553s 
553s Warning: 
553s The signer's certificate is self-signed.
553s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
553s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
553s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
553s 2024-03-26 05:38:48,471 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
553s 2024-03-26 05:38:48,481 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS
554s jar signed.
554s 
554s Warning: 
554s The signer's certificate is self-signed.
554s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
554s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
554s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
554s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
554s 2024-03-26 05:38:49,089 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS archive/entry.jar
554s 2024-03-26 05:38:49,391 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
554s 
554s Warning:
554s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
554s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
554s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -deststoretype pkcs12".
555s 2024-03-26 05:38:50,115 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
555s 
555s Warning:
555s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
555s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
555s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -deststoretype pkcs12".
555s 2024-03-26 05:38:50,827 INFO: Creating signed index with this key (SHA256):
555s 2024-03-26 05:38:50,827 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3
555s 2024-03-26 05:38:50,827 DEBUG: Directory: repo
555s 2024-03-26 05:38:50,827 DEBUG: > jar cf index.jar index.xml
556s 2024-03-26 05:38:51,136 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS
556s jar signed.
556s 
556s Warning: 
556s The signer's certificate is self-signed.
556s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
556s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
556s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
556s 2024-03-26 05:38:51,841 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
556s 2024-03-26 05:38:51,851 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS
557s jar signed.
557s 
557s Warning: 
557s The signer's certificate is self-signed.
557s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
557s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
557s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update.
557s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
557s 2024-03-26 05:38:52,458 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS repo/entry.jar
557s 2024-03-26 05:38:52,866 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS
559s 
559s Warning:
559s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk.
559s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update.
559s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/home/.android/debug.keystore -deststoretype pkcs12".
559s 2024-03-26 05:38:54,318 DEBUG: Outputting JSON
559s 2024-03-26 05:38:54,318 DEBUG: skip deploying full build logs: not enabled in config
559s 2024-03-26 05:38:54,324 DEBUG: skip deploying full build logs: not enabled in config
559s 2024-03-26 05:38:54,324 DEBUG: skip deploying full build logs: not enabled in config
559s 2024-03-26 05:38:54,325 INFO: Finished
559s sending incremental file list
559s created directory /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/fdroid/git-mirror/fdroid/metadata
559s ./
559s info.guardianproject.urzip.yml
559s 
559s sent 413 bytes  received 184 bytes  1,194.00 bytes/sec
559s total size is 263  speedup is 0.44
559s sending incremental file list
559s created directory /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_gitlab_ci__q5puapo1711431524.945461/fdroid/git-mirror/fdroid/stats
559s ./
559s known_apks.txt
559s 
559s sent 207 bytes  received 181 bytes  776.00 bytes/sec
559s total size is 73  speedup is 0.19
559s .ERROR:root:/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_main_empty_dot_android_b22twp111711431534.6692364/home/.android/debug.keystore does not exist!  Create it by running:
559s     keytool -genkey -v -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_main_empty_dot_android_b22twp111711431534.6692364/home/.android/debug.keystore -storepass android \
559s      -alias androiddebugkey -keypass android -keyalg RSA -keysize 2048 -validity 10000 \
559s      -dname "CN=Android Debug,O=Android,C=US"
560s .Importing keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_main_empty_dot_ssh_aid7y7k91711431534.6706684/home/.android/debug.keystore to /tmp/.hld5r81c/.keystore.p12...
560s 
560s Warning:
560s <androiddebugkey> uses the SHA1withRSA signature algorithm which is considered a security risk.
561s writing RSA key
561s .Importing keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/test_main_on_user_machine_4k5u3fko1711431536.2780457/home/.android/debug.keystore to /tmp/.u6o9zs2c/.keystore.p12...
561s 
561s Warning:
561s <androiddebugkey> uses the SHA1withRSA signature algorithm which is considered a security risk.
561s writing RSA key
562s ..Importing keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/aosp_testkey_debug.keystore to /tmp/.o2avzjei/.keystore.p12...
563s 
563s Warning:
563s <androiddebugkey> uses the SHA1withRSA signature algorithm which is considered a security risk.
563s writing RSA key
563s .localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
563s WARNING: only public git repos are supported!
563s 
563s ----------------------------------------------------------------------
563s Ran 9 tests in 23.439s
563s 
563s OK
563s + for testcase in $WORKSPACE/tests/*.TestCase
563s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/publish.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
563s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/publish.TestCase
563s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/publish.TestCase:342: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
563s   newSuite.addTest(unittest.makeSuite(PublishTest))
563s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
563s ERROR:root:There is a keyalias collision - publishing halted
563s .s.DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
563s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS
564s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
564s INFO:root:Creating log directory
564s INFO:root:Creating temporary directory
564s INFO:root:1 app, 1 key aliases
564s INFO:root:Processing unsigned/com.politedroid_6.apk
564s DEBUG:root:unsigned/binaries/com.politedroid_6.binary.apk: Verifies
564s Verified using v1 scheme (JAR signing): true
564s Verified using v2 scheme (APK Signature Scheme v2): false
564s Verified using v3 scheme (APK Signature Scheme v3): false
564s Verified using v4 scheme (APK Signature Scheme v4): false
564s Verified for SourceStamp: false
564s Number of signers: 1
564s 
565s DEBUG:root:tmp/sigcp_com.politedroid_6.apk: Verifies
565s Verified using v1 scheme (JAR signing): true
565s Verified using v2 scheme (APK Signature Scheme v2): false
565s Verified using v3 scheme (APK Signature Scheme v3): false
565s Verified using v4 scheme (APK Signature Scheme v4): false
565s Verified for SourceStamp: false
565s Number of signers: 1
565s 
565s INFO:root:...successfully verified
565s DEBUG:root:...no source tarball for com.politedroid_6.apk
565s INFO:root:Published com.politedroid_6.apk
565s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS
565s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS
566s jar signed.
566s 
566s Warning: 
566s The signer's certificate is self-signed.
566s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
566s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
566s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
566s DEBUG:root:Outputting JSON
566s DEBUG:root:skip deploying full build logs: not enabled in config
566s DEBUG:root:skip deploying full build logs: not enabled in config
566s DEBUG:root:skip deploying full build logs: not enabled in config
566s INFO:root:published list signing-key fingerprints
566s .INFO:root:Creating log directory
566s INFO:root:Creating temporary directory
566s INFO:root:Creating output directory
566s INFO:root:1 app, 1 key aliases
566s INFO:root:Processing unsigned/org.fdroid.ci_1.apk
566s INFO:root:Key alias: 59d3c650
566s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -alias 59d3c650 -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS
567s keytool error: java.lang.Exception: Alias <59d3c650> does not exist
567s INFO:root:Key does not exist - generating...
567s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -genkey -keystore keystore.jks -alias 59d3c650 -keyalg RSA -keysize 2048 -validity 10000 -storepass:env FDROID_KEY_STORE_PASS -dname CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US -keypass:env FDROID_KEY_PASS
568s Generating 2,048 bit RSA key pair and self-signed certificate (SHA384withRSA) with a validity of 10,000 days
568s 	for: CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, ST=California, C=US
568s 
568s Warning:
568s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore keystore.jks -destkeystore keystore.jks -deststoretype pkcs12".
568s DEBUG:root:> /usr/bin/apksigner sign --ks keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias 59d3c650 --in unsigned/org.fdroid.ci_1.apk --out repo/org.fdroid.ci_1.apk
569s DEBUG:root:...no source tarball for org.fdroid.ci_1.apk
569s INFO:root:Published org.fdroid.ci_1.apk
569s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS
570s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS
572s jar signed.
572s 
572s Warning: 
572s The signer's certificate is self-signed.
572s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
572s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
572s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
572s DEBUG:root:Outputting JSON
572s DEBUG:root:skip deploying full build logs: not enabled in config
572s DEBUG:root:skip deploying full build logs: not enabled in config
572s DEBUG:root:skip deploying full build logs: not enabled in config
572s INFO:root:published list signing-key fingerprints
572s DEBUG:root:repo/org.fdroid.ci_1.apk: Verifies
572s Verified using v1 scheme (JAR signing): true
572s Verified using v2 scheme (APK Signature Scheme v2): true
572s Verified using v3 scheme (APK Signature Scheme v3): true
572s Verified using v4 scheme (APK Signature Scheme v4): false
572s Verified for SourceStamp: false
572s Number of signers: 1
572s 
572s DEBUG:root:signature okay: repo/org.fdroid.ci_1.apk
572s DEBUG:androguard.axml:AXML contains a RESOURCE MAP
572s DEBUG:androguard.axml:Start of Namespace mapping: prefix 8: 'android' --> uri 10: 'http://schemas.android.com/apk/res/android'
572s INFO:root:Fetched signatures for 'repo/org.fdroid.ci_1.apk' -> 'metadata/org.fdroid.ci/signatures/1'
572s INFO:root:1 app, 1 key aliases
572s INFO:root:Processing unsigned/org.fdroid.ci_1.apk
573s DEBUG:root:tmp/org.fdroid.ci_1_e830e4b.apk: Verifies
573s Verified using v1 scheme (JAR signing): true
573s Verified using v2 scheme (APK Signature Scheme v2): true
573s Verified using v3 scheme (APK Signature Scheme v3): true
573s Verified using v4 scheme (APK Signature Scheme v4): false
573s Verified for SourceStamp: false
573s Number of signers: 1
573s 
573s INFO:root:Key alias: 59d3c650
573s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -alias 59d3c650 -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS
574s 59d3c650, Mar 26, 2024, PrivateKeyEntry, 
574s Certificate fingerprint (SHA-256): E8:30:E4:B8:6A:31:3F:52:14:04:87:0D:53:67:DF:14:5A:67:99:5D:50:C7:90:C2:BE:D0:85:70:DA:9F:70:73
574s 
574s Warning:
574s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore keystore.jks -destkeystore keystore.jks -deststoretype pkcs12".
574s DEBUG:root:> /usr/bin/apksigner sign --ks keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias 59d3c650 --in unsigned/org.fdroid.ci_1.apk --out repo/org.fdroid.ci_1.apk
574s DEBUG:root:...no source tarball for org.fdroid.ci_1.apk
574s INFO:root:Published org.fdroid.ci_1.apk
574s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS
575s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS
575s jar signed.
575s 
575s Warning: 
575s The signer's certificate is self-signed.
575s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
575s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
575s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
575s DEBUG:root:Outputting JSON
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s INFO:root:published list signing-key fingerprints
575s .DEBUG:root:Outputting JSON
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:Outputting JSON
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
575s DEBUG:root:Outputting JSON
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s DEBUG:root:skip deploying full build logs: not enabled in config
575s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
575s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS
576s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar repokey -keypass:env FDROID_KEY_PASS
576s jar signed.
576s 
576s Warning: 
576s The signer's certificate is self-signed.
576s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
576s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
576s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
577s DEBUG:root:JAR signature verified: stats/publishsigkeys.jar
577s WARNING:root:repo_key_sha256 not in config.yml, setting it to the signature key fingerprint of 'stats/publishsigkeys.jar'
577s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
577s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS
579s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar repokey -keypass:env FDROID_KEY_PASS
579s jar signed.
579s 
579s Warning: 
579s The signer's certificate is self-signed.
579s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
579s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
579s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
580s DEBUG:root:JAR signature verified: stats/publishsigkeys.jar
580s .
580s ----------------------------------------------------------------------
580s Ran 9 tests in 16.307s
580s 
580s OK (skipped=1)
580s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
580s + for testcase in $WORKSPACE/tests/*.TestCase
580s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/rewritemeta.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
580s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/rewritemeta.TestCase
581s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/rewritemeta.TestCase:106: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
581s   newSuite.addTest(unittest.makeSuite(RewriteMetaTest))
581s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
581s INFO:root:Rewriting 'a'
581s INFO:root:Rewriting 'b'
581s DEBUG:root:Finished
581s .INFO:root:Rewriting 'a'
581s .
581s ----------------------------------------------------------------------
581s Ran 2 tests in 0.011s
581s 
581s OK
581s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
581s + for testcase in $WORKSPACE/tests/*.TestCase
581s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
581s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase
582s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase:780: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
582s   unittest.makeSuite(ScannerTest),
582s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase:781: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
582s   unittest.makeSuite(Test_scan_binary),
582s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase:782: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
582s   unittest.makeSuite(Test_SignatureDataController),
582s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase:783: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
582s   unittest.makeSuite(Test_main),
582s INFO:root:Getting source for revision 1.0
582s INFO:root:Creating local.properties file at /tmp/tmppjy2ik9y/local.properties
582s INFO:root:Scanning source for common problems...
582s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar
582s INFO:root:Ignoring shared library at baz.so
582s INFO:root:Ignoring Android AAR library at foo.aar
582s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0
589s ......INFO:root:Removing unknown maven repo 'https://maven.fabric.io/public' at build.gradle
589s INFO:root:Removing unknown maven repo 'https://evilcorp.com/maven' at build.gradle
589s .-rw-rw-r-- 1 ubuntu ubuntu 18 Mar 26 05:39 binary.out
589s -rwxr-xr-x 1 ubuntu ubuntu 18 Mar 26 05:39 fake.png
589s INFO:root:Removing gradlew at gradlew
589s ERROR:root:Found binary at binary.out
589s WARNING:root:Found executable binary, possibly code at fake.png
589s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar
589s ERROR:root:Found static library at static.a
589s ERROR:root:Found shared library at baz.so
589s ERROR:root:Found Java JAR file at arg.jar
589s ERROR:root:Found Android AAR library at sqlcipher.aar
589s ERROR:root:Found Android DEX code at classes.dex
589s INFO:root:Removing gradlew.bat at gradlew.bat
589s WARNING:root:Found Android DEX code at src/test/resources/classes.dex
589s .ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at app/build.gradle
589s ERROR:root:Found unknown maven repo 'http://developer.huawei.com/repo/' at build.gradle
589s ERROR:root:Found unknown maven repo 'https://dl.bintray.com/jenly/maven' at build.gradle
589s ERROR:root:Found usual suspect 'com.tencent.bugly' at chat/build.gradle
589s ERROR:root:Found usual suspect 'com.tencent.bugly' at chat/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at app/build.gradle
589s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at build.gradle.kts
589s ERROR:root:Found usual suspect 'com\.mapbox(?!\.mapboxsdk:mapbox-sdk-services)' at app/build.gradle.kts
589s ERROR:root:Found usual suspect '["']com.facebook.android['":]' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'crashlytics' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at oneSheeld/build.gradle
589s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at oneSheeld/build.gradle
589s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at oneSheeld/build.gradle
589s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at oneSheeld/build.gradle
589s ERROR:root:Found unknown maven repo '../../m2/repository' at syncthing-silk/build.gradle
589s ERROR:root:Found unknown maven repo '$projectDir/../../tests/react-test-app/node_modules/react-native/android' at react-native/android/build.gradle
589s ERROR:root:Found unknown maven repo '$rootDir/../node_modules/react-native/android' at android/build.gradle
589s ERROR:root:Found unknown maven repo '$rootDir/../node_modules/jsc-android/dist' at android/build.gradle
589s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at app/build.gradle
589s ERROR:root:Found usual suspect 'google.*play.*services' at app/build.gradle
589s .ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at build.gradle
589s ERROR:root:Found unknown maven repo 'https://evilcorp.com/maven' at build.gradle
589s ..../tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase:536: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
589s   sdc.data['last_updated'] = (datetime.utcnow() - timedelta(days=30)).timestamp()
589s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/scanner.py:118: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
589s   return datetime.utcnow()
589s ..../tmp/autopkgtest.tyZAgp/build.nAO/src/tests/scanner.TestCase:528: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
589s   sdc.data['last_updated'] = datetime.utcnow().timestamp()
589s ........INFO:root:Creating build directory
589s INFO:root:Finished
589s .INFO:root:Scanning APK with dexdump for known non-free classes.
590s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
590s .INFO:root:Scanning APK with dexdump for known non-free classes.
590s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/no_targetsdk_minsdk1_unsigned.apk
590s .INFO:root:Scanning APK with dexdump for known non-free classes.
590s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
590s .
590s ----------------------------------------------------------------------
590s Ran 29 tests in 8.753s
590s 
590s OK
590s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
590s basedir
590s 0 problems found
591s + for testcase in $WORKSPACE/tests/*.TestCase
591s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signatures.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
591s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signatures.TestCase
591s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signatures.TestCase:73: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
591s   newSuite.addTest(unittest.makeSuite(SignaturesTest))
591s WARNING:root:config.py is deprecated, use config.yml
591s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation
591s DEBUG:root:/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk: Verifies
591s Verified using v1 scheme (JAR signing): true
591s Verified using v2 scheme (APK Signature Scheme v2): false
591s Verified using v3 scheme (APK Signature Scheme v3): false
591s Verified using v4 scheme (APK Signature Scheme v4): false
591s Verified for SourceStamp: false
591s Number of signers: 1
591s 
591s DEBUG:root:signature okay: /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
592s DEBUG:androguard.axml:AXML contains a RESOURCE MAP
592s DEBUG:androguard.axml:Start of Namespace mapping: prefix 6: 'android' --> uri 7: 'http://schemas.android.com/apk/res/android'
592s INFO:root:Fetched signatures for '/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk' -> 'metadata/com.politedroid/signatures/3'
592s .
592s ----------------------------------------------------------------------
592s Ran 1 test in 0.954s
592s 
592s OK
592s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
592s + for testcase in $WORKSPACE/tests/*.TestCase
592s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
592s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex.TestCase
592s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/signindex.TestCase:208: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
592s   newSuite.addTest(unittest.makeSuite(SignindexTest))
592s WARNING:root:config.py is deprecated, use config.yml
594s ....jar signed.
594s 
594s Warning: 
594s The signer's certificate is self-signed.
594s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
594s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
594s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
595s ...s
595s ----------------------------------------------------------------------
595s Ran 8 tests in 2.195s
595s 
595s OK (skipped=1)
595s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
595s + for testcase in $WORKSPACE/tests/*.TestCase
595s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/update.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
595s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/update.TestCase
595s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/update.TestCase:1773: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
595s   newSuite.addTest(unittest.makeSuite(UpdateTest))
595s ./usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:884: DeprecationWarning: This method is deprecated since 3.3.5.
595s   warnings.warn("This method is deprecated since 3.3.5.", DeprecationWarning)
596s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/common.py:2447: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
596s   default_date = datetime.utcnow()
597s WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
598s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
605s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
606s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
612s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
612s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
615s ..WARNING:root:repo/urzip.apk is set to android:debuggable="true"
616s INFO:root:Generated skeleton metadata for info.guardianproject.urzip
616s INFO:root:Generated skeleton metadata for info.guardianproject.urzip
616s .WARNING:root:rocks.janicerand does not have a name! Using application ID instead.
616s INFO:root:Generated skeleton metadata for rocks.janicerand
617s ...WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
618s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
622s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
623s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
629s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
629s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
632s .ERROR:root:No signing certificates found in urzip-release-unsigned.apk
632s .....ERROR:root:Found bad funding file "build/fake.app.id/FUNDING.yml" for "fake.app.id":
632s ERROR:root:mapping values are not allowed in this context
632s   in "build/fake.app.id/FUNDING.yml", line 4, column 12
635s ..WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
635s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
639s WARNING:root:Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"!
639s WARNING:root:Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"!
639s WARNING:root:Found "icon.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"!
639s WARNING:root:Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"!
639s .....WARNING:root:skipping test_insert_triple_t_metadata, import.TestCase must run first!
640s ..WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
641s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
644s .WARNING:root:repo/../urzip.apk is set to android:debuggable="true"
645s .localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
645s SKIPPING: apksigner installed and it allows MD5 signatures
645s .WARNING:androguard.apk:Missing AndroidManifest.xml. Is this an APK file?
645s ERROR:root:Failed to get APK information, skipping repo/fake.ota.update_1234.zip
645s WARNING:root:Skipping 'fake.ota.update_1234.zip' with invalid signature!
647s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
647s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
650s .WARNING:root:Ignoring FUNDING.yml entry longer than 2048: MNZSWPJBVEGQKJMQCDXMNFTGVJWLQWMBFMFNNDQEYEUGBITCBCAKPEVZNUOWZVUDVKVZILPLJPRWNDVVUSXTSXJUFKNXBHFPHXLXUWAIKYIJZMCTEFKGSWQGQRLSYYUUUEZGOHRHYDXXPXNEEUEGCMFRZIFXAEWITPVALXMELFMXZEXPGIEFLIYVWKAJNTCHPFPELKRUMAZTNKRGRJAFDAQCAQVEWZSBTZYQAHVHDEZNJNTHZIRNIQXCIMAIRNBRUNBAGEJCEMYDBKSUZWPRNQXZJUWGZYASFABJCNRRYYSWMPGTDIBSOOWSBGUROIMCCUEBKSSBSCZHZDTGDSFPCTZJCKKDFILBDXXWBATACALLCRDLVSNCCXTBCQLTVZIFICVOIRCTTNUACTDIBRHPRCMCGOPXHLKHGLUBUGGIQCDGLJRPZFAXQHUGWJQYQALQBOFGIPYVZVJPBOZHAJFNSNMSIDFPUURFNSFQDLLOWFGZADOVYCBCOITWLRIAYXFCBUNCQJNMOUANEBNTEZTZLKLLTKFDYRVXGRLNSTZLFDICAXHRQANYMTWIPVDTQSNMVNSMBDTWFDBJBPIKCMAREQGMMORJCFLRPUIAIQONAHTQRBSCTHUVIZHEUTSBKJMOXBYMHUFUKMQZGVFQSQZEIUXVEZPHIZWZBBUMSVZSWSLOKRHDURIFKUUWXYMWRHOFDUFXFZQXZVRXUNZOLKMCLSUOYOPVKJGCIGQUEJYEHRSNRJCKUWEBZJLZFEVMWHSFTWUXLMPXQMDCEDJZHJWCXEYQGLUOYDSDMYKLAQLQUXMBVHMPFFSUTCORYFDVNOBSIYCBUNGYKHTAZLZOBSXWVYSVENVEDDZRMWFYBMFYOBOSFCPFIPBXDBWPDXVIKEDWIBCAJSCFJYMTWHICFJYZZZMRPPQGXFYUFXHWCMJZBFEWSHAPTQUIIADCECDQUVUHYRBVZAWTOGZEMRXYBGPQIOMBTQYOMMQAXSNITVWFYKTJWMJBNONTCXBGLAJERAPEYWQYGILOGTXEZZQYEAAQWRANPQGVVSEVIWFNDSQKNISWKVQIUPXDUOXZFWVTVDUYPKVRPBMUFZLVNDYVXARHMEAYPGSWAXSSIJJBZBYFPICUQGUDSNDUCKECTZTSZTKJTPAYJVQIUMQMVIJXSKMYIKWGTMPTMKVXPHHGMZQAYNLTAYEVERIUNZRQKJFMAYDWHGWRNIPBQLTXOXYHWPLKUDKOASSZYJIYOMIBMJILFYNEVTIWYPWTKYFXXTTKGMXZYTLOBFUBLXMTOGXXNAXGVVBZPBEBSFNHQROIAHMGQFYLAFFTUMKWITTIJLXSTOLODTCMBNEIHEQABTQHDTCEULAXDSBORYNPHFLWXELJKODLZIAWELWSZIEFLYHTOQSIIXHHWSHIZMRCMVPWYBOMCPURXFQAKRAGCOGSGMRYKYYRPMUXBMPKKNBBKICXVYNAKTFVKKQUVVITEBEVMNVODOSFRBGUEAZLPJEMBMJXZYCJJKLOTDLQYBOILCWCFAUUMPGJDZJDMKTSFTMEJRKERYDMBQTKHLRGHRFRHKUUNBMXUHXIDNBCSNIGDUNBHFFGRCSZCXIILWSBNPPYJUKRWLGWZWZEMAEILWJUNKVRYHEIAKRSRJOKBSIDNGROYXZICWIOCYSUBRLZCVKCWUQIGLXHIQFLSLSMNEPGLDRKEPYQJSBYXWVRJVDUVEWNLBKMVWKLVHIBTBLFDFVNDLVICLLOYSWESMBGQUMIUAAYJHMUQPNFXZETCPIMDNIELOWSENDLQCKHGGNHMAXLOZTDSSUDSVVGNBFITYDKAELBGDZXMIFOIHSEYERBLPSTDJGLHQIIZUAZPWOCEKULCOTOIDHYRFIWDGDVVUJQYQUJKGLWLVXJLGCCIMPGXLJBBNLOPNNQIRIQRCWLMLXQATHJSFGRYRHHUQDUKTUGFVOVNSCSRVHLHHWYWIMQECTNSAHRIEUZTSVCLHLSZZQOGJRHBKDDNBMQRPXOEYUAVGCOHZULOMJEFXMKESIITMUPFIIS
650s .WARNING:root:No minimum SDK version found in SpeedoMeterApp.main_1.apk, using default (3).
650s .sERROR:root:Could not open APK repo/badzip_1.apk for analysis: File is not a zip file
650s .WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
650s .ERROR:root:No signing certificates found in urzip-release-unsigned.apk
650s ...ERROR:root:badlink.txt: [Errno 2] No such file or directory: 'badlink.txt'
650s .ERROR:root:badlink-full-description.txt: [Errno 2] No such file or directory: 'badlink-full-description.txt'
650s ERROR:root:badlink-short-description.txt: [Errno 2] No such file or directory: 'badlink-short-description.txt'
650s ERROR:root:badlink-title.txt: [Errno 2] No such file or directory: 'badlink-title.txt'
650s ERROR:root:badlink-video-url.txt: [Errno 2] No such file or directory: 'badlink-video-url.txt'
650s ..ERROR:root:Failed copying /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/corrupt-featureGraphic.png: cannot identify image file <_io.BufferedReader name='/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/corrupt-featureGraphic.png'>
653s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
653s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
656s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
656s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
656s   repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc)
657s 
657s Warning:
657s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
657s INFO:root:Creating signed index with this key (SHA256):
657s INFO:root:F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
658s jar signed.
658s 
658s Warning: 
658s The signer's certificate is self-signed.
658s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
658s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
658s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
658s jar signed.
658s 
658s Warning: 
658s The signer's certificate is self-signed.
658s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
658s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
658s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
659s 
659s Warning:
659s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
660s INFO:root:Finished
660s WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
660s WARNING:root:"com.politedroid_6.apk" is signed by a key that is not allowed:
660s 32a23624c201b949f085996ba5ed53d40f703aca4989476949cae891022e0ed6
660s WARNING:root:Removing repo/com.politedroid_6.apk"
660s /tmp/autopkgtest.tyZAgp/build.nAO/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC).
660s   repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc)
660s 
660s Warning:
660s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
660s INFO:root:Creating signed index with this key (SHA256):
660s INFO:root:F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
661s jar signed.
661s 
661s Warning: 
661s The signer's certificate is self-signed.
661s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
661s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
661s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
662s jar signed.
662s 
662s Warning: 
662s The signer's certificate is self-signed.
662s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
662s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
662s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
663s 
663s Warning:
663s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
664s INFO:root:Finished
664s .
664s ----------------------------------------------------------------------
664s Ran 45 tests in 68.479s
664s 
664s OK (skipped=1)
664s + for testcase in $WORKSPACE/tests/*.TestCase
664s + '[' /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/vcs.TestCase == /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/install.TestCase ']'
664s + /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/vcs.TestCase
664s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/vcs.TestCase:96: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead.
664s   newSuite.addTest(unittest.makeSuite(VCSTest))
664s DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpy9i9ih3z/upstream_repo, universal_newlines=False, shell=None, istream=None)
664s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpy9i9ih3z/upstream_repo, universal_newlines=False, shell=None, istream=<valid stream>)
664s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch'], cwd=/tmp/tmpy9i9ih3z/upstream_repo, universal_newlines=False, shell=None, istream=<valid stream>)
664s DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpy9i9ih3z/clone1, universal_newlines=False, shell=None, istream=None)
664s DEBUG:git.cmd:Popen(['git', 'remote', 'add', '--', 'upstream', 'file:///tmp/tmpy9i9ih3z/upstream_repo'], cwd=/tmp/tmpy9i9ih3z/clone1, universal_newlines=False, shell=None, istream=None)
664s DEBUG:git.cmd:Popen(['git', 'fetch', '-v', '--', 'upstream'], cwd=/tmp/tmpy9i9ih3z/clone1, universal_newlines=True, shell=None, istream=None)
664s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpy9i9ih3z/clone1, universal_newlines=False, shell=None, istream=<valid stream>)
664s DEBUG:git.cmd:Popen(['git', 'reset', '--hard', 'HEAD', '--'], cwd=/tmp/tmpy9i9ih3z/clone1, universal_newlines=False, shell=None, istream=None)
664s DEBUG:root:Getting git vcs interface for /tmp/tmpy9i9ih3z/clone1
664s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- /tmp/tmpy9i9ih3z/clone1 build/com.gpl.rpg.AndorsTrail
664s Cloning into 'build/com.gpl.rpg.AndorsTrail'...
664s done.
664s Note: switching to 'f78c75091d98e04a5e8c039023bb31a85d85b0e9'.
664s 
664s You are in 'detached HEAD' state. You can look around, make experimental
664s changes and commit them, and you can discard any commits you make in this
664s state without impacting any branches by switching back to a branch.
664s 
664s If you want to create a new branch to retain commits you create, you may
664s do so (now or later) by using -c with the switch command. Example:
664s 
664s   git switch -c <new-branch-name>
664s 
664s Or undo this operation with:
664s 
664s   git switch -
664s 
664s Turn off this advice by setting config variable advice.detachedHead to false
664s 
665s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
665s DEBUG:root:> git rev-parse --show-toplevel
665s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
665s DEBUG:root:> git checkout -f f78c75091d98e04a5e8c039023bb31a85d85b0e9
665s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
665s DEBUG:root:> git clean -dffx
665s INFO:root:Getting source for revision f78c75091d98e04a5e8c039023bb31a85d85b0e9
665s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
665s DEBUG:root:> git rev-parse --show-toplevel
665s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
665s DEBUG:root:> git submodule foreach --recursive git reset --hard
665s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
665s DEBUG:root:> git reset --hard
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git submodule foreach --recursive git clean -dffx
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git clean -dffx
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch origin
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org remote prune origin
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git remote set-head origin --auto
666s WARNING:root:Git remote set-head failed: "error: Cannot determine remote HEAD"
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git checkout -f f78c75091d98e04a5e8c039023bb31a85d85b0e9
666s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail
666s DEBUG:root:> git clean -dffx
667s INFO:root:Creating local.properties file at build/com.gpl.rpg.AndorsTrail/local.properties
667s DEBUG:root:Removing debuggable flags from build/com.gpl.rpg.AndorsTrail
667s .
667s ----------------------------------------------------------------------
667s Ran 1 test in 2.272s
667s 
667s OK
667s localmodule: /tmp/autopkgtest.tyZAgp/build.nAO/src
667s + echo_header 'print fdroid version'
667s + /usr/bin/fdroid --version
667s ==============================================================================
667s print fdroid version
667s no version info found!
667s ==============================================================================
667s run process when building and signing are on separate machines
667s + echo_header 'run process when building and signing are on separate machines'
667s + use_apksigner
667s + python3 -c '
667s import sys
667s sys.path.insert(0, '\''/tmp/autopkgtest.tyZAgp/build.nAO/src'\'')
667s from fdroidserver import common
667s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''}
667s common.find_apksigner(c)
667s exit(c.get('\''apksigner'\'') is None)
667s '
667s ++ create_test_dir
667s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
667s ++ mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
667s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
667s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC
667s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC
667s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/
668s + /usr/bin/fdroid init --keystore keystore.jks --repo-keyalias=sova
668s 2024-03-26 05:40:43,369 WARNING: 
668s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks"
668s Now set these in config.yml: keystorepass, keypass, keydname
668s 
668s 2024-03-26 05:40:43,369 INFO: 
668s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC" with this config:
668s 
668s   Android SDK:			/usr/lib/android-sdk
668s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks
668s   Alias for key in store:	sova
668s 
668s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/repo"
668s then run "fdroid update -c; fdroid update".  You might also want to edit
668s "config.yml" to set the URL, repo name, and more.  You should also set up
668s a signing key (a temporary one might have been automatically generated).
668s 
668s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
668s and https://f-droid.org/docs/Signing_Process
668s + echo 'make_current_version_link: true'
668s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
668s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
668s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"'
668s + test -d archive
668s + mkdir archive
668s + test -d metadata
668s + mkdir metadata
668s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/info.guardianproject.urzip.yml metadata/
668s + test -d repo
668s + test -d unsigned
668s + mkdir unsigned
668s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release-unsigned.apk unsigned/info.guardianproject.urzip_100.apk
668s + /usr/bin/fdroid publish --verbose
668s 2024-03-26 05:40:43,861 DEBUG: Reading 'config.yml'
668s 2024-03-26 05:40:43,872 DEBUG: ipfs_cid not found, skipping CIDv1 generation
668s 2024-03-26 05:40:43,872 INFO: Creating log directory
668s 2024-03-26 05:40:43,872 INFO: Creating temporary directory
668s 2024-03-26 05:40:43,874 INFO: 1 app, 1 key aliases
668s 2024-03-26 05:40:43,875 INFO: Processing unsigned/info.guardianproject.urzip_100.apk
668s 2024-03-26 05:40:43,875 INFO: Key alias: d0299f24
668s 2024-03-26 05:40:43,875 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -list -alias d0299f24 -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
669s keytool error: java.lang.Exception: Alias <d0299f24> does not exist
669s 2024-03-26 05:40:44,487 INFO: Key does not exist - generating...
669s 2024-03-26 05:40:44,487 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -genkey -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -alias d0299f24 -keyalg RSA -keysize 2048 -validity 10000 -storepass:env FDROID_KEY_STORE_PASS -dname CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US -keypass:env FDROID_KEY_PASS
670s Generating 2,048 bit RSA key pair and self-signed certificate (SHA384withRSA) with a validity of 10,000 days
670s 	for: CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, ST=California, C=US
670s 
670s Warning:
670s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -deststoretype pkcs12".
670s 2024-03-26 05:40:45,768 DEBUG: > /usr/bin/apksigner sign --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias d0299f24 --in unsigned/info.guardianproject.urzip_100.apk --out repo/info.guardianproject.urzip_100.apk
671s 2024-03-26 05:40:46,279 DEBUG: ...no source tarball for info.guardianproject.urzip_100.apk
671s 2024-03-26 05:40:46,279 INFO: Published info.guardianproject.urzip_100.apk
671s 2024-03-26 05:40:46,279 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
671s 2024-03-26 05:40:46,798 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS
672s jar signed.
672s 
672s Warning: 
672s The signer's certificate is self-signed.
672s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
672s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
672s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
672s 2024-03-26 05:40:47,506 DEBUG: Outputting JSON
672s 2024-03-26 05:40:47,506 DEBUG: skip deploying full build logs: not enabled in config
672s 2024-03-26 05:40:47,512 DEBUG: skip deploying full build logs: not enabled in config
672s 2024-03-26 05:40:47,512 DEBUG: skip deploying full build logs: not enabled in config
672s 2024-03-26 05:40:47,512 INFO: published list signing-key fingerprints
672s + /usr/bin/fdroid update --verbose --nosign
672s 2024-03-26 05:40:47,963 DEBUG: Reading 'config.yml'
672s 2024-03-26 05:40:47,974 DEBUG: ipfs_cid not found, skipping CIDv1 generation
672s 2024-03-26 05:40:47,974 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
672s 2024-03-26 05:40:47,974 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
673s 2024-03-26 05:40:47,977 DEBUG: Processing info.guardianproject.urzip_100.apk
673s 2024-03-26 05:40:48,082 INFO: Starting analysis on AndroidManifest.xml
673s 2024-03-26 05:40:48,091 INFO: APK file was successfully validated!
673s 2024-03-26 05:40:48,093 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
673s 2024-03-26 05:40:48,388 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
673s Verified using v1 scheme (JAR signing): true
673s Verified using v2 scheme (APK Signature Scheme v2): true
673s Verified using v3 scheme (APK Signature Scheme v3): true
673s Verified using v4 scheme (APK Signature Scheme v4): false
673s Verified for SourceStamp: false
673s Number of signers: 1
673s 
673s 2024-03-26 05:40:48,391 DEBUG: Density 120 not available, resizing down from 160
673s 2024-03-26 05:40:48,776 DEBUG: JAR signature verified: stats/publishsigkeys.jar
673s 2024-03-26 05:40:48,780 WARNING: repo_key_sha256 not in config.yml, setting it to the signature key fingerprint of 'stats/publishsigkeys.jar'
673s 2024-03-26 05:40:48,781 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
674s 
674s Warning:
674s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -deststoretype pkcs12".
674s 2024-03-26 05:40:49,390 INFO: Creating unsigned index in preparation for signing
674s 2024-03-26 05:40:49,390 DEBUG: Directory: repo
674s 2024-03-26 05:40:49,390 DEBUG: > jar cf index_unsigned.jar index.xml
674s 2024-03-26 05:40:49,591 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
674s 2024-03-26 05:40:49,598 DEBUG: index-v1 must have a signature, use `fdroid signindex` to create it!
674s 2024-03-26 05:40:49,600 DEBUG: index-v2 must have a signature, use `fdroid signindex` to create it!
674s 2024-03-26 05:40:49,600 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
674s 
674s Warning:
674s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -deststoretype pkcs12".
675s 2024-03-26 05:40:50,116 DEBUG: Outputting JSON
675s 2024-03-26 05:40:50,117 DEBUG: skip deploying full build logs: not enabled in config
675s 2024-03-26 05:40:50,117 DEBUG: skip deploying full build logs: not enabled in config
675s 2024-03-26 05:40:50,118 DEBUG: skip deploying full build logs: not enabled in config
675s 2024-03-26 05:40:50,118 INFO: Finished
675s + /usr/bin/fdroid signindex --verbose
675s 2024-03-26 05:40:50,571 DEBUG: Reading 'config.yml'
675s 2024-03-26 05:40:50,581 DEBUG: ipfs_cid not found, skipping CIDv1 generation
675s 2024-03-26 05:40:50,581 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/index_unsigned.jar
676s 2024-03-26 05:40:51,083 INFO: Signed index in repo
676s 2024-03-26 05:40:51,084 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS
676s jar signed.
676s 
676s Warning: 
676s The signer's certificate is self-signed.
676s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
676s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
676s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
676s 2024-03-26 05:40:51,800 INFO: Signed repo/index-v1.json
676s 2024-03-26 05:40:51,800 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1TzC/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
677s 2024-03-26 05:40:52,203 INFO: Signed repo/entry.json
677s 2024-03-26 05:40:52,204 DEBUG: Outputting JSON
677s 2024-03-26 05:40:52,204 DEBUG: skip deploying full build logs: not enabled in config
677s 2024-03-26 05:40:52,205 DEBUG: skip deploying full build logs: not enabled in config
677s 2024-03-26 05:40:52,205 DEBUG: skip deploying full build logs: not enabled in config
677s + test -e repo/index.xml
677s + test -e repo/index.jar
677s + test -e repo/index-v1.jar
677s + test -e tmp/apkcache.json
677s + test -z tmp/apkcache.json
677s + test -L urzip.apk
677s + grep -F '<application id=' repo/index.xml
677s + echo_header 'TODO remove once buildserver image is upgraded to bullseye with apksigner'
677s ==============================================================================
677s TODO remove once buildserver image is upgraded to bullseye with apksigner
677s + java -version
677s + grep -F 1.8.0
677s + echo_header 'test UTF-8 metadata'
677s ==============================================================================
677s test UTF-8 metadata
677s ++ create_test_dir
677s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
677s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
677s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.8Fr2
677s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.8Fr2
677s + fdroid_init_with_prebuilt_keystore
677s + '[' -z '' ']'
677s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
677s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
677s 2024-03-26 05:40:52,703 WARNING: 
677s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
677s Now set these in config.yml: keystorepass, keypass, keydname
677s 
677s 2024-03-26 05:40:52,703 INFO: 
677s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.8Fr2" with this config:
677s 
677s   Android SDK:			/usr/lib/android-sdk
677s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
677s   Alias for key in store:	sova
677s 
677s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.8Fr2/repo"
677s then run "fdroid update -c; fdroid update".  You might also want to edit
677s "config.yml" to set the URL, repo name, and more.  You should also set up
677s a signing key (a temporary one might have been automatically generated).
677s 
677s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
677s and https://f-droid.org/docs/Signing_Process
677s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
677s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
677s + sed -i.tmp 's,^ *repo_description.*,repo_description: |\n  获取已安装在您的设备上的应用的,' config.yml
677s + echo 'mirrors: ['\''https://foo.bar/fdroid'\'', '\''http://secret.onion/fdroid'\'']'
677s + mkdir metadata
677s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/bad-unicode-πÇÇ现代通用字-български-عربي1.apk repo/
677s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/info.guardianproject.urzip.yml metadata/
677s + /usr/bin/fdroid readmeta
679s + /usr/bin/fdroid update
679s 2024-03-26 05:40:53,766 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
679s 2024-03-26 05:40:53,890 INFO: Starting analysis on AndroidManifest.xml
679s 2024-03-26 05:40:53,914 INFO: APK file was successfully validated!
679s 2024-03-26 05:40:54,321 INFO: Starting analysis on AndroidManifest.xml
679s 2024-03-26 05:40:54,323 INFO: APK file was successfully validated!
679s 2024-03-26 05:40:54,330 WARNING: repo/urzip.apk is set to android:debuggable="true"
680s 2024-03-26 05:40:55,184 INFO: Creating signed index with this key (SHA256):
680s 2024-03-26 05:40:55,185 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
681s 2024-03-26 05:40:56,200 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
683s 2024-03-26 05:40:58,283 INFO: Finished
683s ==============================================================================
683s copy git import and run "fdroid scanner" on it
683s + echo_header 'copy git import and run "fdroid scanner" on it'
683s ++ create_test_dir
683s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
683s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
683s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tQBf
683s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tQBf
683s + mkdir metadata
683s + echo 'AutoName: Just A Test'
683s + echo 'WebSite: '
683s + echo Builds:
683s + echo ' - versionName: 0.3'
683s + echo '   versionCode: 300'
683s + echo '   commit: 0.3'
683s + echo '   subdir: app'
683s + echo '   gradle:'
683s + echo '     - yes'
683s + echo ''
683s + echo 'Repo: https://gitlab.com/fdroid/ci-test-app.git'
683s + echo 'RepoType: git'
683s + mkdir build
683s + git clone https://gitlab.com/fdroid/ci-test-app.git build/org.fdroid.ci.test.app
683s Cloning into 'build/org.fdroid.ci.test.app'...
685s + ls -l build/org.fdroid.ci.test.app
685s + /usr/bin/fdroid scanner org.fdroid.ci.test.app --verbose
685s total 52
685s -rw-rw-r-- 1 ubuntu ubuntu   143 Mar 26 05:41 README.md
685s drwxrwxr-x 3 ubuntu ubuntu  4096 Mar 26 05:41 app
685s -rw-rw-r-- 1 ubuntu ubuntu   268 Mar 26 05:41 build.gradle
685s -rw-rw-r-- 1 ubuntu ubuntu 28714 Mar 26 05:41 ic_launcher-web.png
685s -rw-rw-r-- 1 ubuntu ubuntu   563 Mar 26 05:41 project.properties
685s -rw-rw-r-- 1 ubuntu ubuntu    15 Mar 26 05:41 settings.gradle
685s 2024-03-26 05:41:00,681 DEBUG: ipfs_cid not found, skipping CIDv1 generation
685s 2024-03-26 05:41:00,686 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tQBf/build/org.fdroid.ci.test.app, universal_newlines=False, shell=None, istream=<valid stream>)
685s 2024-03-26 05:41:00,688 DEBUG: Including metadata from build/org.fdroid.ci.test.app/.fdroid.yml@723e955be8fa0647c021992040f0ae8ae8c4569d
685s 2024-03-26 05:41:00,690 INFO: Processing org.fdroid.ci.test.app
685s 2024-03-26 05:41:00,690 INFO: ...scanning version 0.3
685s 2024-03-26 05:41:00,690 INFO: Getting source for revision 0.3
685s 2024-03-26 05:41:00,690 INFO: Repository details for build/org.fdroid.ci.test.app missing - deleting
685s 2024-03-26 05:41:00,699 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git build/org.fdroid.ci.test.app
685s Cloning into 'build/org.fdroid.ci.test.app'...
687s 2024-03-26 05:41:02,104 DEBUG: Directory: build/org.fdroid.ci.test.app
687s 2024-03-26 05:41:02,104 DEBUG: > git rev-parse --show-toplevel
687s 2024-03-26 05:41:02,306 DEBUG: Directory: build/org.fdroid.ci.test.app
687s 2024-03-26 05:41:02,306 DEBUG: > git checkout -f 0.3
687s 2024-03-26 05:41:02,507 DEBUG: Directory: build/org.fdroid.ci.test.app
687s 2024-03-26 05:41:02,507 DEBUG: > git clean -dffx
687s 2024-03-26 05:41:02,609 INFO: Creating local.properties file at build/org.fdroid.ci.test.app/local.properties
687s 2024-03-26 05:41:02,609 INFO: Creating local.properties file at build/org.fdroid.ci.test.app/app/local.properties
687s 2024-03-26 05:41:02,609 DEBUG: Removing debuggable flags from build/org.fdroid.ci.test.app/app
687s 2024-03-26 05:41:02,613 DEBUG: scanner is configured to use signature data from: 'suss'
687s 2024-03-26 05:41:02,616 INFO: Finished
687s 0 problems found
687s + echo_header 'copy tests/repo, generate java/gpg keys, update, and gpgsign'
687s ==============================================================================
687s copy tests/repo, generate java/gpg keys, update, and gpgsign
687s ++ create_test_dir
687s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
687s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
687s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo
687s + GNUPGHOME=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo/gnupghome
687s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo
687s + fdroid_init_with_prebuilt_keystore
687s + '[' -z '' ']'
687s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
687s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
688s 2024-03-26 05:41:03,201 WARNING: 
688s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
688s Now set these in config.yml: keystorepass, keypass, keydname
688s 
688s 2024-03-26 05:41:03,201 INFO: 
688s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo" with this config:
688s 
688s   Android SDK:			/usr/lib/android-sdk
688s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
688s   Alias for key in store:	sova
688s 
688s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo/repo"
688s then run "fdroid update -c; fdroid update".  You might also want to edit
688s "config.yml" to set the URL, repo name, and more.  You should also set up
688s a signing key (a temporary one might have been automatically generated).
688s 
688s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
688s and https://f-droid.org/docs/Signing_Process
688s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
688s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
688s + cp -a /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/stats /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo/
688s + cp -a /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/gnupghome /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo/gnupghome
688s + chmod 0700 /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo/gnupghome
688s + echo 'install_list: org.adaway'
688s + echo 'uninstall_list: [com.android.vending, com.facebook.orca]'
688s + echo 'gpghome: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.1hHo/gnupghome'
688s + echo 'gpgkey: CE71F7FB'
688s + echo 'mirrors: ['\''http://foobarfoobarfoobar.onion/fdroid'\'', '\''https://foo.bar/fdroid'\'']'
688s + /usr/bin/fdroid update --verbose --pretty
689s 2024-03-26 05:41:04,119 DEBUG: Reading 'config.yml'
689s 2024-03-26 05:41:04,130 DEBUG: ipfs_cid not found, skipping CIDv1 generation
689s 2024-03-26 05:41:04,130 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
689s 2024-03-26 05:41:04,130 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
689s 2024-03-26 05:41:04,212 DEBUG: Processing com.example.test.helloworld_1.apk
689s 2024-03-26 05:41:04,369 INFO: Starting analysis on AndroidManifest.xml
689s 2024-03-26 05:41:04,394 INFO: APK file was successfully validated!
689s 2024-03-26 05:41:04,398 DEBUG: Getting signature of com.example.test.helloworld_1.apk
690s 2024-03-26 05:41:05,785 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
690s Verified using v1 scheme (JAR signing): true
690s Verified using v2 scheme (APK Signature Scheme v2): false
690s Verified using v3 scheme (APK Signature Scheme v3): false
690s Verified using v4 scheme (APK Signature Scheme v4): false
690s Verified for SourceStamp: false
690s Number of signers: 1
690s 
690s 2024-03-26 05:41:05,791 DEBUG: Processing com.politedroid_3.apk
690s 2024-03-26 05:41:05,791 INFO: Starting analysis on AndroidManifest.xml
690s 2024-03-26 05:41:05,797 INFO: APK file was successfully validated!
690s 2024-03-26 05:41:05,799 DEBUG: Getting signature of com.politedroid_3.apk
691s 2024-03-26 05:41:06,278 DEBUG: repo/com.politedroid_3.apk: Verifies
691s Verified using v1 scheme (JAR signing): true
691s Verified using v2 scheme (APK Signature Scheme v2): false
691s Verified using v3 scheme (APK Signature Scheme v3): false
691s Verified using v4 scheme (APK Signature Scheme v4): false
691s Verified for SourceStamp: false
691s Number of signers: 1
691s 
691s 2024-03-26 05:41:06,287 DEBUG: Processing com.politedroid_4.apk
691s 2024-03-26 05:41:06,288 INFO: Starting analysis on AndroidManifest.xml
691s 2024-03-26 05:41:06,288 INFO: APK file was successfully validated!
691s 2024-03-26 05:41:06,290 DEBUG: Getting signature of com.politedroid_4.apk
691s 2024-03-26 05:41:06,624 DEBUG: repo/com.politedroid_4.apk: Verifies
691s Verified using v1 scheme (JAR signing): true
691s Verified using v2 scheme (APK Signature Scheme v2): false
691s Verified using v3 scheme (APK Signature Scheme v3): false
691s Verified using v4 scheme (APK Signature Scheme v4): false
691s Verified for SourceStamp: false
691s Number of signers: 1
691s 
691s 2024-03-26 05:41:06,625 DEBUG: Processing com.politedroid_5.apk
691s 2024-03-26 05:41:06,625 INFO: Starting analysis on AndroidManifest.xml
691s 2024-03-26 05:41:06,626 INFO: APK file was successfully validated!
691s 2024-03-26 05:41:06,628 DEBUG: Getting signature of com.politedroid_5.apk
691s 2024-03-26 05:41:06,915 DEBUG: repo/com.politedroid_5.apk: Verifies
691s Verified using v1 scheme (JAR signing): true
691s Verified using v2 scheme (APK Signature Scheme v2): false
691s Verified using v3 scheme (APK Signature Scheme v3): false
691s Verified using v4 scheme (APK Signature Scheme v4): false
691s Verified for SourceStamp: false
691s Number of signers: 1
691s 
691s 2024-03-26 05:41:06,923 DEBUG: Processing com.politedroid_6.apk
691s 2024-03-26 05:41:06,923 INFO: Starting analysis on AndroidManifest.xml
691s 2024-03-26 05:41:06,924 INFO: APK file was successfully validated!
691s 2024-03-26 05:41:06,926 DEBUG: Getting signature of com.politedroid_6.apk
692s 2024-03-26 05:41:07,231 DEBUG: repo/com.politedroid_6.apk: Verifies
692s Verified using v1 scheme (JAR signing): true
692s Verified using v2 scheme (APK Signature Scheme v2): false
692s Verified using v3 scheme (APK Signature Scheme v3): false
692s Verified using v4 scheme (APK Signature Scheme v4): false
692s Verified for SourceStamp: false
692s Number of signers: 1
692s 
692s 2024-03-26 05:41:07,233 DEBUG: Processing duplicate.permisssions_9999999.apk
692s 2024-03-26 05:41:07,233 INFO: Starting analysis on AndroidManifest.xml
692s 2024-03-26 05:41:07,235 INFO: APK file was successfully validated!
692s 2024-03-26 05:41:07,237 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
692s 2024-03-26 05:41:07,243 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
692s 2024-03-26 05:41:07,685 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
692s Verified using v1 scheme (JAR signing): true
692s Verified using v2 scheme (APK Signature Scheme v2): true
692s Verified using v3 scheme (APK Signature Scheme v3): false
692s Verified using v4 scheme (APK Signature Scheme v4): false
692s Verified for SourceStamp: false
692s Number of signers: 1
692s 
692s 2024-03-26 05:41:07,708 DEBUG: Density 120 not available, resizing down from 160
692s 2024-03-26 05:41:07,773 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
692s 2024-03-26 05:41:07,800 INFO: Starting analysis on AndroidManifest.xml
692s 2024-03-26 05:41:07,817 INFO: APK file was successfully validated!
692s 2024-03-26 05:41:07,826 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
693s 2024-03-26 05:41:08,175 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
693s Verified using v1 scheme (JAR signing): true
693s Verified using v2 scheme (APK Signature Scheme v2): false
693s Verified using v3 scheme (APK Signature Scheme v3): false
693s Verified using v4 scheme (APK Signature Scheme v4): false
693s Verified for SourceStamp: false
693s Number of signers: 1
693s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
693s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
693s 
693s 2024-03-26 05:41:08,181 DEBUG: Processing no.min.target.sdk_987.apk
693s 2024-03-26 05:41:08,181 INFO: Starting analysis on AndroidManifest.xml
693s 2024-03-26 05:41:08,183 INFO: APK file was successfully validated!
693s 2024-03-26 05:41:08,184 DEBUG: Getting signature of no.min.target.sdk_987.apk
693s 2024-03-26 05:41:08,192 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
693s 2024-03-26 05:41:08,558 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
693s Verified using v1 scheme (JAR signing): true
693s Verified using v2 scheme (APK Signature Scheme v2): true
693s Verified using v3 scheme (APK Signature Scheme v3): false
693s Verified using v4 scheme (APK Signature Scheme v4): false
693s Verified for SourceStamp: false
693s Number of signers: 1
693s 
693s 2024-03-26 05:41:08,559 DEBUG: Density 120 not available, resizing down from 160
693s 2024-03-26 05:41:08,560 DEBUG: Processing obb.main.oldversion_1444412523.apk
693s 2024-03-26 05:41:08,561 INFO: Starting analysis on AndroidManifest.xml
693s 2024-03-26 05:41:08,563 INFO: APK file was successfully validated!
693s 2024-03-26 05:41:08,564 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
693s 2024-03-26 05:41:08,918 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
693s Verified using v1 scheme (JAR signing): true
693s Verified using v2 scheme (APK Signature Scheme v2): true
693s Verified using v3 scheme (APK Signature Scheme v3): false
693s Verified using v4 scheme (APK Signature Scheme v4): false
693s Verified for SourceStamp: false
693s Number of signers: 1
693s 
693s 2024-03-26 05:41:08,919 DEBUG: Density 120 not available, resizing down from 160
693s 2024-03-26 05:41:08,921 DEBUG: Processing obb.main.twoversions_1101613.apk
693s 2024-03-26 05:41:08,921 INFO: Starting analysis on AndroidManifest.xml
693s 2024-03-26 05:41:08,922 INFO: APK file was successfully validated!
693s 2024-03-26 05:41:08,924 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
695s 2024-03-26 05:41:10,081 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
695s Verified using v1 scheme (JAR signing): true
695s Verified using v2 scheme (APK Signature Scheme v2): false
695s Verified using v3 scheme (APK Signature Scheme v3): false
695s Verified using v4 scheme (APK Signature Scheme v4): false
695s Verified for SourceStamp: false
695s Number of signers: 1
695s 
695s 2024-03-26 05:41:10,091 DEBUG: Density 120 not available, resizing down from 160
695s 2024-03-26 05:41:10,098 DEBUG: Processing obb.main.twoversions_1101615.apk
695s 2024-03-26 05:41:10,099 INFO: Starting analysis on AndroidManifest.xml
695s 2024-03-26 05:41:10,107 INFO: APK file was successfully validated!
695s 2024-03-26 05:41:10,109 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
695s 2024-03-26 05:41:10,503 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
695s Verified using v1 scheme (JAR signing): true
695s Verified using v2 scheme (APK Signature Scheme v2): false
695s Verified using v3 scheme (APK Signature Scheme v3): false
695s Verified using v4 scheme (APK Signature Scheme v4): false
695s Verified for SourceStamp: false
695s Number of signers: 1
695s 
695s 2024-03-26 05:41:10,504 DEBUG: Density 120 not available, resizing down from 160
695s 2024-03-26 05:41:10,505 DEBUG: Processing obb.main.twoversions_1101617.apk
695s 2024-03-26 05:41:10,506 INFO: Starting analysis on AndroidManifest.xml
695s 2024-03-26 05:41:10,507 INFO: APK file was successfully validated!
695s 2024-03-26 05:41:10,508 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
695s 2024-03-26 05:41:10,854 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
695s Verified using v1 scheme (JAR signing): true
695s Verified using v2 scheme (APK Signature Scheme v2): false
695s Verified using v3 scheme (APK Signature Scheme v3): false
695s Verified using v4 scheme (APK Signature Scheme v4): false
695s Verified for SourceStamp: false
695s Number of signers: 1
695s 
695s 2024-03-26 05:41:10,854 DEBUG: Density 120 not available, resizing down from 160
695s 2024-03-26 05:41:10,856 DEBUG: Processing obb.mainpatch.current_1619.apk
695s 2024-03-26 05:41:10,856 INFO: Starting analysis on AndroidManifest.xml
695s 2024-03-26 05:41:10,858 INFO: APK file was successfully validated!
695s 2024-03-26 05:41:10,859 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
696s 2024-03-26 05:41:11,167 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
696s Verified using v1 scheme (JAR signing): true
696s Verified using v2 scheme (APK Signature Scheme v2): false
696s Verified using v3 scheme (APK Signature Scheme v3): false
696s Verified using v4 scheme (APK Signature Scheme v4): false
696s Verified for SourceStamp: false
696s Number of signers: 1
696s 
696s 2024-03-26 05:41:11,167 DEBUG: Density 120 not available, resizing down from 160
696s 2024-03-26 05:41:11,169 DEBUG: Processing obb.mainpatch.current_1619_another-release-key.apk
696s 2024-03-26 05:41:11,169 INFO: Starting analysis on AndroidManifest.xml
696s 2024-03-26 05:41:11,170 INFO: APK file was successfully validated!
696s 2024-03-26 05:41:11,172 DEBUG: Getting signature of obb.mainpatch.current_1619_another-release-key.apk
696s 2024-03-26 05:41:11,447 DEBUG: repo/obb.mainpatch.current_1619_another-release-key.apk: Verifies
696s Verified using v1 scheme (JAR signing): true
696s Verified using v2 scheme (APK Signature Scheme v2): false
696s Verified using v3 scheme (APK Signature Scheme v3): false
696s Verified using v4 scheme (APK Signature Scheme v4): false
696s Verified for SourceStamp: false
696s Number of signers: 1
696s 
696s 2024-03-26 05:41:11,447 DEBUG: Density 120 not available, resizing down from 160
696s 2024-03-26 05:41:11,449 DEBUG: Processing souch.smsbypass_9.apk
696s 2024-03-26 05:41:11,449 INFO: Starting analysis on AndroidManifest.xml
696s 2024-03-26 05:41:11,450 INFO: APK file was successfully validated!
696s 2024-03-26 05:41:11,453 DEBUG: Getting signature of souch.smsbypass_9.apk
696s 2024-03-26 05:41:11,743 DEBUG: repo/souch.smsbypass_9.apk: Verifies
696s Verified using v1 scheme (JAR signing): true
696s Verified using v2 scheme (APK Signature Scheme v2): false
696s Verified using v3 scheme (APK Signature Scheme v3): false
696s Verified using v4 scheme (APK Signature Scheme v4): false
696s Verified for SourceStamp: false
696s Number of signers: 1
696s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
696s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
696s 
696s 2024-03-26 05:41:11,744 DEBUG: Density 120 not available, resizing down from 160
696s 2024-03-26 05:41:11,746 DEBUG: Processing urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
696s 2024-03-26 05:41:11,746 INFO: Starting analysis on AndroidManifest.xml
696s 2024-03-26 05:41:11,748 INFO: APK file was successfully validated!
696s 2024-03-26 05:41:11,749 DEBUG: Getting signature of urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
697s 2024-03-26 05:41:12,058 DEBUG: repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk: Verifies
697s Verified using v1 scheme (JAR signing): true
697s Verified using v2 scheme (APK Signature Scheme v2): false
697s Verified using v3 scheme (APK Signature Scheme v3): false
697s Verified using v4 scheme (APK Signature Scheme v4): false
697s Verified for SourceStamp: false
697s Number of signers: 1
697s 
697s 2024-03-26 05:41:12,058 DEBUG: Density 120 not available, resizing down from 160
697s 2024-03-26 05:41:12,060 DEBUG: Processing v1.v2.sig_1020.apk
697s 2024-03-26 05:41:12,060 INFO: Starting analysis on AndroidManifest.xml
697s 2024-03-26 05:41:12,062 INFO: APK file was successfully validated!
697s 2024-03-26 05:41:12,063 DEBUG: Getting signature of v1.v2.sig_1020.apk
697s 2024-03-26 05:41:12,414 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
697s Verified using v1 scheme (JAR signing): true
697s Verified using v2 scheme (APK Signature Scheme v2): true
697s Verified using v3 scheme (APK Signature Scheme v3): false
697s Verified using v4 scheme (APK Signature Scheme v4): false
697s Verified for SourceStamp: false
697s Number of signers: 1
697s 
697s 2024-03-26 05:41:12,420 DEBUG: Density 120 not available, resizing down from 160
697s 2024-03-26 05:41:12,440 DEBUG: Processing fake.ota.update_1234.zip
697s 2024-03-26 05:41:12,440 DEBUG: skipping source tarball: repo/obb.main.twoversions_1101617_src.tar.gz
697s 2024-03-26 05:41:12,440 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata!
697s 	Use `fdroid update -c` to create it.
697s 2024-03-26 05:41:12,440 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata!
697s 	Use `fdroid update -c` to create it.
697s 2024-03-26 05:41:12,442 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan.
697s 2024-03-26 05:41:12,442 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan.
697s 2024-03-26 05:41:12,442 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan.
697s 2024-03-26 05:41:12,443 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/icon.png repo/info.guardianproject.urzip/en-US
697s 2024-03-26 05:41:12,443 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/featureGraphic.png repo/info.guardianproject.urzip/en-US
697s 2024-03-26 05:41:12,524 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan.
697s 2024-03-26 05:41:12,524 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan.
697s 2024-03-26 05:41:12,524 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan.
697s 2024-03-26 05:41:12,525 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"!
697s 2024-03-26 05:41:12,525 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"!
697s 2024-03-26 05:41:12,526 DEBUG: adding to phoneScreenshots: repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png
697s 2024-03-26 05:41:12,526 DEBUG: adding to sevenInchScreenshots: repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
697s 2024-03-26 05:41:12,526 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,526 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,526 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,527 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,528 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,528 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"!
697s 2024-03-26 05:41:12,528 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
698s 
698s Warning:
698s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
698s 2024-03-26 05:41:13,216 INFO: Creating signed index with this key (SHA256):
698s 2024-03-26 05:41:13,216 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
698s 2024-03-26 05:41:13,217 DEBUG: Directory: repo
698s 2024-03-26 05:41:13,217 DEBUG: > jar cf index.jar index.xml
698s 2024-03-26 05:41:13,544 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS
699s jar signed.
699s 
699s Warning: 
699s The signer's certificate is self-signed.
699s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
699s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
699s 2024-03-26 05:41:14,248 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
699s 2024-03-26 05:41:14,266 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
699s 2024-03-26 05:41:14,266 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
699s 2024-03-26 05:41:14,274 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS
699s jar signed.
699s 
699s Warning: 
699s The signer's certificate is self-signed.
699s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
699s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
699s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
700s 2024-03-26 05:41:14,986 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
700s 2024-03-26 05:41:14,987 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
700s 2024-03-26 05:41:14,991 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
700s 2024-03-26 05:41:15,916 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
701s 
701s Warning:
701s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
701s 2024-03-26 05:41:16,648 DEBUG: Outputting JSON
701s 2024-03-26 05:41:16,649 DEBUG: skip deploying full build logs: not enabled in config
701s 2024-03-26 05:41:16,649 DEBUG: skip deploying full build logs: not enabled in config
701s 2024-03-26 05:41:16,650 DEBUG: skip deploying full build logs: not enabled in config
701s 2024-03-26 05:41:16,650 INFO: Finished
701s + test -e repo/index.xml
701s + test -e repo/index.jar
701s + test -e repo/index-v1.jar
701s + grep -F '<application id=' repo/index.xml
701s + grep -F '<install packageName=' repo/index.xml
701s + grep -F '<uninstall packageName=' repo/index.xml
701s + '[' osx '!=' osx ']'
701s ++ sed -n -e 's,.*timestamp="\([0-9][0-9][0-9][0-9][0-9][0-9][0-9][0-9][0-9][0-9]\)".*,\1,p' repo/index.xml
701s + v0timestamp=1711431672
701s ++ sed -n -e 's,.*"timestamp": \([0-9][0-9][0-9][0-9][0-9][0-9][0-9][0-9][0-9][0-9]\).*,\1,p' repo/index-v1.json
701s + v1timestamp=1711431672
701s + test 1711431672 -eq 1711431672
702s + sed -i.tmp -e 's,timestamp="[0-9]*",timestamp="1676634233",' repo/index.xml
702s + diff -uw /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/index.xml repo/index.xml
702s + sed -i '--expression=s,"timestamp": [0-9]*,"timestamp": 1676634233000,' repo/index-v1.json
702s + diff -uw /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/index-v1.json repo/index-v1.json
702s + echo_header 'test moving lots of APKs to the archive'
702s ++ create_test_dir
702s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
702s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
702s ==============================================================================
702s test moving lots of APKs to the archive
702s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.U0u0
702s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.U0u0
702s + fdroid_init_with_prebuilt_keystore
702s + '[' -z '' ']'
702s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
702s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
702s 2024-03-26 05:41:17,390 WARNING: 
702s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
702s Now set these in config.yml: keystorepass, keypass, keydname
702s 
702s 2024-03-26 05:41:17,390 INFO: 
702s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.U0u0" with this config:
702s 
702s   Android SDK:			/usr/lib/android-sdk
702s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
702s   Alias for key in store:	sova
702s 
702s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.U0u0/repo"
702s then run "fdroid update -c; fdroid update".  You might also want to edit
702s "config.yml" to set the URL, repo name, and more.  You should also set up
702s a signing key (a temporary one might have been automatically generated).
702s 
702s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
702s and https://f-droid.org/docs/Signing_Process
702s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
702s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
702s + sed -i.tmp /allow_disabled_algorithms/d config.yml
702s + test -d metadata
702s + mkdir metadata
702s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/app.with.special.build.params.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/com.politedroid.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/duplicate.permisssions.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/fake.ota.update.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/info.guardianproject.checkey.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/info.guardianproject.urzip.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/info.zwanenburg.caffeinetile.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/no.min.target.sdk.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/obb.main.oldversion.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/obb.main.twoversions.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/obb.mainpatch.current.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/org.adaway.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/org.fdroid.ci.test.app.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/org.fdroid.fdroid.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/org.smssecure.smssecure.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/org.videolan.vlc.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/raw.template.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/souch.smsbypass.yml metadata/
702s + echo 'Summary: good test version of urzip'
702s + echo 'Summary: good MD5 sig, which is disabled algorithm'
702s + sed -i.tmp /ArchivePolicy:/d metadata/app.with.special.build.params.yml metadata/com.politedroid.yml metadata/duplicate.permisssions.yml metadata/fake.ota.update.yml metadata/info.guardianproject.checkey.yml metadata/info.guardianproject.urzip.yml metadata/info.zwanenburg.caffeinetile.yml metadata/no.min.target.sdk.yml metadata/obb.main.oldversion.yml metadata/obb.main.twoversions.yml metadata/obb.mainpatch.current.yml metadata/org.adaway.yml metadata/org.bitbucket.tickytacky.mirrormirror.yml metadata/org.fdroid.ci.test.app.yml metadata/org.fdroid.fdroid.yml metadata/org.smssecure.smssecure.yml metadata/org.videolan.vlc.yml metadata/raw.template.yml metadata/souch.smsbypass.yml
702s + test -d repo
702s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk repo/
702s + printf '\narchive_older: 3\n'
702s + /usr/bin/fdroid update --pretty --nosign
702s 2024-03-26 05:41:17,959 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
703s 2024-03-26 05:41:18,120 INFO: Starting analysis on AndroidManifest.xml
703s 2024-03-26 05:41:18,128 INFO: APK file was successfully validated!
703s 2024-03-26 05:41:18,554 INFO: Starting analysis on AndroidManifest.xml
703s 2024-03-26 05:41:18,554 INFO: APK file was successfully validated!
703s 2024-03-26 05:41:18,870 INFO: Starting analysis on AndroidManifest.xml
703s 2024-03-26 05:41:18,871 INFO: APK file was successfully validated!
704s 2024-03-26 05:41:19,186 INFO: Starting analysis on AndroidManifest.xml
704s 2024-03-26 05:41:19,187 INFO: APK file was successfully validated!
704s 2024-03-26 05:41:19,466 INFO: Starting analysis on AndroidManifest.xml
704s 2024-03-26 05:41:19,468 INFO: APK file was successfully validated!
704s 2024-03-26 05:41:19,766 INFO: Starting analysis on AndroidManifest.xml
704s 2024-03-26 05:41:19,768 INFO: APK file was successfully validated!
705s 2024-03-26 05:41:20,149 INFO: Starting analysis on AndroidManifest.xml
705s 2024-03-26 05:41:20,151 INFO: APK file was successfully validated!
705s 2024-03-26 05:41:20,470 INFO: Starting analysis on AndroidManifest.xml
705s 2024-03-26 05:41:20,470 INFO: APK file was successfully validated!
705s 2024-03-26 05:41:20,718 INFO: Starting analysis on AndroidManifest.xml
705s 2024-03-26 05:41:20,718 INFO: APK file was successfully validated!
706s 2024-03-26 05:41:20,989 INFO: Starting analysis on AndroidManifest.xml
706s 2024-03-26 05:41:20,990 INFO: APK file was successfully validated!
706s 2024-03-26 05:41:21,342 INFO: Starting analysis on AndroidManifest.xml
706s 2024-03-26 05:41:21,343 INFO: APK file was successfully validated!
706s 2024-03-26 05:41:21,599 INFO: Starting analysis on AndroidManifest.xml
706s 2024-03-26 05:41:21,600 INFO: APK file was successfully validated!
706s 2024-03-26 05:41:21,607 WARNING: repo/urzip.apk is set to android:debuggable="true"
707s 2024-03-26 05:41:21,984 INFO: Moving com.politedroid_3.apk from repo to archive
707s 2024-03-26 05:41:21,985 INFO: Moving org.bitbucket.tickytacky.mirrormirror_1.apk from repo to archive
707s 2024-03-26 05:41:22,509 INFO: Creating unsigned index in preparation for signing
707s 2024-03-26 05:41:22,711 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
708s 2024-03-26 05:41:23,740 INFO: Creating unsigned index in preparation for signing
708s 2024-03-26 05:41:23,941 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
709s 2024-03-26 05:41:24,473 INFO: Finished
709s + use_apksigner
709s + python3 -c '
709s import sys
709s sys.path.insert(0, '\''/tmp/autopkgtest.tyZAgp/build.nAO/src'\'')
709s from fdroidserver import common
709s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''}
709s common.find_apksigner(c)
709s exit(c.get('\''apksigner'\'') is None)
709s '
710s ++ grep '<package>' archive/index.xml
710s ++ wc -l
710s + test 2 -eq 2
710s ++ grep '<package>' repo/index.xml
710s ++ wc -l
710s + test 10 -eq 10
710s + use_apksigner
710s + python3 -c '
710s import sys
710s sys.path.insert(0, '\''/tmp/autopkgtest.tyZAgp/build.nAO/src'\'')
710s from fdroidserver import common
710s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''}
710s common.find_apksigner(c)
710s exit(c.get('\''apksigner'\'') is None)
710s '
710s + echo_header 'test moving old APKs to and from the archive'
710s ==============================================================================
710s test moving old APKs to and from the archive
710s ++ create_test_dir
710s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
710s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
710s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.QfSj
710s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.QfSj
710s + fdroid_init_with_prebuilt_keystore
710s + '[' -z '' ']'
710s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
710s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
711s 2024-03-26 05:41:26,221 WARNING: 
711s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
711s Now set these in config.yml: keystorepass, keypass, keydname
711s 
711s 2024-03-26 05:41:26,221 INFO: 
711s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.QfSj" with this config:
711s 
711s   Android SDK:			/usr/lib/android-sdk
711s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
711s   Alias for key in store:	sova
711s 
711s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.QfSj/repo"
711s then run "fdroid update -c; fdroid update".  You might also want to edit
711s "config.yml" to set the URL, repo name, and more.  You should also set up
711s a signing key (a temporary one might have been automatically generated).
711s 
711s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
711s and https://f-droid.org/docs/Signing_Process
711s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
711s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
711s + test -d metadata
711s + mkdir metadata
711s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/com.politedroid.yml metadata/
711s + sed -i.tmp /ArchivePolicy:/d metadata/com.politedroid.yml
711s + test -d repo
711s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk repo/
711s + printf '\narchive_older: 3\n'
711s + /usr/bin/fdroid update --pretty --nosign
711s 2024-03-26 05:41:26,720 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
711s 2024-03-26 05:41:26,815 INFO: Starting analysis on AndroidManifest.xml
711s 2024-03-26 05:41:26,838 INFO: APK file was successfully validated!
712s 2024-03-26 05:41:27,404 INFO: Starting analysis on AndroidManifest.xml
712s 2024-03-26 05:41:27,405 INFO: APK file was successfully validated!
712s 2024-03-26 05:41:27,708 INFO: Starting analysis on AndroidManifest.xml
712s 2024-03-26 05:41:27,709 INFO: APK file was successfully validated!
713s 2024-03-26 05:41:28,034 INFO: Starting analysis on AndroidManifest.xml
713s 2024-03-26 05:41:28,035 INFO: APK file was successfully validated!
713s 2024-03-26 05:41:28,304 INFO: Moving com.politedroid_3.apk from repo to archive
713s 2024-03-26 05:41:28,708 INFO: Creating unsigned index in preparation for signing
714s 2024-03-26 05:41:29,012 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
715s 2024-03-26 05:41:30,253 INFO: Creating unsigned index in preparation for signing
715s 2024-03-26 05:41:30,454 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
716s 2024-03-26 05:41:31,029 INFO: Finished
716s ++ grep '<package>' archive/index.xml
716s ++ wc -l
716s + test 1 -eq 1
716s ++ grep '<package>' repo/index.xml
716s ++ wc -l
716s + test 3 -eq 3
716s + grep -F com.politedroid_3.apk archive/index.xml
716s 			<apkname>com.politedroid_3.apk</apkname>
716s + grep -F com.politedroid_4.apk repo/index.xml
716s 			<apkname>com.politedroid_4.apk</apkname>
716s + grep -F com.politedroid_5.apk repo/index.xml
716s + grep -F com.politedroid_6.apk repo/index.xml
716s + test -e archive/com.politedroid_3.apk
716s + test -e repo/com.politedroid_4.apk
716s + test -e repo/com.politedroid_5.apk
716s + test -e repo/com.politedroid_6.apk
716s + sed -i.tmp 's,archive_older: 3,archive_older: 1,' config.yml
716s + /usr/bin/fdroid update --pretty --nosign
716s 			<apkname>com.politedroid_5.apk</apkname>
716s 			<apkname>com.politedroid_6.apk</apkname>
716s 2024-03-26 05:41:31,803 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
716s 2024-03-26 05:41:31,831 INFO: Moving com.politedroid_5.apk from repo to archive
716s 2024-03-26 05:41:31,831 INFO: Moving com.politedroid_4.apk from repo to archive
717s 2024-03-26 05:41:32,338 INFO: Creating unsigned index in preparation for signing
717s 2024-03-26 05:41:32,539 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
718s 2024-03-26 05:41:33,572 INFO: Creating unsigned index in preparation for signing
718s 2024-03-26 05:41:33,878 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
719s 2024-03-26 05:41:34,401 INFO: Finished
719s ++ grep '<package>' archive/index.xml
719s ++ wc -l
719s + test 3 -eq 3
719s ++ grep '<package>' repo/index.xml
719s ++ wc -l
719s + test 1 -eq 1
719s + grep -F com.politedroid_3.apk archive/index.xml
719s 			<apkname>com.politedroid_3.apk</apkname>
719s + grep -F com.politedroid_4.apk archive/index.xml
719s 			<apkname>com.politedroid_4.apk</apkname>
719s + grep -F com.politedroid_5.apk archive/index.xml
719s + grep -F com.politedroid_6.apk repo/index.xml
719s + test -e archive/com.politedroid_3.apk
719s + test -e archive/com.politedroid_4.apk
719s + test -e archive/com.politedroid_5.apk
719s + test -e repo/com.politedroid_6.apk
719s + sed -i.tmp 's/\(versionCode: 4\)/\1\n    disable: testing deletion/' metadata/com.politedroid.yml
719s + /usr/bin/fdroid update --pretty --nosign
719s 			<apkname>com.politedroid_5.apk</apkname>
719s 			<apkname>com.politedroid_6.apk</apkname>
719s 2024-03-26 05:41:34,891 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
719s 2024-03-26 05:41:34,895 INFO: Deleting disabled build output repo/icons-640/com.politedroid.4.png
719s 2024-03-26 05:41:34,896 INFO: Deleting disabled build output repo/icons-480/com.politedroid.4.png
719s 2024-03-26 05:41:34,896 INFO: Deleting disabled build output archive/com.politedroid_4.apk
719s 2024-03-26 05:41:34,896 INFO: Deleting disabled build output archive/icons/com.politedroid.4.png
719s 2024-03-26 05:41:34,896 INFO: Deleting disabled build output archive/icons-320/com.politedroid.4.png
719s 2024-03-26 05:41:34,896 INFO: Deleting disabled build output archive/icons-240/com.politedroid.4.png
719s 2024-03-26 05:41:34,896 INFO: Deleting disabled build output archive/icons-160/com.politedroid.4.png
719s 2024-03-26 05:41:34,897 INFO: Deleting disabled build output archive/icons-120/com.politedroid.4.png
720s 2024-03-26 05:41:35,400 INFO: Creating unsigned index in preparation for signing
720s 2024-03-26 05:41:35,603 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
721s 2024-03-26 05:41:36,640 INFO: Creating unsigned index in preparation for signing
721s 2024-03-26 05:41:36,842 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
722s 2024-03-26 05:41:37,366 INFO: Finished
722s ++ grep '<package>' archive/index.xml
722s ++ wc -l
722s + test 2 -eq 2
722s ++ grep '<package>' repo/index.xml
722s ++ wc -l
722s + test 1 -eq 1
722s + grep -F com.politedroid_3.apk archive/index.xml
722s 			<apkname>com.politedroid_3.apk</apkname>
722s + grep -F com.politedroid_4.apk archive/index.xml
722s + grep -F com.politedroid_5.apk archive/index.xml
722s 			<apkname>com.politedroid_5.apk</apkname>
722s + grep -F com.politedroid_6.apk repo/index.xml
722s + test -e archive/com.politedroid_3.apk
722s + test -e archive/com.politedroid_4.apk
722s + test -e archive/com.politedroid_5.apk
722s + test -e repo/com.politedroid_6.apk
722s + sed -i.tmp 's/\(versionCode: 6\)/\1\n    disable: testing deletion/' metadata/com.politedroid.yml
722s + /usr/bin/fdroid update --pretty --nosign
722s 			<apkname>com.politedroid_6.apk</apkname>
722s 2024-03-26 05:41:37,860 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
722s 2024-03-26 05:41:37,864 INFO: Deleting disabled build output repo/com.politedroid_6.apk
722s 2024-03-26 05:41:37,864 INFO: Deleting disabled build output repo/icons/com.politedroid.6.png
722s 2024-03-26 05:41:37,864 INFO: Deleting disabled build output repo/icons-640/com.politedroid.6.png
722s 2024-03-26 05:41:37,865 INFO: Deleting disabled build output repo/icons-480/com.politedroid.6.png
722s 2024-03-26 05:41:37,865 INFO: Deleting disabled build output repo/icons-320/com.politedroid.6.png
722s 2024-03-26 05:41:37,865 INFO: Deleting disabled build output repo/icons-240/com.politedroid.6.png
722s 2024-03-26 05:41:37,865 INFO: Deleting disabled build output repo/icons-160/com.politedroid.6.png
722s 2024-03-26 05:41:37,865 INFO: Deleting disabled build output repo/icons-120/com.politedroid.6.png
722s 2024-03-26 05:41:37,866 INFO: Moving com.politedroid_5.apk from archive to repo
723s 2024-03-26 05:41:38,376 INFO: Creating unsigned index in preparation for signing
723s 2024-03-26 05:41:38,577 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
724s 2024-03-26 05:41:39,521 INFO: Creating unsigned index in preparation for signing
724s 2024-03-26 05:41:39,723 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
725s 2024-03-26 05:41:40,360 INFO: Finished
725s ++ grep '<package>' archive/index.xml
725s ++ wc -l
725s + test 1 -eq 1
725s ++ grep '<package>' repo/index.xml
725s ++ wc -l
725s + test 1 -eq 1
725s + grep -F com.politedroid_3.apk archive/index.xml
725s 			<apkname>com.politedroid_3.apk</apkname>
725s + grep -F com.politedroid_5.apk repo/index.xml
725s 			<apkname>com.politedroid_5.apk</apkname>
725s ==============================================================================
725s test that verify can succeed and fail
725s + grep -F com.politedroid_6.apk repo/index.xml
725s + test -e archive/com.politedroid_3.apk
725s + test -e repo/com.politedroid_5.apk
725s + test -e repo/com.politedroid_6.apk
725s + echo_header 'test that verify can succeed and fail'
725s ++ create_test_dir
725s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
725s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
725s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ou44
725s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ou44
725s + test -d tmp
725s + mkdir tmp
725s + test -d unsigned
725s + mkdir unsigned
725s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk tmp/
725s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk unsigned/
725s + /usr/bin/fdroid verify --reuse-remote-apk --verbose com.politedroid
725s 2024-03-26 05:41:40,877 DEBUG: ipfs_cid not found, skipping CIDv1 generation
725s 2024-03-26 05:41:40,878 INFO: Processing com.politedroid_6.apk
726s 2024-03-26 05:41:41,190 DEBUG: tmp/com.politedroid_6.apk: Verifies
726s Verified using v1 scheme (JAR signing): true
726s Verified using v2 scheme (APK Signature Scheme v2): false
726s Verified using v3 scheme (APK Signature Scheme v3): false
726s Verified using v4 scheme (APK Signature Scheme v4): false
726s Verified for SourceStamp: false
726s Number of signers: 1
726s 
726s 2024-03-26 05:41:41,479 DEBUG: tmp/sigcp_com.politedroid_6.apk: Verifies
726s Verified using v1 scheme (JAR signing): true
726s Verified using v2 scheme (APK Signature Scheme v2): false
726s Verified using v3 scheme (APK Signature Scheme v3): false
726s Verified using v4 scheme (APK Signature Scheme v4): false
726s Verified for SourceStamp: false
726s Number of signers: 1
726s 
726s 2024-03-26 05:41:41,479 INFO: ...successfully verified
726s 2024-03-26 05:41:41,479 INFO: ...successfully verified
726s 2024-03-26 05:41:41,479 INFO: 1 successfully verified
726s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk unsigned/com.politedroid_6.apk
726s + /usr/bin/fdroid verify --reuse-remote-apk --verbose com.politedroid
726s 2024-03-26 05:41:41,901 DEBUG: ipfs_cid not found, skipping CIDv1 generation
726s 2024-03-26 05:41:41,901 INFO: Processing com.politedroid_6.apk
727s 2024-03-26 05:41:42,214 DEBUG: tmp/com.politedroid_6.apk: Verifies
727s Verified using v1 scheme (JAR signing): true
727s Verified using v2 scheme (APK Signature Scheme v2): false
727s Verified using v3 scheme (APK Signature Scheme v3): false
727s Verified using v4 scheme (APK Signature Scheme v4): false
727s Verified for SourceStamp: false
727s Number of signers: 1
727s 
727s DOES NOT VERIFY
727s ERROR: res/drawable-ldpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK
727s ERROR: res/drawable-mdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK
727s ERROR: res/drawable-hdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK
727s ERROR: res/drawable-xhdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK
727s 2024-03-26 05:41:42,396 ERROR: 
727s tmp/sigcp_com.politedroid_6.apk: 
727s 2024-03-26 05:41:42,396 INFO: ...NOT verified - tmp/sigcp_com.politedroid_6.apk
727s 2024-03-26 05:41:42,399 DEBUG: > diff -r tmp/tmp_com.politedroid_6 tmp/tmp_sigcp_com.politedroid_6
727s 2024-03-26 05:41:42,600 INFO: ...NOT verified - verification of APK with copied signature failed
727s Comparing reference APK to APK with copied signature...
727s Unexpected diff output:
727s Binary files tmp/tmp_com.politedroid_6/content/AndroidManifest.xml and tmp/tmp_sigcp_com.politedroid_6/content/AndroidManifest.xml differ
727s Binary files tmp/tmp_com.politedroid_6/content/classes.dex and tmp/tmp_sigcp_com.politedroid_6/content/classes.dex differ
727s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-hdpi
727s Only in tmp/tmp_com.politedroid_6/content/res: drawable-hdpi-v4
727s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-ldpi
727s Only in tmp/tmp_com.politedroid_6/content/res: drawable-ldpi-v4
727s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-mdpi
727s Only in tmp/tmp_com.politedroid_6/content/res: drawable-mdpi-v4
727s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-xhdpi
727s Only in tmp/tmp_com.politedroid_6/content/res: drawable-xhdpi-v4
727s Binary files tmp/tmp_com.politedroid_6/content/res/xml/preferences.xml and tmp/tmp_sigcp_com.politedroid_6/content/res/xml/preferences.xml differ
727s Binary files tmp/tmp_com.politedroid_6/content/resources.arsc and tmp/tmp_sigcp_com.politedroid_6/content/resources.arsc differ
727s 
727s 2024-03-26 05:41:42,601 INFO: 1 NOT verified
727s + echo_header 'test allowing disabled signatures in repo and archive'
727s ==============================================================================
727s test allowing disabled signatures in repo and archive
727s ++ create_test_dir
727s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
727s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
727s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qwCb
727s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qwCb
727s + fdroid_init_with_prebuilt_keystore
727s + '[' -z '' ']'
727s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
727s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
728s 2024-03-26 05:41:43,041 WARNING: 
728s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
728s Now set these in config.yml: keystorepass, keypass, keydname
728s 
728s 2024-03-26 05:41:43,041 INFO: 
728s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qwCb" with this config:
728s 
728s   Android SDK:			/usr/lib/android-sdk
728s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
728s   Alias for key in store:	sova
728s 
728s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qwCb/repo"
728s then run "fdroid update -c; fdroid update".  You might also want to edit
728s "config.yml" to set the URL, repo name, and more.  You should also set up
728s a signing key (a temporary one might have been automatically generated).
728s 
728s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
728s and https://f-droid.org/docs/Signing_Process
728s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
728s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
728s + echo 'allow_disabled_algorithms: true'
728s + printf '\narchive_older: 3\n'
728s + test -d metadata
728s + mkdir metadata
728s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/com.politedroid.yml metadata/
728s + echo 'Summary: good test version of urzip'
728s + echo 'Summary: good MD5 sig, disabled algorithm'
728s + sed -i.tmp /ArchivePolicy:/d metadata/com.politedroid.yml metadata/info.guardianproject.urzip.yml metadata/org.bitbucket.tickytacky.mirrormirror.yml
728s + test -d repo
728s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-badsig.apk repo/
728s + /usr/bin/fdroid update --pretty --nosign
728s 2024-03-26 05:41:43,560 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
728s 2024-03-26 05:41:43,707 INFO: Starting analysis on AndroidManifest.xml
728s 2024-03-26 05:41:43,734 INFO: APK file was successfully validated!
729s 2024-03-26 05:41:44,263 INFO: Starting analysis on AndroidManifest.xml
729s 2024-03-26 05:41:44,264 INFO: APK file was successfully validated!
729s 2024-03-26 05:41:44,593 INFO: Starting analysis on AndroidManifest.xml
729s 2024-03-26 05:41:44,594 INFO: APK file was successfully validated!
730s 2024-03-26 05:41:45,014 INFO: Starting analysis on AndroidManifest.xml
730s 2024-03-26 05:41:45,015 INFO: APK file was successfully validated!
730s 2024-03-26 05:41:45,330 INFO: Starting analysis on AndroidManifest.xml
730s 2024-03-26 05:41:45,331 INFO: APK file was successfully validated!
730s 2024-03-26 05:41:45,592 INFO: Starting analysis on AndroidManifest.xml
730s 2024-03-26 05:41:45,593 INFO: APK file was successfully validated!
730s 2024-03-26 05:41:45,885 INFO: Starting analysis on AndroidManifest.xml
730s 2024-03-26 05:41:45,886 INFO: APK file was successfully validated!
731s 2024-03-26 05:41:46,137 INFO: Starting analysis on AndroidManifest.xml
731s 2024-03-26 05:41:46,138 INFO: APK file was successfully validated!
731s 2024-03-26 05:41:46,569 INFO: Starting analysis on AndroidManifest.xml
731s 2024-03-26 05:41:46,571 INFO: APK file was successfully validated!
731s 2024-03-26 05:41:46,578 WARNING: repo/urzip-badsig.apk is set to android:debuggable="true"
731s DOES NOT VERIFY
731s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: <JYBUMhOCUqbNupF0uRUilMG8psI=>, actual: <osOjbkldSAk+vTAdsdLeXI6f58c=>
731s 2024-03-26 05:41:46,951 ERROR: 
731s repo/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: <xnVQzXMpgNgZtvjZJC+y28A9cjo=>, actual: <5+8iqbzUfegBixjQUeg1++LwFe4=>
731s 
732s 2024-03-26 05:41:47,648 WARNING: Archiving urzip-badsig.apk with invalid signature!
732s 2024-03-26 05:41:47,649 INFO: Moving urzip-badsig.apk from repo to archive
732s 2024-03-26 05:41:47,649 INFO: Starting analysis on AndroidManifest.xml
732s 2024-03-26 05:41:47,651 INFO: APK file was successfully validated!
732s 2024-03-26 05:41:47,658 WARNING: archive/urzip-badsig.apk is set to android:debuggable="true"
733s DOES NOT VERIFY
733s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: <JYBUMhOCUqbNupF0uRUilMG8psI=>, actual: <osOjbkldSAk+vTAdsdLeXI6f58c=>
733s 2024-03-26 05:41:48,061 ERROR: 
733s archive/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: <xnVQzXMpgNgZtvjZJC+y28A9cjo=>, actual: <5+8iqbzUfegBixjQUeg1++LwFe4=>
733s 
733s 2024-03-26 05:41:48,428 WARNING: Archiving urzip-badsig.apk with invalid signature!
733s 2024-03-26 05:41:48,430 INFO: Moving com.politedroid_3.apk from repo to archive
733s 2024-03-26 05:41:48,430 INFO: Moving org.bitbucket.tickytacky.mirrormirror_1.apk from repo to archive
733s 2024-03-26 05:41:48,938 INFO: Creating unsigned index in preparation for signing
734s 2024-03-26 05:41:49,140 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
735s 2024-03-26 05:41:50,170 INFO: Creating unsigned index in preparation for signing
735s 2024-03-26 05:41:50,517 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
736s 2024-03-26 05:41:51,291 INFO: Finished
736s ++ grep '<package>' archive/index.xml
736s ++ wc -l
736s + test 2 -eq 2
736s ++ grep '<package>' repo/index.xml
736s ++ wc -l
736s + test 6 -eq 6
736s + grep -F com.politedroid_3.apk archive/index.xml
736s + grep -F com.politedroid_4.apk repo/index.xml
736s 			<apkname>com.politedroid_3.apk</apkname>
736s 			<apkname>com.politedroid_4.apk</apkname>
736s + grep -F com.politedroid_5.apk repo/index.xml
736s 			<apkname>com.politedroid_5.apk</apkname>
736s + grep -F com.politedroid_6.apk repo/index.xml
736s + grep -F org.bitbucket.tickytacky.mirrormirror_1.apk archive/index.xml
736s + grep -F org.bitbucket.tickytacky.mirrormirror_2.apk repo/index.xml
736s + grep -F org.bitbucket.tickytacky.mirrormirror_3.apk repo/index.xml
736s + grep -F org.bitbucket.tickytacky.mirrormirror_4.apk repo/index.xml
736s + grep -F urzip-badsig.apk repo/index.xml
736s + grep -F urzip-badsig.apk archive/index.xml
736s + test -e archive/com.politedroid_3.apk
736s + test -e repo/com.politedroid_4.apk
736s + test -e repo/com.politedroid_5.apk
736s + test -e repo/com.politedroid_6.apk
736s + test -e archive/org.bitbucket.tickytacky.mirrormirror_1.apk
736s + test -e repo/org.bitbucket.tickytacky.mirrormirror_2.apk
736s + test -e repo/org.bitbucket.tickytacky.mirrormirror_3.apk
736s + test -e repo/org.bitbucket.tickytacky.mirrormirror_4.apk
736s + test -e archive/urzip-badsig.apk
736s + sed -i.tmp /apksigner:/d config.yml
736s + use_apksigner
736s + python3 -c '
736s import sys
736s sys.path.insert(0, '\''/tmp/autopkgtest.tyZAgp/build.nAO/src'\'')
736s from fdroidserver import common
736s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''}
736s common.find_apksigner(c)
736s exit(c.get('\''apksigner'\'') is None)
736s '
736s 			<apkname>com.politedroid_6.apk</apkname>
736s 			<apkname>org.bitbucket.tickytacky.mirrormirror_1.apk</apkname>
736s 			<apkname>org.bitbucket.tickytacky.mirrormirror_2.apk</apkname>
736s 			<apkname>org.bitbucket.tickytacky.mirrormirror_3.apk</apkname>
736s 			<apkname>org.bitbucket.tickytacky.mirrormirror_4.apk</apkname>
737s + echo 'allow_disabled_algorithms: true'
737s + /usr/bin/fdroid update --pretty --nosign
737s 2024-03-26 05:41:52,444 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
737s 2024-03-26 05:41:52,552 INFO: Starting analysis on AndroidManifest.xml
737s 2024-03-26 05:41:52,562 INFO: APK file was successfully validated!
737s 2024-03-26 05:41:52,570 WARNING: archive/urzip-badsig.apk is set to android:debuggable="true"
737s DOES NOT VERIFY
737s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: <JYBUMhOCUqbNupF0uRUilMG8psI=>, actual: <osOjbkldSAk+vTAdsdLeXI6f58c=>
737s 2024-03-26 05:41:52,866 ERROR: 
737s archive/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: <xnVQzXMpgNgZtvjZJC+y28A9cjo=>, actual: <5+8iqbzUfegBixjQUeg1++LwFe4=>
737s 
738s 2024-03-26 05:41:53,239 WARNING: Archiving urzip-badsig.apk with invalid signature!
738s 2024-03-26 05:41:53,745 INFO: Creating unsigned index in preparation for signing
738s 2024-03-26 05:41:53,946 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
740s 2024-03-26 05:41:54,979 INFO: Creating unsigned index in preparation for signing
740s 2024-03-26 05:41:55,283 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
740s 2024-03-26 05:41:55,809 INFO: Finished
740s ++ grep '<package>' archive/index.xml
740s ++ wc -l
740s + test 2 -eq 2
740s ++ grep '<package>' repo/index.xml
740s ++ wc -l
740s + test 6 -eq 6
740s + grep -F com.politedroid_3.apk archive/index.xml
740s 			<apkname>com.politedroid_3.apk</apkname>
740s + grep -F com.politedroid_4.apk repo/index.xml
740s 			<apkname>com.politedroid_4.apk</apkname>
740s + grep -F com.politedroid_5.apk repo/index.xml
741s + grep -F com.politedroid_6.apk repo/index.xml
741s + grep -F org.bitbucket.tickytacky.mirrormirror_1.apk archive/index.xml
741s + grep -F org.bitbucket.tickytacky.mirrormirror_2.apk repo/index.xml
741s + grep -F org.bitbucket.tickytacky.mirrormirror_3.apk repo/index.xml
741s + grep -F org.bitbucket.tickytacky.mirrormirror_4.apk repo/index.xml
741s + grep -F urzip-badsig.apk repo/index.xml
741s + grep -F urzip-badsig.apk archive/index.xml
741s + test -e archive/com.politedroid_3.apk
741s + test -e repo/com.politedroid_4.apk
741s + test -e repo/com.politedroid_5.apk
741s + test -e repo/com.politedroid_6.apk
741s + test -e archive/org.bitbucket.tickytacky.mirrormirror_1.apk
741s + test -e repo/org.bitbucket.tickytacky.mirrormirror_2.apk
741s + test -e repo/org.bitbucket.tickytacky.mirrormirror_3.apk
741s + test -e repo/org.bitbucket.tickytacky.mirrormirror_4.apk
741s + test -e archive/urzip-badsig.apk
741s + echo_header 'rename apks with `fdroid update --rename-apks`, --nosign for speed'
741s ++ create_test_dir
741s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
741s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
741s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.VRt7
741s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.VRt7
741s + fdroid_init_with_prebuilt_keystore
741s + '[' -z '' ']'
741s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
741s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
741s 			<apkname>com.politedroid_5.apk</apkname>
741s 			<apkname>com.politedroid_6.apk</apkname>
741s 			<apkname>org.bitbucket.tickytacky.mirrormirror_1.apk</apkname>
741s 			<apkname>org.bitbucket.tickytacky.mirrormirror_2.apk</apkname>
741s 			<apkname>org.bitbucket.tickytacky.mirrormirror_3.apk</apkname>
741s 			<apkname>org.bitbucket.tickytacky.mirrormirror_4.apk</apkname>
741s ==============================================================================
741s rename apks with `fdroid update --rename-apks`, --nosign for speed
741s 2024-03-26 05:41:56,340 WARNING: 
741s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
741s Now set these in config.yml: keystorepass, keypass, keydname
741s 
741s 2024-03-26 05:41:56,341 INFO: 
741s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.VRt7" with this config:
741s 
741s   Android SDK:			/usr/lib/android-sdk
741s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
741s   Alias for key in store:	sova
741s 
741s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.VRt7/repo"
741s then run "fdroid update -c; fdroid update".  You might also want to edit
741s "config.yml" to set the URL, repo name, and more.  You should also set up
741s a signing key (a temporary one might have been automatically generated).
741s 
741s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
741s and https://f-droid.org/docs/Signing_Process
741s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
741s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
741s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"'
741s + test -d metadata
741s + mkdir metadata
741s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/info.guardianproject.urzip.yml metadata/
741s + test -d repo
741s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk 'repo/asdfiuhk urzip-πÇÇπÇÇ现代汉语通用字-български-عربي1234 ö.apk'
741s + /usr/bin/fdroid update --rename-apks --pretty --nosign
741s 2024-03-26 05:41:56,903 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
742s 2024-03-26 05:41:56,992 INFO: Starting analysis on AndroidManifest.xml
742s 2024-03-26 05:41:57,002 INFO: APK file was successfully validated!
742s 2024-03-26 05:41:57,010 WARNING: repo/asdfiuhk urzip-πÇÇπÇÇ现代汉语通用字-български-عربي1234 ö.apk is set to android:debuggable="true"
742s 2024-03-26 05:41:57,771 INFO: Creating unsigned index in preparation for signing
743s 2024-03-26 05:41:58,074 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
743s 2024-03-26 05:41:58,500 INFO: Finished
743s + test -e repo/info.guardianproject.urzip_100.apk
743s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml
743s repo/index-v1.json:        "apkName": "info.guardianproject.urzip_100.apk",
743s repo/index.xml:			<apkname>info.guardianproject.urzip_100.apk</apkname>
743s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk repo/
743s + /usr/bin/fdroid update --rename-apks --pretty --nosign
744s 2024-03-26 05:41:59,162 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
744s 2024-03-26 05:41:59,312 INFO: Starting analysis on AndroidManifest.xml
744s 2024-03-26 05:41:59,335 INFO: APK file was successfully validated!
744s 2024-03-26 05:41:59,344 WARNING: repo/info.guardianproject.urzip_100.apk is set to android:debuggable="true"
744s 2024-03-26 05:41:59,933 INFO: Starting analysis on AndroidManifest.xml
744s 2024-03-26 05:41:59,934 INFO: APK file was successfully validated!
745s 2024-03-26 05:42:00,971 INFO: Creating unsigned index in preparation for signing
746s 2024-03-26 05:42:01,173 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
746s 2024-03-26 05:42:01,709 INFO: Finished
746s repo/index-v1.json:        "apkName": "info.guardianproject.urzip_100.apk",
746s repo/index.xml:			<apkname>info.guardianproject.urzip_100.apk</apkname>
746s         "apkName": "info.guardianproject.urzip_100_b4964fd.apk",
746s + test -e repo/info.guardianproject.urzip_100.apk
746s + test -e repo/info.guardianproject.urzip_100_b4964fd.apk
746s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml
746s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index-v1.json
746s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index.xml
746s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk repo/
746s + /usr/bin/fdroid update --rename-apks --pretty --nosign
747s 2024-03-26 05:42:02,243 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
747s 2024-03-26 05:42:02,339 INFO: Starting analysis on AndroidManifest.xml
747s 2024-03-26 05:42:02,348 INFO: APK file was successfully validated!
747s 2024-03-26 05:42:02,357 WARNING: repo/info.guardianproject.urzip_100.apk is set to android:debuggable="true"
747s 2024-03-26 05:42:02,615 INFO: Starting analysis on AndroidManifest.xml
747s 2024-03-26 05:42:02,616 INFO: APK file was successfully validated!
747s 2024-03-26 05:42:02,925 INFO: Starting analysis on AndroidManifest.xml
747s 2024-03-26 05:42:02,927 INFO: APK file was successfully validated!
747s 2024-03-26 05:42:02,937 WARNING: Moving duplicate repo/info.guardianproject.urzip_100_b4964fd.apk to duplicates/repo/info.guardianproject.urzip_100_b4964fd.apk
748s 2024-03-26 05:42:03,444 INFO: Creating unsigned index in preparation for signing
748s 2024-03-26 05:42:03,645 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
749s 2024-03-26 05:42:04,173 INFO: Finished
749s + test -e repo/info.guardianproject.urzip_100.apk
749s + test -e repo/info.guardianproject.urzip_100_b4964fd.apk
749s + test -e duplicates/repo/info.guardianproject.urzip_100_b4964fd.apk
749s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml
749s repo/index-v1.json:        "apkName": "info.guardianproject.urzip_100.apk",
749s repo/index.xml:			<apkname>info.guardianproject.urzip_100.apk</apkname>
749s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index-v1.json
749s         "apkName": "info.guardianproject.urzip_100_b4964fd.apk",
749s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index.xml
749s ==============================================================================
749s test for added date being set correctly for repo and archive
749s + echo_header 'test for added date being set correctly for repo and archive'
749s ++ create_test_dir
749s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
749s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
749s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.o5z7
749s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.o5z7
749s + fdroid_init_with_prebuilt_keystore
749s + '[' -z '' ']'
749s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
749s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
749s 2024-03-26 05:42:04,672 WARNING: 
749s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
749s Now set these in config.yml: keystorepass, keypass, keydname
749s 
749s 2024-03-26 05:42:04,672 INFO: 
749s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.o5z7" with this config:
749s 
749s   Android SDK:			/usr/lib/android-sdk
749s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
749s   Alias for key in store:	sova
749s 
749s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.o5z7/repo"
749s then run "fdroid update -c; fdroid update".  You might also want to edit
749s "config.yml" to set the URL, repo name, and more.  You should also set up
749s a signing key (a temporary one might have been automatically generated).
749s 
749s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
749s and https://f-droid.org/docs/Signing_Process
749s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
749s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
749s + printf '\narchive_older: 3\n'
749s + mkdir -p repo archive metadata stats
749s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk archive
749s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk repo
749s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/com.politedroid.yml metadata
749s + echo 'com.politedroid_4.apk com.politedroid 2016-01-01'
749s + echo 'com.politedroid_5.apk com.politedroid 2017-01-01'
749s + echo 'com.politedroid_6.apk com.politedroid 2018-01-01'
749s + sed -i -e 's/ArchivePolicy:.*/ArchivePolicy: 1 versions/' metadata/com.politedroid.yml
749s + timestamp=1483228800
749s + /usr/bin/fdroid update --pretty --nosign
750s 2024-03-26 05:42:05,133 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
750s 2024-03-26 05:42:05,242 INFO: Starting analysis on AndroidManifest.xml
750s 2024-03-26 05:42:05,251 INFO: APK file was successfully validated!
750s 2024-03-26 05:42:05,547 INFO: Starting analysis on AndroidManifest.xml
750s 2024-03-26 05:42:05,548 INFO: APK file was successfully validated!
751s 2024-03-26 05:42:06,328 INFO: Creating unsigned index in preparation for signing
751s 2024-03-26 05:42:06,530 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
752s 2024-03-26 05:42:07,456 INFO: Creating unsigned index in preparation for signing
752s 2024-03-26 05:42:07,658 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
753s 2024-03-26 05:42:08,081 INFO: Finished
753s + grep -F '"added": 1483228800' repo/index-v1.json
753s       "added": 1483228800000,
753s ++ grep -F '"added": 1483228800' archive/index-v1.json
753s ++ wc -l
753s + '[' 2 == 2 ']'
753s + true
753s + echo_header 'test whatsnew from fastlane without CVC set'
753s ==============================================================================
753s test whatsnew from fastlane without CVC set
753s ++ create_test_dir
753s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
753s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
753s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.OyvZ
753s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.OyvZ
753s + fdroid_init_with_prebuilt_keystore
753s + '[' -z '' ']'
753s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
753s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
753s 2024-03-26 05:42:08,594 WARNING: 
753s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
753s Now set these in config.yml: keystorepass, keypass, keydname
753s 
753s 2024-03-26 05:42:08,595 INFO: 
753s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.OyvZ" with this config:
753s 
753s   Android SDK:			/usr/lib/android-sdk
753s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
753s   Alias for key in store:	sova
753s 
753s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.OyvZ/repo"
753s then run "fdroid update -c; fdroid update".  You might also want to edit
753s "config.yml" to set the URL, repo name, and more.  You should also set up
753s a signing key (a temporary one might have been automatically generated).
753s 
753s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
753s and https://f-droid.org/docs/Signing_Process
753s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
753s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
753s + mkdir -p metadata/com.politedroid/en-US/changelogs/
753s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk repo
753s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/com.politedroid.yml metadata
753s + echo 'whatsnew test'
753s + sed -i -e /CurrentVersion/d metadata/com.politedroid.yml
753s + /usr/bin/fdroid update --pretty --nosign
754s 2024-03-26 05:42:09,105 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
754s 2024-03-26 05:42:09,197 INFO: Starting analysis on AndroidManifest.xml
754s 2024-03-26 05:42:09,206 INFO: APK file was successfully validated!
755s 2024-03-26 05:42:10,189 INFO: Creating unsigned index in preparation for signing
755s 2024-03-26 05:42:10,396 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
755s 2024-03-26 05:42:10,920 INFO: Finished
756s + grep -F whatsnew repo/index-v1.json
756s + echo_header 'test metadata checks'
756s           "whatsNew": "whatsnew test\n"
756s ==============================================================================
756s test metadata checks
756s ++ create_test_dir
756s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
756s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
756s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tZwJ
756s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tZwJ
756s + mkdir repo
756s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tZwJ/repo/
756s + set +e
756s + /usr/bin/fdroid build
756s 2024-03-26 05:42:11,583 CRITICAL: No app metadata found, nothing to process!
756s testing metadata checks passed
756s + '[' 1 -eq 0 ']'
756s + echo 'testing metadata checks passed'
756s + set -e
756s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tZwJ/metadata/
756s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/org.smssecure.smssecure.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tZwJ/metadata/
756s + /usr/bin/fdroid readmeta
757s ==============================================================================
757s ensure commands that don't need the JDK work without a JDK configed
757s + echo_header 'ensure commands that don'\''t need the JDK work without a JDK configed'
757s ++ create_test_dir
757s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
757s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
757s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ow9g
757s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ow9g
757s + mkdir repo
757s + mkdir metadata
757s + echo 'License: GPL-2.0-only'
757s + echo 'Summary: Yup still fake'
757s + echo 'Categories: [Internet]'
757s + echo 'Description: |'
757s + echo ' this is fake'
757s + echo 'java_paths: {}'
757s ++ create_test_dir
757s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
757s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
757s + LOCAL_COPY_DIR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.4u6d/fdroid
757s + mkdir -p /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.4u6d/fdroid/repo
757s + echo 'local_copy_dir: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.4u6d/fdroid'
757s + /usr/bin/fdroid checkupdates --allow-dirty
757s 2024-03-26 05:42:12,529 INFO: Processing fake
757s + which gpg
757s + /usr/bin/fdroid gpgsign
757s /usr/bin/gpg
758s + /usr/bin/fdroid lint
758s + /usr/bin/fdroid readmeta
759s + /usr/bin/fdroid rewritemeta fake
759s 2024-03-26 05:42:14,581 INFO: Rewriting 'fake'
759s + /usr/bin/fdroid deploy
760s + /usr/bin/fdroid deploy
760s + /usr/bin/fdroid scanner
761s + /usr/bin/fdroid build
761s usage: fdroid build [options] [APPID[:VERCODE] [APPID[:VERCODE] ...]]
761s fdroid build: error: option all: If you really want to build all the apps, use --all
761s + true
761s + /usr/bin/fdroid import
762s 2024-03-26 05:42:17,026 CRITICAL: Specify project url.
762s + true
762s + /usr/bin/fdroid install
762s usage: fdroid install [options] [APPID[:VERCODE] [APPID[:VERCODE] ...]]
762s fdroid install: error: option all: If you really want to install all the signed apps, use --all
762s ==============================================================================
762s test config checks of local_copy_dir
762s + true
762s + '[' -e .git/config ']'
762s + echo_header 'test config checks of local_copy_dir'
762s ++ create_test_dir
762s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
762s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
762s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.5vna
762s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.5vna
762s + /usr/bin/fdroid init
762s 2024-03-26 05:42:17,934 INFO: Generating a new key in "keystore.p12"...
766s 2024-03-26 05:42:21,256 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
766s Creation date: Mar 26, 2024
766s Entry type: PrivateKeyEntry
766s Certificate chain length: 1
766s Certificate[1]:
766s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
766s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
766s Serial number: 5b5c6669f0e839b8
766s Valid from: Tue Mar 26 05:42:20 UTC 2024 until: Sat Aug 12 05:42:20 UTC 2051
766s Certificate fingerprints:
766s 	 SHA1: B0:80:6A:34:80:4D:28:85:BD:A4:8F:5D:75:BE:C5:4C:D9:7E:57:5F
766s 	 SHA256: 64:3A:79:60:9B:42:29:52:52:ED:C6:D5:26:5B:FC:4A:0A:FF:FB:19:04:35:9F:9B:68:8D:E6:23:61:D0:C2:19
766s Signature algorithm name: SHA256withRSA
766s Subject Public Key Algorithm: 4096-bit RSA key
766s Version: 3
766s 
766s Extensions: 
766s 
766s #1: ObjectId: 2.5.29.14 Criticality=false
766s SubjectKeyIdentifier [
766s KeyIdentifier [
766s 0000: 2F 67 AF 8F 8F AC C6 CC   AF 64 A5 E5 9A C8 0F 99  /g.......d......
766s 0010: 92 96 0A DF                                        ....
766s ]
766s ]
766s 
766s 
766s 2024-03-26 05:42:21,864 INFO: 
766s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.5vna" with this config:
766s 
766s   Android SDK:			/usr/lib/android-sdk
766s   Keystore for signing key:	keystore.p12
766s 
766s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.5vna/repo"
766s then run "fdroid update -c; fdroid update".  You might also want to edit
766s "config.yml" to set the URL, repo name, and more.  You should also set up
766s a signing key (a temporary one might have been automatically generated).
766s 
766s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
766s and https://f-droid.org/docs/Signing_Process
766s + /usr/bin/fdroid update --create-metadata --verbose
767s 2024-03-26 05:42:22,293 DEBUG: Reading 'config.yml'
767s 2024-03-26 05:42:22,304 DEBUG: ipfs_cid not found, skipping CIDv1 generation
767s 2024-03-26 05:42:22,304 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
767s 2024-03-26 05:42:22,304 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
767s 2024-03-26 05:42:22,306 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
768s 2024-03-26 05:42:23,011 INFO: Creating signed index with this key (SHA256):
768s 2024-03-26 05:42:23,011 INFO: 64 3A 79 60 9B 42 29 52 52 ED C6 D5 26 5B FC 4A 0A FF FB 19 04 35 9F 9B 68 8D E6 23 61 D0 C2 19
768s 2024-03-26 05:42:23,012 DEBUG: Directory: repo
768s 2024-03-26 05:42:23,012 DEBUG: > jar cf index.jar index.xml
768s 2024-03-26 05:42:23,213 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
769s jar signed.
769s 
769s Warning: 
769s The signer's certificate is self-signed.
769s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
769s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
769s 2024-03-26 05:42:24,220 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
769s 2024-03-26 05:42:24,232 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
770s jar signed.
770s 
770s Warning: 
770s The signer's certificate is self-signed.
770s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
770s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
770s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
770s 2024-03-26 05:42:25,251 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar
771s 2024-03-26 05:42:26,170 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
772s 2024-03-26 05:42:26,998 DEBUG: Outputting JSON
772s 2024-03-26 05:42:26,998 DEBUG: skip deploying full build logs: not enabled in config
772s 2024-03-26 05:42:27,004 DEBUG: skip deploying full build logs: not enabled in config
772s 2024-03-26 05:42:27,004 DEBUG: skip deploying full build logs: not enabled in config
772s 2024-03-26 05:42:27,005 INFO: Finished
772s + /usr/bin/fdroid readmeta
772s ++ create_test_dir
772s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
772s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
772s + LOCAL_COPY_DIR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ADIW/fdroid
772s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ADIW/fdroid
773s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ADIW/fdroid --verbose
773s 2024-03-26 05:42:28,450 DEBUG: Reading 'config.yml'
773s 2024-03-26 05:42:28,460 DEBUG: ipfs_cid not found, skipping CIDv1 generation
773s 2024-03-26 05:42:28,460 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.ADIW/fdroid/
773s sending incremental file list
773s repo/status/
773s repo/status/deploy.json
773s repo/status/running.json
773s 
773s sent 1,602 bytes  received 70 bytes  3,344.00 bytes/sec
773s total size is 26,174  speedup is 15.65
773s 2024-03-26 05:42:28,508 DEBUG: skip deploying full build logs: not enabled in config
773s 2024-03-26 05:42:28,508 DEBUG: skip deploying full build logs: not enabled in config
773s 2024-03-26 05:42:28,508 DEBUG: skip deploying full build logs: not enabled in config
773s + set +e
773s + /usr/bin/fdroid deploy --local-copy-dir=thisisnotanabsolutepath
773s 2024-03-26 05:42:28,947 ERROR: The root dir for local_copy_dir "" does not exist!
774s testing absolute path checker passed
774s + '[' 1 -eq 0 ']'
774s + echo 'testing absolute path checker passed'
774s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/IReallyDoubtThisPathExistsasdfasdf
774s 2024-03-26 05:42:29,387 ERROR: local_copy_dir does not end with "fdroid", perhaps you meant: "/tmp/IReallyDoubtThisPathExistsasdfasdf/fdroid"
774s testing dirname exists checker passed
774s + '[' 1 -eq 0 ']'
774s + echo 'testing dirname exists checker passed'
774s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/IReallyDoubtThisPathExistsasdfasdf/fdroid
774s 2024-03-26 05:42:29,829 ERROR: The root dir for local_copy_dir "/tmp/IReallyDoubtThisPathExistsasdfasdf" does not exist!
774s testing dirname exists checker passed
774s ==============================================================================
774s setup a new repo from scratch using ANDROID_HOME and do a local sync
774s + '[' 1 -eq 0 ']'
774s + echo 'testing dirname exists checker passed'
774s + set -e
774s + echo_header 'setup a new repo from scratch using ANDROID_HOME and do a local sync'
774s ++ create_test_dir
774s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
774s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
775s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.BomF
775s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.BomF
775s + fdroid_init_with_prebuilt_keystore
775s + '[' -z '' ']'
775s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
775s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
775s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk
775s 2024-03-26 05:42:30,279 WARNING: 
775s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
775s Now set these in config.yml: keystorepass, keypass, keydname
775s 
775s 2024-03-26 05:42:30,279 INFO: 
775s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.BomF" with this config:
775s 
775s   Android SDK:			/usr/lib/android-sdk
775s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
775s   Alias for key in store:	sova
775s 
775s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.BomF/repo"
775s then run "fdroid update -c; fdroid update".  You might also want to edit
775s "config.yml" to set the URL, repo name, and more.  You should also set up
775s a signing key (a temporary one might have been automatically generated).
775s 
775s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
775s and https://f-droid.org/docs/Signing_Process
775s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
775s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
775s + copy_apks_into_repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.BomF
775s + set +x
775s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk
775s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk
775s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk
775s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
776s Requested API level 30 is larger than maximum we have, returning API level 28 instead.
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk
776s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk --> repo/obb.mainpatch.current_1619.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk
777s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk
778s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk
778s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk
778s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk
778s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk
778s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk
778s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk
779s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk
780s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk
780s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk
780s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk
780s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk
780s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk
780s + /usr/bin/fdroid update --create-metadata --verbose
781s 2024-03-26 05:42:36,112 DEBUG: Reading 'config.yml'
781s 2024-03-26 05:42:36,122 DEBUG: ipfs_cid not found, skipping CIDv1 generation
781s 2024-03-26 05:42:36,123 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
781s 2024-03-26 05:42:36,123 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
781s 2024-03-26 05:42:36,124 DEBUG: Processing SpeedoMeterApp.main_1.apk
781s 2024-03-26 05:42:36,215 INFO: Starting analysis on AndroidManifest.xml
781s 2024-03-26 05:42:36,224 INFO: APK file was successfully validated!
781s 2024-03-26 05:42:36,225 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk
781s 2024-03-26 05:42:36,231 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3).
781s 2024-03-26 05:42:36,689 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies
781s Verified using v1 scheme (JAR signing): true
781s Verified using v2 scheme (APK Signature Scheme v2): false
781s Verified using v3 scheme (APK Signature Scheme v3): false
781s Verified using v4 scheme (APK Signature Scheme v4): false
781s Verified for SourceStamp: false
781s Number of signers: 1
781s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
781s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
781s 
781s 2024-03-26 05:42:36,690 DEBUG: Processing apk.embedded_1.apk
781s 2024-03-26 05:42:36,690 INFO: Starting analysis on AndroidManifest.xml
781s 2024-03-26 05:42:36,691 INFO: APK file was successfully validated!
781s 2024-03-26 05:42:36,693 DEBUG: Getting signature of apk.embedded_1.apk
782s 2024-03-26 05:42:37,099 DEBUG: repo/apk.embedded_1.apk: Verifies
782s Verified using v1 scheme (JAR signing): true
782s Verified using v2 scheme (APK Signature Scheme v2): true
782s Verified using v3 scheme (APK Signature Scheme v3): true
782s Verified using v4 scheme (APK Signature Scheme v4): false
782s Verified for SourceStamp: false
782s Number of signers: 1
782s 
782s 2024-03-26 05:42:37,099 DEBUG: Processing com.example.test.helloworld_1.apk
782s 2024-03-26 05:42:37,100 INFO: Starting analysis on AndroidManifest.xml
782s 2024-03-26 05:42:37,100 INFO: APK file was successfully validated!
782s 2024-03-26 05:42:37,102 DEBUG: Getting signature of com.example.test.helloworld_1.apk
782s 2024-03-26 05:42:37,374 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
782s Verified using v1 scheme (JAR signing): true
782s Verified using v2 scheme (APK Signature Scheme v2): false
782s Verified using v3 scheme (APK Signature Scheme v3): false
782s Verified using v4 scheme (APK Signature Scheme v4): false
782s Verified for SourceStamp: false
782s Number of signers: 1
782s 
782s 2024-03-26 05:42:37,375 DEBUG: Processing com.politedroid_3.apk
782s 2024-03-26 05:42:37,375 INFO: Starting analysis on AndroidManifest.xml
782s 2024-03-26 05:42:37,376 INFO: APK file was successfully validated!
782s 2024-03-26 05:42:37,378 DEBUG: Getting signature of com.politedroid_3.apk
782s 2024-03-26 05:42:37,707 DEBUG: repo/com.politedroid_3.apk: Verifies
782s Verified using v1 scheme (JAR signing): true
782s Verified using v2 scheme (APK Signature Scheme v2): false
782s Verified using v3 scheme (APK Signature Scheme v3): false
782s Verified using v4 scheme (APK Signature Scheme v4): false
782s Verified for SourceStamp: false
782s Number of signers: 1
782s 
782s 2024-03-26 05:42:37,712 DEBUG: Processing com.politedroid_4.apk
782s 2024-03-26 05:42:37,712 INFO: Starting analysis on AndroidManifest.xml
782s 2024-03-26 05:42:37,713 INFO: APK file was successfully validated!
782s 2024-03-26 05:42:37,715 DEBUG: Getting signature of com.politedroid_4.apk
783s 2024-03-26 05:42:37,996 DEBUG: repo/com.politedroid_4.apk: Verifies
783s Verified using v1 scheme (JAR signing): true
783s Verified using v2 scheme (APK Signature Scheme v2): false
783s Verified using v3 scheme (APK Signature Scheme v3): false
783s Verified using v4 scheme (APK Signature Scheme v4): false
783s Verified for SourceStamp: false
783s Number of signers: 1
783s 
783s 2024-03-26 05:42:37,998 DEBUG: Processing com.politedroid_5.apk
783s 2024-03-26 05:42:37,998 INFO: Starting analysis on AndroidManifest.xml
783s 2024-03-26 05:42:37,999 INFO: APK file was successfully validated!
783s 2024-03-26 05:42:38,001 DEBUG: Getting signature of com.politedroid_5.apk
783s 2024-03-26 05:42:38,255 DEBUG: repo/com.politedroid_5.apk: Verifies
783s Verified using v1 scheme (JAR signing): true
783s Verified using v2 scheme (APK Signature Scheme v2): false
783s Verified using v3 scheme (APK Signature Scheme v3): false
783s Verified using v4 scheme (APK Signature Scheme v4): false
783s Verified for SourceStamp: false
783s Number of signers: 1
783s 
783s 2024-03-26 05:42:38,257 DEBUG: Processing com.politedroid_6.apk
783s 2024-03-26 05:42:38,258 INFO: Starting analysis on AndroidManifest.xml
783s 2024-03-26 05:42:38,259 INFO: APK file was successfully validated!
783s 2024-03-26 05:42:38,261 DEBUG: Getting signature of com.politedroid_6.apk
783s 2024-03-26 05:42:38,522 DEBUG: repo/com.politedroid_6.apk: Verifies
783s Verified using v1 scheme (JAR signing): true
783s Verified using v2 scheme (APK Signature Scheme v2): false
783s Verified using v3 scheme (APK Signature Scheme v3): false
783s Verified using v4 scheme (APK Signature Scheme v4): false
783s Verified for SourceStamp: false
783s Number of signers: 1
783s 
783s 2024-03-26 05:42:38,523 DEBUG: Processing duplicate.permisssions_9999999.apk
783s 2024-03-26 05:42:38,524 INFO: Starting analysis on AndroidManifest.xml
783s 2024-03-26 05:42:38,526 INFO: APK file was successfully validated!
783s 2024-03-26 05:42:38,528 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
783s 2024-03-26 05:42:38,534 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
783s 2024-03-26 05:42:38,897 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
783s Verified using v1 scheme (JAR signing): true
783s Verified using v2 scheme (APK Signature Scheme v2): true
783s Verified using v3 scheme (APK Signature Scheme v3): false
783s Verified using v4 scheme (APK Signature Scheme v4): false
783s Verified for SourceStamp: false
783s Number of signers: 1
783s 
783s 2024-03-26 05:42:38,916 DEBUG: Density 120 not available, resizing down from 160
783s 2024-03-26 05:42:38,936 DEBUG: Processing info.guardianproject.urzip_100.apk
783s 2024-03-26 05:42:38,953 INFO: Starting analysis on AndroidManifest.xml
783s 2024-03-26 05:42:38,959 INFO: APK file was successfully validated!
783s 2024-03-26 05:42:38,966 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
784s 2024-03-26 05:42:39,264 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
784s Verified using v1 scheme (JAR signing): true
784s Verified using v2 scheme (APK Signature Scheme v2): false
784s Verified using v3 scheme (APK Signature Scheme v3): false
784s Verified using v4 scheme (APK Signature Scheme v4): false
784s Verified for SourceStamp: false
784s Number of signers: 1
784s 
784s 2024-03-26 05:42:39,269 DEBUG: Density 120 not available, resizing down from 160
784s 2024-03-26 05:42:39,271 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
784s 2024-03-26 05:42:39,271 INFO: Starting analysis on AndroidManifest.xml
784s 2024-03-26 05:42:39,272 INFO: APK file was successfully validated!
784s 2024-03-26 05:42:39,274 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
784s 2024-03-26 05:42:39,554 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
784s Verified using v1 scheme (JAR signing): true
784s Verified using v2 scheme (APK Signature Scheme v2): false
784s Verified using v3 scheme (APK Signature Scheme v3): false
784s Verified using v4 scheme (APK Signature Scheme v4): false
784s Verified for SourceStamp: false
784s Number of signers: 1
784s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
784s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
784s 
784s 2024-03-26 05:42:39,555 DEBUG: Processing no.min.target.sdk_987.apk
784s 2024-03-26 05:42:39,555 INFO: Starting analysis on AndroidManifest.xml
784s 2024-03-26 05:42:39,556 INFO: APK file was successfully validated!
784s 2024-03-26 05:42:39,558 DEBUG: Getting signature of no.min.target.sdk_987.apk
784s 2024-03-26 05:42:39,566 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
784s 2024-03-26 05:42:39,858 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
784s Verified using v1 scheme (JAR signing): true
784s Verified using v2 scheme (APK Signature Scheme v2): true
784s Verified using v3 scheme (APK Signature Scheme v3): false
784s Verified using v4 scheme (APK Signature Scheme v4): false
784s Verified for SourceStamp: false
784s Number of signers: 1
784s 
784s 2024-03-26 05:42:39,858 DEBUG: Density 120 not available, resizing down from 160
784s 2024-03-26 05:42:39,860 DEBUG: Processing obb.main.oldversion_1444412523.apk
784s 2024-03-26 05:42:39,860 INFO: Starting analysis on AndroidManifest.xml
784s 2024-03-26 05:42:39,862 INFO: APK file was successfully validated!
784s 2024-03-26 05:42:39,864 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
785s 2024-03-26 05:42:40,172 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
785s Verified using v1 scheme (JAR signing): true
785s Verified using v2 scheme (APK Signature Scheme v2): true
785s Verified using v3 scheme (APK Signature Scheme v3): false
785s Verified using v4 scheme (APK Signature Scheme v4): false
785s Verified for SourceStamp: false
785s Number of signers: 1
785s 
785s 2024-03-26 05:42:40,173 DEBUG: Density 120 not available, resizing down from 160
785s 2024-03-26 05:42:40,175 DEBUG: Processing obb.main.twoversions_1101613.apk
785s 2024-03-26 05:42:40,175 INFO: Starting analysis on AndroidManifest.xml
785s 2024-03-26 05:42:40,176 INFO: APK file was successfully validated!
785s 2024-03-26 05:42:40,178 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
785s 2024-03-26 05:42:40,464 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
785s Verified using v1 scheme (JAR signing): true
785s Verified using v2 scheme (APK Signature Scheme v2): false
785s Verified using v3 scheme (APK Signature Scheme v3): false
785s Verified using v4 scheme (APK Signature Scheme v4): false
785s Verified for SourceStamp: false
785s Number of signers: 1
785s 
785s 2024-03-26 05:42:40,464 DEBUG: Density 120 not available, resizing down from 160
785s 2024-03-26 05:42:40,466 DEBUG: Processing obb.main.twoversions_1101615.apk
785s 2024-03-26 05:42:40,466 INFO: Starting analysis on AndroidManifest.xml
785s 2024-03-26 05:42:40,468 INFO: APK file was successfully validated!
785s 2024-03-26 05:42:40,469 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
785s 2024-03-26 05:42:40,797 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
785s Verified using v1 scheme (JAR signing): true
785s Verified using v2 scheme (APK Signature Scheme v2): false
785s Verified using v3 scheme (APK Signature Scheme v3): false
785s Verified using v4 scheme (APK Signature Scheme v4): false
785s Verified for SourceStamp: false
785s Number of signers: 1
785s 
785s 2024-03-26 05:42:40,798 DEBUG: Density 120 not available, resizing down from 160
785s 2024-03-26 05:42:40,800 DEBUG: Processing obb.main.twoversions_1101617.apk
785s 2024-03-26 05:42:40,800 INFO: Starting analysis on AndroidManifest.xml
785s 2024-03-26 05:42:40,801 INFO: APK file was successfully validated!
785s 2024-03-26 05:42:40,803 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
786s 2024-03-26 05:42:41,089 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
786s Verified using v1 scheme (JAR signing): true
786s Verified using v2 scheme (APK Signature Scheme v2): false
786s Verified using v3 scheme (APK Signature Scheme v3): false
786s Verified using v4 scheme (APK Signature Scheme v4): false
786s Verified for SourceStamp: false
786s Number of signers: 1
786s 
786s 2024-03-26 05:42:41,089 DEBUG: Density 120 not available, resizing down from 160
786s 2024-03-26 05:42:41,091 DEBUG: Processing obb.mainpatch.current_1619.apk
786s 2024-03-26 05:42:41,091 INFO: Starting analysis on AndroidManifest.xml
786s 2024-03-26 05:42:41,093 INFO: APK file was successfully validated!
786s 2024-03-26 05:42:41,094 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
786s 2024-03-26 05:42:41,384 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
786s Verified using v1 scheme (JAR signing): true
786s Verified using v2 scheme (APK Signature Scheme v2): false
786s Verified using v3 scheme (APK Signature Scheme v3): false
786s Verified using v4 scheme (APK Signature Scheme v4): false
786s Verified for SourceStamp: false
786s Number of signers: 1
786s 
786s 2024-03-26 05:42:41,385 DEBUG: Density 120 not available, resizing down from 160
786s 2024-03-26 05:42:41,386 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk
786s 2024-03-26 05:42:41,387 INFO: Starting analysis on AndroidManifest.xml
786s 2024-03-26 05:42:41,387 INFO: APK file was successfully validated!
786s 2024-03-26 05:42:41,389 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk
786s 2024-03-26 05:42:41,669 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies
786s Verified using v1 scheme (JAR signing): true
786s Verified using v2 scheme (APK Signature Scheme v2): false
786s Verified using v3 scheme (APK Signature Scheme v3): false
786s Verified using v4 scheme (APK Signature Scheme v4): false
786s Verified for SourceStamp: false
786s Number of signers: 1
786s 
786s 2024-03-26 05:42:41,669 DEBUG: Density 120 not available, resizing down from 160
786s 2024-03-26 05:42:41,671 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk
786s 2024-03-26 05:42:41,671 INFO: Starting analysis on AndroidManifest.xml
786s 2024-03-26 05:42:41,672 INFO: APK file was successfully validated!
786s 2024-03-26 05:42:41,674 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk
786s 2024-03-26 05:42:41,970 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies
786s Verified using v1 scheme (JAR signing): true
786s Verified using v2 scheme (APK Signature Scheme v2): false
786s Verified using v3 scheme (APK Signature Scheme v3): false
786s Verified using v4 scheme (APK Signature Scheme v4): false
786s Verified for SourceStamp: false
786s Number of signers: 1
786s 
786s 2024-03-26 05:42:41,970 DEBUG: Density 120 not available, resizing down from 160
786s 2024-03-26 05:42:41,972 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk
786s 2024-03-26 05:42:41,972 INFO: Starting analysis on AndroidManifest.xml
786s 2024-03-26 05:42:41,973 INFO: APK file was successfully validated!
786s 2024-03-26 05:42:41,974 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk
787s 2024-03-26 05:42:42,227 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies
787s Verified using v1 scheme (JAR signing): true
787s Verified using v2 scheme (APK Signature Scheme v2): false
787s Verified using v3 scheme (APK Signature Scheme v3): false
787s Verified using v4 scheme (APK Signature Scheme v4): false
787s Verified for SourceStamp: false
787s Number of signers: 1
787s 
787s 2024-03-26 05:42:42,228 DEBUG: Density 120 not available, resizing down from 160
787s 2024-03-26 05:42:42,229 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk
787s 2024-03-26 05:42:42,229 INFO: Starting analysis on AndroidManifest.xml
787s 2024-03-26 05:42:42,230 INFO: APK file was successfully validated!
787s 2024-03-26 05:42:42,232 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk
787s 2024-03-26 05:42:42,508 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies
787s Verified using v1 scheme (JAR signing): true
787s Verified using v2 scheme (APK Signature Scheme v2): false
787s Verified using v3 scheme (APK Signature Scheme v3): false
787s Verified using v4 scheme (APK Signature Scheme v4): false
787s Verified for SourceStamp: false
787s Number of signers: 1
787s 
787s 2024-03-26 05:42:42,513 DEBUG: Density 120 not available, resizing down from 160
787s 2024-03-26 05:42:42,515 DEBUG: Processing org.dyndns.fules.ck_20.apk
787s 2024-03-26 05:42:42,516 INFO: Starting analysis on AndroidManifest.xml
787s 2024-03-26 05:42:42,517 INFO: APK file was successfully validated!
787s 2024-03-26 05:42:42,525 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk
787s 2024-03-26 05:42:42,887 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies
787s Verified using v1 scheme (JAR signing): true
787s Verified using v2 scheme (APK Signature Scheme v2): false
787s Verified using v3 scheme (APK Signature Scheme v3): false
787s Verified using v4 scheme (APK Signature Scheme v4): false
787s Verified for SourceStamp: false
787s Number of signers: 1
787s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
787s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
787s 
787s 2024-03-26 05:42:42,889 DEBUG: Processing souch.smsbypass_9.apk
787s 2024-03-26 05:42:42,889 INFO: Starting analysis on AndroidManifest.xml
787s 2024-03-26 05:42:42,900 INFO: APK file was successfully validated!
787s 2024-03-26 05:42:42,903 DEBUG: Getting signature of souch.smsbypass_9.apk
788s 2024-03-26 05:42:43,386 DEBUG: repo/souch.smsbypass_9.apk: Verifies
788s Verified using v1 scheme (JAR signing): true
788s Verified using v2 scheme (APK Signature Scheme v2): false
788s Verified using v3 scheme (APK Signature Scheme v3): false
788s Verified using v4 scheme (APK Signature Scheme v4): false
788s Verified for SourceStamp: false
788s Number of signers: 1
788s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
788s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
788s 
788s 2024-03-26 05:42:43,387 DEBUG: Density 120 not available, resizing down from 160
788s 2024-03-26 05:42:43,409 DEBUG: Processing v1.v2.sig_1020.apk
788s 2024-03-26 05:42:43,409 INFO: Starting analysis on AndroidManifest.xml
788s 2024-03-26 05:42:43,450 INFO: APK file was successfully validated!
788s 2024-03-26 05:42:43,452 DEBUG: Getting signature of v1.v2.sig_1020.apk
788s 2024-03-26 05:42:43,754 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
788s Verified using v1 scheme (JAR signing): true
788s Verified using v2 scheme (APK Signature Scheme v2): true
788s Verified using v3 scheme (APK Signature Scheme v3): false
788s Verified using v4 scheme (APK Signature Scheme v4): false
788s Verified for SourceStamp: false
788s Number of signers: 1
788s 
788s 2024-03-26 05:42:43,755 DEBUG: Density 120 not available, resizing down from 160
788s 2024-03-26 05:42:43,756 DEBUG: Processing v2.only.sig_2.apk
788s 2024-03-26 05:42:43,756 INFO: Starting analysis on AndroidManifest.xml
788s 2024-03-26 05:42:43,758 INFO: APK file was successfully validated!
788s 2024-03-26 05:42:43,759 DEBUG: Getting signature of v2.only.sig_2.apk
788s 2024-03-26 05:42:43,760 INFO: Starting analysis on AndroidManifest.xml
788s 2024-03-26 05:42:43,761 INFO: APK file was successfully validated!
788s 2024-03-26 05:42:43,762 DEBUG: Using APK Signature v2
788s 2024-03-26 05:42:43,762 INFO: Starting analysis on AndroidManifest.xml
788s 2024-03-26 05:42:43,764 INFO: APK file was successfully validated!
788s 2024-03-26 05:42:43,764 DEBUG: Using APK Signature v2
789s 2024-03-26 05:42:44,291 DEBUG: repo/v2.only.sig_2.apk: Verifies
789s Verified using v1 scheme (JAR signing): false
789s Verified using v2 scheme (APK Signature Scheme v2): true
789s Verified using v3 scheme (APK Signature Scheme v3): false
789s Verified using v4 scheme (APK Signature Scheme v4): false
789s Verified for SourceStamp: false
789s Number of signers: 1
789s 
789s 2024-03-26 05:42:44,292 DEBUG: Density 120 not available, resizing down from 160
789s 2024-03-26 05:42:44,294 INFO: Generated skeleton metadata for SpeedoMeterApp.main
789s 2024-03-26 05:42:44,301 INFO: Generated skeleton metadata for apk.embedded
789s 2024-03-26 05:42:44,303 INFO: Generated skeleton metadata for com.example.test.helloworld
789s 2024-03-26 05:42:44,305 INFO: Generated skeleton metadata for com.politedroid
789s 2024-03-26 05:42:44,308 INFO: Generated skeleton metadata for duplicate.permisssions
789s 2024-03-26 05:42:44,311 INFO: Generated skeleton metadata for info.guardianproject.urzip
789s 2024-03-26 05:42:44,314 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile
789s 2024-03-26 05:42:44,318 INFO: Generated skeleton metadata for no.min.target.sdk
789s 2024-03-26 05:42:44,322 INFO: Generated skeleton metadata for obb.main.oldversion
789s 2024-03-26 05:42:44,327 INFO: Generated skeleton metadata for obb.main.twoversions
789s 2024-03-26 05:42:44,331 INFO: Generated skeleton metadata for obb.mainpatch.current
789s 2024-03-26 05:42:44,337 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror
789s 2024-03-26 05:42:44,343 INFO: Generated skeleton metadata for org.dyndns.fules.ck
789s 2024-03-26 05:42:44,349 INFO: Generated skeleton metadata for souch.smsbypass
789s 2024-03-26 05:42:44,355 INFO: Generated skeleton metadata for v1.v2.sig
789s 2024-03-26 05:42:44,362 INFO: Generated skeleton metadata for v2.only.sig
789s 2024-03-26 05:42:44,372 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
789s 
789s Warning:
789s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
790s 2024-03-26 05:42:44,986 INFO: Creating signed index with this key (SHA256):
790s 2024-03-26 05:42:44,987 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
790s 2024-03-26 05:42:44,987 DEBUG: Directory: repo
790s 2024-03-26 05:42:44,987 DEBUG: > jar cf index.jar index.xml
790s 2024-03-26 05:42:45,197 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS
791s jar signed.
791s 
791s Warning: 
791s The signer's certificate is self-signed.
791s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
791s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
791s 2024-03-26 05:42:46,218 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
791s 2024-03-26 05:42:46,286 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS
792s jar signed.
792s 
792s Warning: 
792s The signer's certificate is self-signed.
792s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
792s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
792s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
792s 2024-03-26 05:42:47,166 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
792s 2024-03-26 05:42:47,671 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
793s 
793s Warning:
793s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
793s 2024-03-26 05:42:48,289 DEBUG: Outputting JSON
793s 2024-03-26 05:42:48,289 DEBUG: skip deploying full build logs: not enabled in config
793s 2024-03-26 05:42:48,294 DEBUG: skip deploying full build logs: not enabled in config
793s 2024-03-26 05:42:48,295 DEBUG: skip deploying full build logs: not enabled in config
793s 2024-03-26 05:42:48,295 INFO: Finished
793s + /usr/bin/fdroid readmeta
793s + grep -F '<application id=' repo/index.xml
793s ++ create_test_dir
793s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
793s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
793s + LOCALCOPYDIR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.01ib/fdroid
793s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.01ib/fdroid
794s ++ create_test_dir
794s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
794s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
794s + NEWREPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.JxtY
794s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.JxtY
794s + fdroid_init_with_prebuilt_keystore
794s + '[' -z '' ']'
794s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
794s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
794s 2024-03-26 05:42:49,809 WARNING: 
794s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
794s Now set these in config.yml: keystorepass, keypass, keydname
794s 
794s 2024-03-26 05:42:49,810 INFO: 
794s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.JxtY" with this config:
794s 
794s   Android SDK:			/usr/lib/android-sdk
794s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
794s   Alias for key in store:	sova
794s 
794s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.JxtY/repo"
794s then run "fdroid update -c; fdroid update".  You might also want to edit
794s "config.yml" to set the URL, repo name, and more.  You should also set up
794s a signing key (a temporary one might have been automatically generated).
794s 
794s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
794s and https://f-droid.org/docs/Signing_Process
794s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
794s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
794s + echo 'sync_from_local_copy_dir: true'
794s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.01ib/fdroid
795s 2024-03-26 05:42:50,248 INFO: Syncing from local_copy_dir to this repo.
795s ++ create_test_dir
795s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
795s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
795s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.APSn
795s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.APSn/keystore.p12
795s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.APSn
795s + set +e
795s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.APSn/keystore.p12 --android-home /opt/fakeandroidhome
795s 2024-03-26 05:42:50,720 CRITICAL: Android SDK path '/opt/fakeandroidhome' does not exist!
795s 2024-03-26 05:42:50,720 CRITICAL: Android SDK not found at /opt/fakeandroidhome!
795s + '[' 1 -eq 0 ']'
795s + echo 'testing android-home path checker passed'
795s testing android-home path checker passed
795s ++ create_test_file
795s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
795s ++ TMPDIR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
795s ++ mktemp
795s + TESTFILE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/tmp.nRrEGSOGFK
795s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.APSn/keystore.p12 --android-home /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/tmp.nRrEGSOGFK
796s 2024-03-26 05:42:51,147 CRITICAL: Android SDK path '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/tmp.nRrEGSOGFK' is not a directory!
796s 2024-03-26 05:42:51,148 CRITICAL: Android SDK not found at /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/tmp.nRrEGSOGFK!
796s + '[' 1 -eq 0 ']'
796s + echo 'testing android-home not-dir checker passed'
796s + set -e
796s + echo_header 'check that fake android home passes '\''fdroid init'\'''
796s testing android-home not-dir checker passed
796s ==============================================================================
796s check that fake android home passes 'fdroid init'
796s ++ create_test_dir
796s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
796s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
796s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7
796s ++ create_test_dir
796s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
796s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
796s + FAKE_ANDROID_HOME=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL
796s + create_fake_android_home /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL
796s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL/tools
796s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL/platform-tools
796s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL/build-tools
796s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL/build-tools/19.0.2
796s + touch /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL/build-tools/19.0.2/aapt
796s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7/keystore.p12
796s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7
796s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7/keystore.p12 --android-home /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL
796s 2024-03-26 05:42:51,602 INFO: "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7/keystore.p12" does not exist, creating a new keystore there.
796s 2024-03-26 05:42:51,606 INFO: Generating a new key in "keystore.p12"...
804s 2024-03-26 05:42:59,423 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
804s Creation date: Mar 26, 2024
804s Entry type: PrivateKeyEntry
804s Certificate chain length: 1
804s Certificate[1]:
804s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
804s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
804s Serial number: d26bbcaeb04883b
804s Valid from: Tue Mar 26 05:42:58 UTC 2024 until: Sat Aug 12 05:42:58 UTC 2051
804s Certificate fingerprints:
804s 	 SHA1: E6:C4:55:73:23:BA:47:49:3A:2F:AC:65:88:EF:95:A7:2C:52:B3:70
804s 	 SHA256: 7C:0E:F2:2C:0A:6D:BA:25:9C:B6:79:CE:9F:94:03:CB:C1:33:4C:35:3A:1B:A1:71:E4:D8:C2:F5:E4:E8:42:AA
804s Signature algorithm name: SHA256withRSA
804s Subject Public Key Algorithm: 4096-bit RSA key
804s Version: 3
804s 
804s Extensions: 
804s 
804s #1: ObjectId: 2.5.29.14 Criticality=false
804s SubjectKeyIdentifier [
804s KeyIdentifier [
804s 0000: A5 BA 6C 70 0F 1F 8A EF   7A AE DC 02 14 23 1F E0  ..lp....z....#..
804s 0010: 65 00 01 09                                        e...
804s ]
804s ]
804s 
804s 
805s 2024-03-26 05:43:00,129 INFO: 
805s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7" with this config:
805s 
805s   Android SDK:			/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XoXL
805s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7/keystore.p12
805s 
805s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.yiv7/repo"
805s then run "fdroid update -c; fdroid update".  You might also want to edit
805s "config.yml" to set the URL, repo name, and more.  You should also set up
805s a signing key (a temporary one might have been automatically generated).
805s 
805s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
805s and https://f-droid.org/docs/Signing_Process
805s + echo_header 'check that '\''fdroid init'\'' fails when build-tools cannot be found'
805s + '[' -e /usr/bin/aapt ']'
805s + python3 -c 'import androguard'
805s ==============================================================================
805s check that 'fdroid init' fails when build-tools cannot be found
805s + echo '/usr/bin/aapt or androguard installed, not running test'
805s + echo_header 'check that --android-home overrides ANDROID_HOME'
805s /usr/bin/aapt or androguard installed, not running test
805s ==============================================================================
805s check that --android-home overrides ANDROID_HOME
805s ++ create_test_dir
805s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
805s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
805s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM
805s ++ create_test_dir
805s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
805s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
805s + FAKE_ANDROID_HOME=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z
805s + create_fake_android_home /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z
805s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z/tools
805s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z/platform-tools
805s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z/build-tools
805s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z/build-tools/19.0.2
805s + touch /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z/build-tools/19.0.2/aapt
805s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM/keystore.p12
805s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM
805s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM/keystore.p12 --android-home /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z
805s 2024-03-26 05:43:00,587 INFO: "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM/keystore.p12" does not exist, creating a new keystore there.
805s 2024-03-26 05:43:00,590 INFO: Generating a new key in "keystore.p12"...
814s 2024-03-26 05:43:09,608 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
814s Creation date: Mar 26, 2024
814s Entry type: PrivateKeyEntry
814s Certificate chain length: 1
814s Certificate[1]:
814s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
814s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
814s Serial number: 5d9dfe6801fc3c12
814s Valid from: Tue Mar 26 05:43:08 UTC 2024 until: Sat Aug 12 05:43:08 UTC 2051
814s Certificate fingerprints:
814s 	 SHA1: 32:89:B8:A7:17:23:8F:A2:DB:05:92:80:85:36:59:79:27:D6:75:41
814s 	 SHA256: A0:6C:21:DB:32:51:38:DC:49:CD:62:25:91:F7:7C:99:01:C0:16:EB:AB:B8:3D:C5:8B:8A:27:17:55:8C:07:33
814s Signature algorithm name: SHA256withRSA
814s Subject Public Key Algorithm: 4096-bit RSA key
814s Version: 3
814s 
814s Extensions: 
814s 
814s #1: ObjectId: 2.5.29.14 Criticality=false
814s SubjectKeyIdentifier [
814s KeyIdentifier [
814s 0000: 90 54 4C 88 57 D3 D3 F2   27 73 4B 5A 72 B5 0F B2  .TL.W...'sKZr...
814s 0010: E4 33 EC 5D                                        .3.]
814s ]
814s ]
814s 
814s 
815s 2024-03-26 05:43:10,320 INFO: 
815s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM" with this config:
815s 
815s   Android SDK:			/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z
815s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM/keystore.p12
815s 
815s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM/repo"
815s then run "fdroid update -c; fdroid update".  You might also want to edit
815s "config.yml" to set the URL, repo name, and more.  You should also set up
815s a signing key (a temporary one might have been automatically generated).
815s 
815s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
815s and https://f-droid.org/docs/Signing_Process
815s + set +e
815s + grep /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.vgRM/config.yml
815s sdk_path: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Hx1z
815s + '[' 0 -ne 0 ']'
815s + set -e
815s + '[' -z /usr/lib/android-sdk ']'
815s + echo_header 'setup a new repo from scratch with keystore and android-home set on cmd line'
815s ++ create_test_dir
815s ==============================================================================
815s setup a new repo from scratch with keystore and android-home set on cmd line
815s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
815s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
815s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3
815s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12
815s ++ create_test_dir
815s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
815s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
815s + FAKE_ANDROID_HOME=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL
815s + create_fake_android_home /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL
815s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL/tools
815s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL/platform-tools
815s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL/build-tools
815s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL/build-tools/19.0.2
815s + touch /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.aScL/build-tools/19.0.2/aapt
815s + STORED_ANDROID_HOME=/usr/lib/android-sdk
815s + unset ANDROID_HOME
815s + echo 'ANDROID_HOME: '
815s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3
815s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12 --android-home /usr/lib/android-sdk --no-prompt
815s ANDROID_HOME: 
815s 2024-03-26 05:43:10,789 INFO: "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12" does not exist, creating a new keystore there.
815s 2024-03-26 05:43:10,792 INFO: Generating a new key in "keystore.p12"...
820s 2024-03-26 05:43:15,843 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
820s Creation date: Mar 26, 2024
820s Entry type: PrivateKeyEntry
820s Certificate chain length: 1
820s Certificate[1]:
820s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
820s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
820s Serial number: b80ee580800db1b6
820s Valid from: Tue Mar 26 05:43:14 UTC 2024 until: Sat Aug 12 05:43:14 UTC 2051
820s Certificate fingerprints:
820s 	 SHA1: A6:1B:41:F4:B0:A6:47:E1:A2:1B:B7:EB:D1:3A:14:F4:3C:10:DE:29
820s 	 SHA256: 03:A0:26:03:A3:6A:BF:C4:0C:F6:61:8F:B8:23:62:2D:A3:A4:41:D3:7F:2B:FD:92:58:3F:4D:D6:A9:56:2E:D2
820s Signature algorithm name: SHA256withRSA
820s Subject Public Key Algorithm: 4096-bit RSA key
820s Version: 3
820s 
820s Extensions: 
820s 
820s #1: ObjectId: 2.5.29.14 Criticality=false
820s SubjectKeyIdentifier [
820s KeyIdentifier [
820s 0000: DD B6 CF E9 C6 4C A9 9C   F4 5D FB F8 48 F0 2D 91  .....L...]..H.-.
820s 0010: 71 7D BD DB                                        q...
820s ]
820s ]
820s 
820s 
821s 2024-03-26 05:43:16,577 INFO: 
821s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3" with this config:
821s 
821s   Android SDK:			/usr/lib/android-sdk
821s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12
821s 
821s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/repo"
821s then run "fdroid update -c; fdroid update".  You might also want to edit
821s "config.yml" to set the URL, repo name, and more.  You should also set up
821s a signing key (a temporary one might have been automatically generated).
821s 
821s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
821s and https://f-droid.org/docs/Signing_Process
821s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12
821s + copy_apks_into_repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3
821s + set +x
821s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk
822s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
823s Requested API level 30 is larger than maximum we have, returning API level 28 instead.
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk --> repo/obb.mainpatch.current_1619.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk
823s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk
824s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk
825s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk
826s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk
827s + /usr/bin/fdroid update --create-metadata --verbose
827s 2024-03-26 05:43:22,465 DEBUG: Reading 'config.yml'
827s 2024-03-26 05:43:22,475 DEBUG: ipfs_cid not found, skipping CIDv1 generation
827s 2024-03-26 05:43:22,476 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
827s 2024-03-26 05:43:22,476 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
827s 2024-03-26 05:43:22,477 DEBUG: Processing SpeedoMeterApp.main_1.apk
827s 2024-03-26 05:43:22,559 INFO: Starting analysis on AndroidManifest.xml
827s 2024-03-26 05:43:22,568 INFO: APK file was successfully validated!
827s 2024-03-26 05:43:22,570 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk
827s 2024-03-26 05:43:22,576 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3).
828s 2024-03-26 05:43:22,984 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies
828s Verified using v1 scheme (JAR signing): true
828s Verified using v2 scheme (APK Signature Scheme v2): false
828s Verified using v3 scheme (APK Signature Scheme v3): false
828s Verified using v4 scheme (APK Signature Scheme v4): false
828s Verified for SourceStamp: false
828s Number of signers: 1
828s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
828s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
828s 
828s 2024-03-26 05:43:22,985 DEBUG: Processing apk.embedded_1.apk
828s 2024-03-26 05:43:22,985 INFO: Starting analysis on AndroidManifest.xml
828s 2024-03-26 05:43:22,986 INFO: APK file was successfully validated!
828s 2024-03-26 05:43:22,988 DEBUG: Getting signature of apk.embedded_1.apk
828s 2024-03-26 05:43:23,267 DEBUG: repo/apk.embedded_1.apk: Verifies
828s Verified using v1 scheme (JAR signing): true
828s Verified using v2 scheme (APK Signature Scheme v2): true
828s Verified using v3 scheme (APK Signature Scheme v3): true
828s Verified using v4 scheme (APK Signature Scheme v4): false
828s Verified for SourceStamp: false
828s Number of signers: 1
828s 
828s 2024-03-26 05:43:23,268 DEBUG: Processing com.example.test.helloworld_1.apk
828s 2024-03-26 05:43:23,268 INFO: Starting analysis on AndroidManifest.xml
828s 2024-03-26 05:43:23,269 INFO: APK file was successfully validated!
828s 2024-03-26 05:43:23,271 DEBUG: Getting signature of com.example.test.helloworld_1.apk
828s 2024-03-26 05:43:23,515 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
828s Verified using v1 scheme (JAR signing): true
828s Verified using v2 scheme (APK Signature Scheme v2): false
828s Verified using v3 scheme (APK Signature Scheme v3): false
828s Verified using v4 scheme (APK Signature Scheme v4): false
828s Verified for SourceStamp: false
828s Number of signers: 1
828s 
828s 2024-03-26 05:43:23,516 DEBUG: Processing com.politedroid_3.apk
828s 2024-03-26 05:43:23,516 INFO: Starting analysis on AndroidManifest.xml
828s 2024-03-26 05:43:23,517 INFO: APK file was successfully validated!
828s 2024-03-26 05:43:23,519 DEBUG: Getting signature of com.politedroid_3.apk
828s 2024-03-26 05:43:23,773 DEBUG: repo/com.politedroid_3.apk: Verifies
828s Verified using v1 scheme (JAR signing): true
828s Verified using v2 scheme (APK Signature Scheme v2): false
828s Verified using v3 scheme (APK Signature Scheme v3): false
828s Verified using v4 scheme (APK Signature Scheme v4): false
828s Verified for SourceStamp: false
828s Number of signers: 1
828s 
828s 2024-03-26 05:43:23,778 DEBUG: Processing com.politedroid_4.apk
828s 2024-03-26 05:43:23,778 INFO: Starting analysis on AndroidManifest.xml
828s 2024-03-26 05:43:23,779 INFO: APK file was successfully validated!
828s 2024-03-26 05:43:23,780 DEBUG: Getting signature of com.politedroid_4.apk
829s 2024-03-26 05:43:24,036 DEBUG: repo/com.politedroid_4.apk: Verifies
829s Verified using v1 scheme (JAR signing): true
829s Verified using v2 scheme (APK Signature Scheme v2): false
829s Verified using v3 scheme (APK Signature Scheme v3): false
829s Verified using v4 scheme (APK Signature Scheme v4): false
829s Verified for SourceStamp: false
829s Number of signers: 1
829s 
829s 2024-03-26 05:43:24,037 DEBUG: Processing com.politedroid_5.apk
829s 2024-03-26 05:43:24,037 INFO: Starting analysis on AndroidManifest.xml
829s 2024-03-26 05:43:24,038 INFO: APK file was successfully validated!
829s 2024-03-26 05:43:24,040 DEBUG: Getting signature of com.politedroid_5.apk
829s 2024-03-26 05:43:24,305 DEBUG: repo/com.politedroid_5.apk: Verifies
829s Verified using v1 scheme (JAR signing): true
829s Verified using v2 scheme (APK Signature Scheme v2): false
829s Verified using v3 scheme (APK Signature Scheme v3): false
829s Verified using v4 scheme (APK Signature Scheme v4): false
829s Verified for SourceStamp: false
829s Number of signers: 1
829s 
829s 2024-03-26 05:43:24,307 DEBUG: Processing com.politedroid_6.apk
829s 2024-03-26 05:43:24,307 INFO: Starting analysis on AndroidManifest.xml
829s 2024-03-26 05:43:24,308 INFO: APK file was successfully validated!
829s 2024-03-26 05:43:24,310 DEBUG: Getting signature of com.politedroid_6.apk
829s 2024-03-26 05:43:24,557 DEBUG: repo/com.politedroid_6.apk: Verifies
829s Verified using v1 scheme (JAR signing): true
829s Verified using v2 scheme (APK Signature Scheme v2): false
829s Verified using v3 scheme (APK Signature Scheme v3): false
829s Verified using v4 scheme (APK Signature Scheme v4): false
829s Verified for SourceStamp: false
829s Number of signers: 1
829s 
829s 2024-03-26 05:43:24,559 DEBUG: Processing duplicate.permisssions_9999999.apk
829s 2024-03-26 05:43:24,560 INFO: Starting analysis on AndroidManifest.xml
829s 2024-03-26 05:43:24,561 INFO: APK file was successfully validated!
829s 2024-03-26 05:43:24,563 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
829s 2024-03-26 05:43:24,569 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
829s 2024-03-26 05:43:24,835 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
829s Verified using v1 scheme (JAR signing): true
829s Verified using v2 scheme (APK Signature Scheme v2): true
829s Verified using v3 scheme (APK Signature Scheme v3): false
829s Verified using v4 scheme (APK Signature Scheme v4): false
829s Verified for SourceStamp: false
829s Number of signers: 1
829s 
829s 2024-03-26 05:43:24,836 DEBUG: Density 120 not available, resizing down from 160
829s 2024-03-26 05:43:24,838 DEBUG: Processing info.guardianproject.urzip_100.apk
829s 2024-03-26 05:43:24,838 INFO: Starting analysis on AndroidManifest.xml
829s 2024-03-26 05:43:24,839 INFO: APK file was successfully validated!
829s 2024-03-26 05:43:24,841 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
830s 2024-03-26 05:43:25,130 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
830s Verified using v1 scheme (JAR signing): true
830s Verified using v2 scheme (APK Signature Scheme v2): false
830s Verified using v3 scheme (APK Signature Scheme v3): false
830s Verified using v4 scheme (APK Signature Scheme v4): false
830s Verified for SourceStamp: false
830s Number of signers: 1
830s 
830s 2024-03-26 05:43:25,130 DEBUG: Density 120 not available, resizing down from 160
830s 2024-03-26 05:43:25,132 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
830s 2024-03-26 05:43:25,132 INFO: Starting analysis on AndroidManifest.xml
830s 2024-03-26 05:43:25,133 INFO: APK file was successfully validated!
830s 2024-03-26 05:43:25,135 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
830s 2024-03-26 05:43:25,381 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
830s Verified using v1 scheme (JAR signing): true
830s Verified using v2 scheme (APK Signature Scheme v2): false
830s Verified using v3 scheme (APK Signature Scheme v3): false
830s Verified using v4 scheme (APK Signature Scheme v4): false
830s Verified for SourceStamp: false
830s Number of signers: 1
830s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
830s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
830s 
830s 2024-03-26 05:43:25,382 DEBUG: Processing no.min.target.sdk_987.apk
830s 2024-03-26 05:43:25,382 INFO: Starting analysis on AndroidManifest.xml
830s 2024-03-26 05:43:25,383 INFO: APK file was successfully validated!
830s 2024-03-26 05:43:25,385 DEBUG: Getting signature of no.min.target.sdk_987.apk
830s 2024-03-26 05:43:25,393 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
830s 2024-03-26 05:43:25,667 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
830s Verified using v1 scheme (JAR signing): true
830s Verified using v2 scheme (APK Signature Scheme v2): true
830s Verified using v3 scheme (APK Signature Scheme v3): false
830s Verified using v4 scheme (APK Signature Scheme v4): false
830s Verified for SourceStamp: false
830s Number of signers: 1
830s 
830s 2024-03-26 05:43:25,668 DEBUG: Density 120 not available, resizing down from 160
830s 2024-03-26 05:43:25,669 DEBUG: Processing obb.main.oldversion_1444412523.apk
830s 2024-03-26 05:43:25,670 INFO: Starting analysis on AndroidManifest.xml
830s 2024-03-26 05:43:25,672 INFO: APK file was successfully validated!
830s 2024-03-26 05:43:25,673 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
831s 2024-03-26 05:43:25,983 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
831s Verified using v1 scheme (JAR signing): true
831s Verified using v2 scheme (APK Signature Scheme v2): true
831s Verified using v3 scheme (APK Signature Scheme v3): false
831s Verified using v4 scheme (APK Signature Scheme v4): false
831s Verified for SourceStamp: false
831s Number of signers: 1
831s 
831s 2024-03-26 05:43:25,988 DEBUG: Density 120 not available, resizing down from 160
831s 2024-03-26 05:43:25,990 DEBUG: Processing obb.main.twoversions_1101613.apk
831s 2024-03-26 05:43:25,990 INFO: Starting analysis on AndroidManifest.xml
831s 2024-03-26 05:43:25,991 INFO: APK file was successfully validated!
831s 2024-03-26 05:43:25,998 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
831s 2024-03-26 05:43:26,269 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
831s Verified using v1 scheme (JAR signing): true
831s Verified using v2 scheme (APK Signature Scheme v2): false
831s Verified using v3 scheme (APK Signature Scheme v3): false
831s Verified using v4 scheme (APK Signature Scheme v4): false
831s Verified for SourceStamp: false
831s Number of signers: 1
831s 
831s 2024-03-26 05:43:26,270 DEBUG: Density 120 not available, resizing down from 160
831s 2024-03-26 05:43:26,272 DEBUG: Processing obb.main.twoversions_1101615.apk
831s 2024-03-26 05:43:26,272 INFO: Starting analysis on AndroidManifest.xml
831s 2024-03-26 05:43:26,273 INFO: APK file was successfully validated!
831s 2024-03-26 05:43:26,275 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
831s 2024-03-26 05:43:26,529 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
831s Verified using v1 scheme (JAR signing): true
831s Verified using v2 scheme (APK Signature Scheme v2): false
831s Verified using v3 scheme (APK Signature Scheme v3): false
831s Verified using v4 scheme (APK Signature Scheme v4): false
831s Verified for SourceStamp: false
831s Number of signers: 1
831s 
831s 2024-03-26 05:43:26,530 DEBUG: Density 120 not available, resizing down from 160
831s 2024-03-26 05:43:26,532 DEBUG: Processing obb.main.twoversions_1101617.apk
831s 2024-03-26 05:43:26,532 INFO: Starting analysis on AndroidManifest.xml
831s 2024-03-26 05:43:26,533 INFO: APK file was successfully validated!
831s 2024-03-26 05:43:26,535 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
831s 2024-03-26 05:43:26,812 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
831s Verified using v1 scheme (JAR signing): true
831s Verified using v2 scheme (APK Signature Scheme v2): false
831s Verified using v3 scheme (APK Signature Scheme v3): false
831s Verified using v4 scheme (APK Signature Scheme v4): false
831s Verified for SourceStamp: false
831s Number of signers: 1
831s 
831s 2024-03-26 05:43:26,813 DEBUG: Density 120 not available, resizing down from 160
831s 2024-03-26 05:43:26,814 DEBUG: Processing obb.mainpatch.current_1619.apk
831s 2024-03-26 05:43:26,814 INFO: Starting analysis on AndroidManifest.xml
831s 2024-03-26 05:43:26,816 INFO: APK file was successfully validated!
831s 2024-03-26 05:43:26,817 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
832s 2024-03-26 05:43:27,064 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
832s Verified using v1 scheme (JAR signing): true
832s Verified using v2 scheme (APK Signature Scheme v2): false
832s Verified using v3 scheme (APK Signature Scheme v3): false
832s Verified using v4 scheme (APK Signature Scheme v4): false
832s Verified for SourceStamp: false
832s Number of signers: 1
832s 
832s 2024-03-26 05:43:27,065 DEBUG: Density 120 not available, resizing down from 160
832s 2024-03-26 05:43:27,066 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk
832s 2024-03-26 05:43:27,066 INFO: Starting analysis on AndroidManifest.xml
832s 2024-03-26 05:43:27,067 INFO: APK file was successfully validated!
832s 2024-03-26 05:43:27,069 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk
832s 2024-03-26 05:43:27,325 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies
832s Verified using v1 scheme (JAR signing): true
832s Verified using v2 scheme (APK Signature Scheme v2): false
832s Verified using v3 scheme (APK Signature Scheme v3): false
832s Verified using v4 scheme (APK Signature Scheme v4): false
832s Verified for SourceStamp: false
832s Number of signers: 1
832s 
832s 2024-03-26 05:43:27,326 DEBUG: Density 120 not available, resizing down from 160
832s 2024-03-26 05:43:27,327 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk
832s 2024-03-26 05:43:27,327 INFO: Starting analysis on AndroidManifest.xml
832s 2024-03-26 05:43:27,328 INFO: APK file was successfully validated!
832s 2024-03-26 05:43:27,330 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk
832s 2024-03-26 05:43:27,643 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies
832s Verified using v1 scheme (JAR signing): true
832s Verified using v2 scheme (APK Signature Scheme v2): false
832s Verified using v3 scheme (APK Signature Scheme v3): false
832s Verified using v4 scheme (APK Signature Scheme v4): false
832s Verified for SourceStamp: false
832s Number of signers: 1
832s 
832s 2024-03-26 05:43:27,644 DEBUG: Density 120 not available, resizing down from 160
832s 2024-03-26 05:43:27,645 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk
832s 2024-03-26 05:43:27,645 INFO: Starting analysis on AndroidManifest.xml
832s 2024-03-26 05:43:27,646 INFO: APK file was successfully validated!
832s 2024-03-26 05:43:27,648 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk
832s 2024-03-26 05:43:27,887 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies
832s Verified using v1 scheme (JAR signing): true
832s Verified using v2 scheme (APK Signature Scheme v2): false
832s Verified using v3 scheme (APK Signature Scheme v3): false
832s Verified using v4 scheme (APK Signature Scheme v4): false
832s Verified for SourceStamp: false
832s Number of signers: 1
832s 
832s 2024-03-26 05:43:27,888 DEBUG: Density 120 not available, resizing down from 160
832s 2024-03-26 05:43:27,889 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk
832s 2024-03-26 05:43:27,890 INFO: Starting analysis on AndroidManifest.xml
832s 2024-03-26 05:43:27,890 INFO: APK file was successfully validated!
832s 2024-03-26 05:43:27,892 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk
833s 2024-03-26 05:43:28,151 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies
833s Verified using v1 scheme (JAR signing): true
833s Verified using v2 scheme (APK Signature Scheme v2): false
833s Verified using v3 scheme (APK Signature Scheme v3): false
833s Verified using v4 scheme (APK Signature Scheme v4): false
833s Verified for SourceStamp: false
833s Number of signers: 1
833s 
833s 2024-03-26 05:43:28,152 DEBUG: Density 120 not available, resizing down from 160
833s 2024-03-26 05:43:28,153 DEBUG: Processing org.dyndns.fules.ck_20.apk
833s 2024-03-26 05:43:28,153 INFO: Starting analysis on AndroidManifest.xml
833s 2024-03-26 05:43:28,154 INFO: APK file was successfully validated!
833s 2024-03-26 05:43:28,157 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk
833s 2024-03-26 05:43:28,462 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies
833s Verified using v1 scheme (JAR signing): true
833s Verified using v2 scheme (APK Signature Scheme v2): false
833s Verified using v3 scheme (APK Signature Scheme v3): false
833s Verified using v4 scheme (APK Signature Scheme v4): false
833s Verified for SourceStamp: false
833s Number of signers: 1
833s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
833s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
833s 
833s 2024-03-26 05:43:28,464 DEBUG: Processing souch.smsbypass_9.apk
833s 2024-03-26 05:43:28,464 INFO: Starting analysis on AndroidManifest.xml
833s 2024-03-26 05:43:28,465 INFO: APK file was successfully validated!
833s 2024-03-26 05:43:28,468 DEBUG: Getting signature of souch.smsbypass_9.apk
833s 2024-03-26 05:43:28,761 DEBUG: repo/souch.smsbypass_9.apk: Verifies
833s Verified using v1 scheme (JAR signing): true
833s Verified using v2 scheme (APK Signature Scheme v2): false
833s Verified using v3 scheme (APK Signature Scheme v3): false
833s Verified using v4 scheme (APK Signature Scheme v4): false
833s Verified for SourceStamp: false
833s Number of signers: 1
833s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
833s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
833s 
833s 2024-03-26 05:43:28,762 DEBUG: Density 120 not available, resizing down from 160
833s 2024-03-26 05:43:28,765 DEBUG: Processing v1.v2.sig_1020.apk
833s 2024-03-26 05:43:28,765 INFO: Starting analysis on AndroidManifest.xml
833s 2024-03-26 05:43:28,766 INFO: APK file was successfully validated!
833s 2024-03-26 05:43:28,768 DEBUG: Getting signature of v1.v2.sig_1020.apk
834s 2024-03-26 05:43:29,049 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
834s Verified using v1 scheme (JAR signing): true
834s Verified using v2 scheme (APK Signature Scheme v2): true
834s Verified using v3 scheme (APK Signature Scheme v3): false
834s Verified using v4 scheme (APK Signature Scheme v4): false
834s Verified for SourceStamp: false
834s Number of signers: 1
834s 
834s 2024-03-26 05:43:29,049 DEBUG: Density 120 not available, resizing down from 160
834s 2024-03-26 05:43:29,051 DEBUG: Processing v2.only.sig_2.apk
834s 2024-03-26 05:43:29,051 INFO: Starting analysis on AndroidManifest.xml
834s 2024-03-26 05:43:29,053 INFO: APK file was successfully validated!
834s 2024-03-26 05:43:29,054 DEBUG: Getting signature of v2.only.sig_2.apk
834s 2024-03-26 05:43:29,054 INFO: Starting analysis on AndroidManifest.xml
834s 2024-03-26 05:43:29,056 INFO: APK file was successfully validated!
834s 2024-03-26 05:43:29,057 DEBUG: Using APK Signature v2
834s 2024-03-26 05:43:29,057 INFO: Starting analysis on AndroidManifest.xml
834s 2024-03-26 05:43:29,058 INFO: APK file was successfully validated!
834s 2024-03-26 05:43:29,059 DEBUG: Using APK Signature v2
834s 2024-03-26 05:43:29,299 DEBUG: repo/v2.only.sig_2.apk: Verifies
834s Verified using v1 scheme (JAR signing): false
834s Verified using v2 scheme (APK Signature Scheme v2): true
834s Verified using v3 scheme (APK Signature Scheme v3): false
834s Verified using v4 scheme (APK Signature Scheme v4): false
834s Verified for SourceStamp: false
834s Number of signers: 1
834s 
834s 2024-03-26 05:43:29,300 DEBUG: Density 120 not available, resizing down from 160
834s 2024-03-26 05:43:29,302 INFO: Generated skeleton metadata for SpeedoMeterApp.main
834s 2024-03-26 05:43:29,309 INFO: Generated skeleton metadata for apk.embedded
834s 2024-03-26 05:43:29,311 INFO: Generated skeleton metadata for com.example.test.helloworld
834s 2024-03-26 05:43:29,313 INFO: Generated skeleton metadata for com.politedroid
834s 2024-03-26 05:43:29,316 INFO: Generated skeleton metadata for duplicate.permisssions
834s 2024-03-26 05:43:29,319 INFO: Generated skeleton metadata for info.guardianproject.urzip
834s 2024-03-26 05:43:29,322 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile
834s 2024-03-26 05:43:29,326 INFO: Generated skeleton metadata for no.min.target.sdk
834s 2024-03-26 05:43:29,330 INFO: Generated skeleton metadata for obb.main.oldversion
834s 2024-03-26 05:43:29,334 INFO: Generated skeleton metadata for obb.main.twoversions
834s 2024-03-26 05:43:29,339 INFO: Generated skeleton metadata for obb.mainpatch.current
834s 2024-03-26 05:43:29,345 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror
834s 2024-03-26 05:43:29,351 INFO: Generated skeleton metadata for org.dyndns.fules.ck
834s 2024-03-26 05:43:29,357 INFO: Generated skeleton metadata for souch.smsbypass
834s 2024-03-26 05:43:29,363 INFO: Generated skeleton metadata for v1.v2.sig
834s 2024-03-26 05:43:29,370 INFO: Generated skeleton metadata for v2.only.sig
834s 2024-03-26 05:43:29,380 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
835s 2024-03-26 05:43:30,093 INFO: Creating signed index with this key (SHA256):
835s 2024-03-26 05:43:30,093 INFO: 03 A0 26 03 A3 6A BF C4 0C F6 61 8F B8 23 62 2D A3 A4 41 D3 7F 2B FD 92 58 3F 4D D6 A9 56 2E D2
835s 2024-03-26 05:43:30,093 DEBUG: Directory: repo
835s 2024-03-26 05:43:30,093 DEBUG: > jar cf index.jar index.xml
835s 2024-03-26 05:43:30,294 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
836s jar signed.
836s 
836s Warning: 
836s The signer's certificate is self-signed.
836s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
836s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
836s 2024-03-26 05:43:31,418 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
836s 2024-03-26 05:43:31,432 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
837s jar signed.
837s 
837s Warning: 
837s The signer's certificate is self-signed.
837s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
837s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
837s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
837s 2024-03-26 05:43:32,660 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar
838s 2024-03-26 05:43:33,466 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.K2o3/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
839s 2024-03-26 05:43:34,198 DEBUG: Outputting JSON
839s 2024-03-26 05:43:34,198 DEBUG: skip deploying full build logs: not enabled in config
839s 2024-03-26 05:43:34,199 DEBUG: skip deploying full build logs: not enabled in config
839s 2024-03-26 05:43:34,199 DEBUG: skip deploying full build logs: not enabled in config
839s 2024-03-26 05:43:34,199 INFO: Finished
839s + /usr/bin/fdroid readmeta
839s + grep -F '<application id=' repo/index.xml
839s + test -e repo/index.xml
839s + test -e repo/index.jar
839s + test -e repo/index-v1.jar
839s + test -e tmp/apkcache.json
839s + test -z tmp/apkcache.json
839s + export ANDROID_HOME=/usr/lib/android-sdk
839s ==============================================================================
839s check duplicate files are properly handled by fdroid update
839s + ANDROID_HOME=/usr/lib/android-sdk
839s + echo_header 'check duplicate files are properly handled by fdroid update'
839s ++ create_test_dir
839s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
839s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
840s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw
840s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw
840s + fdroid_init_with_prebuilt_keystore
840s + '[' -z '' ']'
840s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
840s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
840s 2024-03-26 05:43:35,223 WARNING: 
840s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
840s Now set these in config.yml: keystorepass, keypass, keydname
840s 
840s 2024-03-26 05:43:35,223 INFO: 
840s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw" with this config:
840s 
840s   Android SDK:			/usr/lib/android-sdk
840s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
840s   Alias for key in store:	sova
840s 
840s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw/repo"
840s then run "fdroid update -c; fdroid update".  You might also want to edit
840s "config.yml" to set the URL, repo name, and more.  You should also set up
840s a signing key (a temporary one might have been automatically generated).
840s 
840s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
840s and https://f-droid.org/docs/Signing_Process
840s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
840s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
840s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw/metadata
840s + cp -a /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/obb.mainpatch.current.yml /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw/metadata
840s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw/repo/
840s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw/repo/
840s + /usr/bin/fdroid update --pretty
840s 2024-03-26 05:43:35,690 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
840s 2024-03-26 05:43:35,784 INFO: Starting analysis on AndroidManifest.xml
840s 2024-03-26 05:43:35,793 INFO: APK file was successfully validated!
841s 2024-03-26 05:43:36,072 INFO: Starting analysis on AndroidManifest.xml
841s 2024-03-26 05:43:36,073 INFO: APK file was successfully validated!
841s 2024-03-26 05:43:36,863 INFO: Creating signed index with this key (SHA256):
841s 2024-03-26 05:43:36,872 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
842s 2024-03-26 05:43:37,824 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
844s 2024-03-26 05:43:39,528 INFO: Finished
844s + grep -F obb.mainpatch.current_1619.apk repo/index.xml repo/index-v1.json
844s repo/index.xml:			<apkname>obb.mainpatch.current_1619.apk</apkname>
844s repo/index-v1.json:        "apkName": "obb.mainpatch.current_1619.apk",
844s + grep -F obb.mainpatch.current_1619_another-release-key.apk repo/index-v1.json
844s + grep -F obb.mainpatch.current_1619_another-release-key.apk repo/index.xml
844s         "apkName": "obb.mainpatch.current_1619_another-release-key.apk",
844s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xMFw/repo/duplicate.apk
844s + /usr/bin/fdroid update
845s 2024-03-26 05:43:40,071 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
845s 2024-03-26 05:43:40,166 INFO: Starting analysis on AndroidManifest.xml
845s 2024-03-26 05:43:40,175 INFO: APK file was successfully validated!
845s 2024-03-26 05:43:40,957 INFO: Creating signed index with this key (SHA256):
845s 2024-03-26 05:43:40,957 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
846s 2024-03-26 05:43:41,867 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
848s 2024-03-26 05:43:43,505 INFO: Finished
848s ==============================================================================
848s setup new repo from scratch using ANDROID_HOME, putting APKs in repo first
848s + echo_header 'setup new repo from scratch using ANDROID_HOME, putting APKs in repo first'
848s ++ create_test_dir
848s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
848s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
848s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.iquc
848s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.iquc
848s + mkdir repo
848s + copy_apks_into_repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.iquc
848s + set +x
848s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk
848s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk
848s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
849s Requested API level 30 is larger than maximum we have, returning API level 28 instead.
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk
849s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk --> repo/obb.mainpatch.current_1619.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk
850s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk
851s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk
852s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk
853s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk
853s + fdroid_init_with_prebuilt_keystore
853s + '[' -z '' ']'
853s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
853s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
854s 2024-03-26 05:43:49,254 WARNING: 
854s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
854s Now set these in config.yml: keystorepass, keypass, keydname
854s 
854s 2024-03-26 05:43:49,254 INFO: 
854s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.iquc" with this config:
854s 
854s   Android SDK:			/usr/lib/android-sdk
854s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
854s   Alias for key in store:	sova
854s 
854s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.iquc/repo"
854s then run "fdroid update -c; fdroid update".  You might also want to edit
854s "config.yml" to set the URL, repo name, and more.  You should also set up
854s a signing key (a temporary one might have been automatically generated).
854s 
854s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
854s and https://f-droid.org/docs/Signing_Process
854s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
854s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
854s + /usr/bin/fdroid update --create-metadata --verbose
854s 2024-03-26 05:43:49,691 DEBUG: Reading 'config.yml'
854s 2024-03-26 05:43:49,701 DEBUG: ipfs_cid not found, skipping CIDv1 generation
854s 2024-03-26 05:43:49,701 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
854s 2024-03-26 05:43:49,702 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
854s 2024-03-26 05:43:49,702 DEBUG: Processing SpeedoMeterApp.main_1.apk
854s 2024-03-26 05:43:49,781 INFO: Starting analysis on AndroidManifest.xml
854s 2024-03-26 05:43:49,794 INFO: APK file was successfully validated!
854s 2024-03-26 05:43:49,796 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk
854s 2024-03-26 05:43:49,801 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3).
855s 2024-03-26 05:43:50,193 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies
855s Verified using v1 scheme (JAR signing): true
855s Verified using v2 scheme (APK Signature Scheme v2): false
855s Verified using v3 scheme (APK Signature Scheme v3): false
855s Verified using v4 scheme (APK Signature Scheme v4): false
855s Verified for SourceStamp: false
855s Number of signers: 1
855s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
855s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
855s 
855s 2024-03-26 05:43:50,194 DEBUG: Processing apk.embedded_1.apk
855s 2024-03-26 05:43:50,194 INFO: Starting analysis on AndroidManifest.xml
855s 2024-03-26 05:43:50,195 INFO: APK file was successfully validated!
855s 2024-03-26 05:43:50,197 DEBUG: Getting signature of apk.embedded_1.apk
855s 2024-03-26 05:43:50,450 DEBUG: repo/apk.embedded_1.apk: Verifies
855s Verified using v1 scheme (JAR signing): true
855s Verified using v2 scheme (APK Signature Scheme v2): true
855s Verified using v3 scheme (APK Signature Scheme v3): true
855s Verified using v4 scheme (APK Signature Scheme v4): false
855s Verified for SourceStamp: false
855s Number of signers: 1
855s 
855s 2024-03-26 05:43:50,451 DEBUG: Processing com.example.test.helloworld_1.apk
855s 2024-03-26 05:43:50,451 INFO: Starting analysis on AndroidManifest.xml
855s 2024-03-26 05:43:50,452 INFO: APK file was successfully validated!
855s 2024-03-26 05:43:50,453 DEBUG: Getting signature of com.example.test.helloworld_1.apk
856s 2024-03-26 05:43:51,015 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
856s Verified using v1 scheme (JAR signing): true
856s Verified using v2 scheme (APK Signature Scheme v2): false
856s Verified using v3 scheme (APK Signature Scheme v3): false
856s Verified using v4 scheme (APK Signature Scheme v4): false
856s Verified for SourceStamp: false
856s Number of signers: 1
856s 
856s 2024-03-26 05:43:51,016 DEBUG: Processing com.politedroid_3.apk
856s 2024-03-26 05:43:51,016 INFO: Starting analysis on AndroidManifest.xml
856s 2024-03-26 05:43:51,027 INFO: APK file was successfully validated!
856s 2024-03-26 05:43:51,029 DEBUG: Getting signature of com.politedroid_3.apk
856s 2024-03-26 05:43:51,355 DEBUG: repo/com.politedroid_3.apk: Verifies
856s Verified using v1 scheme (JAR signing): true
856s Verified using v2 scheme (APK Signature Scheme v2): false
856s Verified using v3 scheme (APK Signature Scheme v3): false
856s Verified using v4 scheme (APK Signature Scheme v4): false
856s Verified for SourceStamp: false
856s Number of signers: 1
856s 
856s 2024-03-26 05:43:51,364 DEBUG: Processing com.politedroid_4.apk
856s 2024-03-26 05:43:51,364 INFO: Starting analysis on AndroidManifest.xml
856s 2024-03-26 05:43:51,365 INFO: APK file was successfully validated!
856s 2024-03-26 05:43:51,367 DEBUG: Getting signature of com.politedroid_4.apk
856s 2024-03-26 05:43:51,645 DEBUG: repo/com.politedroid_4.apk: Verifies
856s Verified using v1 scheme (JAR signing): true
856s Verified using v2 scheme (APK Signature Scheme v2): false
856s Verified using v3 scheme (APK Signature Scheme v3): false
856s Verified using v4 scheme (APK Signature Scheme v4): false
856s Verified for SourceStamp: false
856s Number of signers: 1
856s 
856s 2024-03-26 05:43:51,646 DEBUG: Processing com.politedroid_5.apk
856s 2024-03-26 05:43:51,647 INFO: Starting analysis on AndroidManifest.xml
856s 2024-03-26 05:43:51,648 INFO: APK file was successfully validated!
856s 2024-03-26 05:43:51,649 DEBUG: Getting signature of com.politedroid_5.apk
856s 2024-03-26 05:43:51,901 DEBUG: repo/com.politedroid_5.apk: Verifies
856s Verified using v1 scheme (JAR signing): true
856s Verified using v2 scheme (APK Signature Scheme v2): false
856s Verified using v3 scheme (APK Signature Scheme v3): false
856s Verified using v4 scheme (APK Signature Scheme v4): false
856s Verified for SourceStamp: false
856s Number of signers: 1
856s 
856s 2024-03-26 05:43:51,903 DEBUG: Processing com.politedroid_6.apk
856s 2024-03-26 05:43:51,904 INFO: Starting analysis on AndroidManifest.xml
856s 2024-03-26 05:43:51,904 INFO: APK file was successfully validated!
856s 2024-03-26 05:43:51,906 DEBUG: Getting signature of com.politedroid_6.apk
857s 2024-03-26 05:43:52,158 DEBUG: repo/com.politedroid_6.apk: Verifies
857s Verified using v1 scheme (JAR signing): true
857s Verified using v2 scheme (APK Signature Scheme v2): false
857s Verified using v3 scheme (APK Signature Scheme v3): false
857s Verified using v4 scheme (APK Signature Scheme v4): false
857s Verified for SourceStamp: false
857s Number of signers: 1
857s 
857s 2024-03-26 05:43:52,160 DEBUG: Processing duplicate.permisssions_9999999.apk
857s 2024-03-26 05:43:52,160 INFO: Starting analysis on AndroidManifest.xml
857s 2024-03-26 05:43:52,162 INFO: APK file was successfully validated!
857s 2024-03-26 05:43:52,164 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
857s 2024-03-26 05:43:52,170 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
857s 2024-03-26 05:43:52,431 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
857s Verified using v1 scheme (JAR signing): true
857s Verified using v2 scheme (APK Signature Scheme v2): true
857s Verified using v3 scheme (APK Signature Scheme v3): false
857s Verified using v4 scheme (APK Signature Scheme v4): false
857s Verified for SourceStamp: false
857s Number of signers: 1
857s 
857s 2024-03-26 05:43:52,431 DEBUG: Density 120 not available, resizing down from 160
857s 2024-03-26 05:43:52,433 DEBUG: Processing info.guardianproject.urzip_100.apk
857s 2024-03-26 05:43:52,433 INFO: Starting analysis on AndroidManifest.xml
857s 2024-03-26 05:43:52,434 INFO: APK file was successfully validated!
857s 2024-03-26 05:43:52,436 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
857s 2024-03-26 05:43:52,701 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
857s Verified using v1 scheme (JAR signing): true
857s Verified using v2 scheme (APK Signature Scheme v2): false
857s Verified using v3 scheme (APK Signature Scheme v3): false
857s Verified using v4 scheme (APK Signature Scheme v4): false
857s Verified for SourceStamp: false
857s Number of signers: 1
857s 
857s 2024-03-26 05:43:52,702 DEBUG: Density 120 not available, resizing down from 160
857s 2024-03-26 05:43:52,703 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
857s 2024-03-26 05:43:52,704 INFO: Starting analysis on AndroidManifest.xml
857s 2024-03-26 05:43:52,705 INFO: APK file was successfully validated!
857s 2024-03-26 05:43:52,706 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
858s 2024-03-26 05:43:53,051 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
858s Verified using v1 scheme (JAR signing): true
858s Verified using v2 scheme (APK Signature Scheme v2): false
858s Verified using v3 scheme (APK Signature Scheme v3): false
858s Verified using v4 scheme (APK Signature Scheme v4): false
858s Verified for SourceStamp: false
858s Number of signers: 1
858s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
858s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
858s 
858s 2024-03-26 05:43:53,052 DEBUG: Processing no.min.target.sdk_987.apk
858s 2024-03-26 05:43:53,052 INFO: Starting analysis on AndroidManifest.xml
858s 2024-03-26 05:43:53,053 INFO: APK file was successfully validated!
858s 2024-03-26 05:43:53,055 DEBUG: Getting signature of no.min.target.sdk_987.apk
858s 2024-03-26 05:43:53,062 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
858s 2024-03-26 05:43:53,420 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
858s Verified using v1 scheme (JAR signing): true
858s Verified using v2 scheme (APK Signature Scheme v2): true
858s Verified using v3 scheme (APK Signature Scheme v3): false
858s Verified using v4 scheme (APK Signature Scheme v4): false
858s Verified for SourceStamp: false
858s Number of signers: 1
858s 
858s 2024-03-26 05:43:53,421 DEBUG: Density 120 not available, resizing down from 160
858s 2024-03-26 05:43:53,422 DEBUG: Processing obb.main.oldversion_1444412523.apk
858s 2024-03-26 05:43:53,422 INFO: Starting analysis on AndroidManifest.xml
858s 2024-03-26 05:43:53,424 INFO: APK file was successfully validated!
858s 2024-03-26 05:43:53,426 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
858s 2024-03-26 05:43:53,733 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
858s Verified using v1 scheme (JAR signing): true
858s Verified using v2 scheme (APK Signature Scheme v2): true
858s Verified using v3 scheme (APK Signature Scheme v3): false
858s Verified using v4 scheme (APK Signature Scheme v4): false
858s Verified for SourceStamp: false
858s Number of signers: 1
858s 
858s 2024-03-26 05:43:53,734 DEBUG: Density 120 not available, resizing down from 160
858s 2024-03-26 05:43:53,735 DEBUG: Processing obb.main.twoversions_1101613.apk
858s 2024-03-26 05:43:53,736 INFO: Starting analysis on AndroidManifest.xml
858s 2024-03-26 05:43:53,737 INFO: APK file was successfully validated!
858s 2024-03-26 05:43:53,738 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
859s 2024-03-26 05:43:54,025 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
859s Verified using v1 scheme (JAR signing): true
859s Verified using v2 scheme (APK Signature Scheme v2): false
859s Verified using v3 scheme (APK Signature Scheme v3): false
859s Verified using v4 scheme (APK Signature Scheme v4): false
859s Verified for SourceStamp: false
859s Number of signers: 1
859s 
859s 2024-03-26 05:43:54,026 DEBUG: Density 120 not available, resizing down from 160
859s 2024-03-26 05:43:54,027 DEBUG: Processing obb.main.twoversions_1101615.apk
859s 2024-03-26 05:43:54,028 INFO: Starting analysis on AndroidManifest.xml
859s 2024-03-26 05:43:54,029 INFO: APK file was successfully validated!
859s 2024-03-26 05:43:54,030 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
859s 2024-03-26 05:43:54,297 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
859s Verified using v1 scheme (JAR signing): true
859s Verified using v2 scheme (APK Signature Scheme v2): false
859s Verified using v3 scheme (APK Signature Scheme v3): false
859s Verified using v4 scheme (APK Signature Scheme v4): false
859s Verified for SourceStamp: false
859s Number of signers: 1
859s 
859s 2024-03-26 05:43:54,297 DEBUG: Density 120 not available, resizing down from 160
859s 2024-03-26 05:43:54,299 DEBUG: Processing obb.main.twoversions_1101617.apk
859s 2024-03-26 05:43:54,299 INFO: Starting analysis on AndroidManifest.xml
859s 2024-03-26 05:43:54,301 INFO: APK file was successfully validated!
859s 2024-03-26 05:43:54,302 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
859s 2024-03-26 05:43:54,598 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
859s Verified using v1 scheme (JAR signing): true
859s Verified using v2 scheme (APK Signature Scheme v2): false
859s Verified using v3 scheme (APK Signature Scheme v3): false
859s Verified using v4 scheme (APK Signature Scheme v4): false
859s Verified for SourceStamp: false
859s Number of signers: 1
859s 
859s 2024-03-26 05:43:54,598 DEBUG: Density 120 not available, resizing down from 160
859s 2024-03-26 05:43:54,600 DEBUG: Processing obb.mainpatch.current_1619.apk
859s 2024-03-26 05:43:54,600 INFO: Starting analysis on AndroidManifest.xml
859s 2024-03-26 05:43:54,602 INFO: APK file was successfully validated!
859s 2024-03-26 05:43:54,603 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
859s 2024-03-26 05:43:54,855 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
859s Verified using v1 scheme (JAR signing): true
859s Verified using v2 scheme (APK Signature Scheme v2): false
859s Verified using v3 scheme (APK Signature Scheme v3): false
859s Verified using v4 scheme (APK Signature Scheme v4): false
859s Verified for SourceStamp: false
859s Number of signers: 1
859s 
859s 2024-03-26 05:43:54,856 DEBUG: Density 120 not available, resizing down from 160
859s 2024-03-26 05:43:54,857 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk
859s 2024-03-26 05:43:54,858 INFO: Starting analysis on AndroidManifest.xml
859s 2024-03-26 05:43:54,858 INFO: APK file was successfully validated!
859s 2024-03-26 05:43:54,860 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk
860s 2024-03-26 05:43:55,113 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies
860s Verified using v1 scheme (JAR signing): true
860s Verified using v2 scheme (APK Signature Scheme v2): false
860s Verified using v3 scheme (APK Signature Scheme v3): false
860s Verified using v4 scheme (APK Signature Scheme v4): false
860s Verified for SourceStamp: false
860s Number of signers: 1
860s 
860s 2024-03-26 05:43:55,113 DEBUG: Density 120 not available, resizing down from 160
860s 2024-03-26 05:43:55,114 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk
860s 2024-03-26 05:43:55,115 INFO: Starting analysis on AndroidManifest.xml
860s 2024-03-26 05:43:55,115 INFO: APK file was successfully validated!
860s 2024-03-26 05:43:55,117 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk
860s 2024-03-26 05:43:55,357 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies
860s Verified using v1 scheme (JAR signing): true
860s Verified using v2 scheme (APK Signature Scheme v2): false
860s Verified using v3 scheme (APK Signature Scheme v3): false
860s Verified using v4 scheme (APK Signature Scheme v4): false
860s Verified for SourceStamp: false
860s Number of signers: 1
860s 
860s 2024-03-26 05:43:55,358 DEBUG: Density 120 not available, resizing down from 160
860s 2024-03-26 05:43:55,359 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk
860s 2024-03-26 05:43:55,359 INFO: Starting analysis on AndroidManifest.xml
860s 2024-03-26 05:43:55,360 INFO: APK file was successfully validated!
860s 2024-03-26 05:43:55,361 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk
860s 2024-03-26 05:43:55,795 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies
860s Verified using v1 scheme (JAR signing): true
860s Verified using v2 scheme (APK Signature Scheme v2): false
860s Verified using v3 scheme (APK Signature Scheme v3): false
860s Verified using v4 scheme (APK Signature Scheme v4): false
860s Verified for SourceStamp: false
860s Number of signers: 1
860s 
860s 2024-03-26 05:43:55,796 DEBUG: Density 120 not available, resizing down from 160
860s 2024-03-26 05:43:55,797 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk
860s 2024-03-26 05:43:55,797 INFO: Starting analysis on AndroidManifest.xml
860s 2024-03-26 05:43:55,798 INFO: APK file was successfully validated!
860s 2024-03-26 05:43:55,800 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk
861s 2024-03-26 05:43:56,060 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies
861s Verified using v1 scheme (JAR signing): true
861s Verified using v2 scheme (APK Signature Scheme v2): false
861s Verified using v3 scheme (APK Signature Scheme v3): false
861s Verified using v4 scheme (APK Signature Scheme v4): false
861s Verified for SourceStamp: false
861s Number of signers: 1
861s 
861s 2024-03-26 05:43:56,061 DEBUG: Density 120 not available, resizing down from 160
861s 2024-03-26 05:43:56,062 DEBUG: Processing org.dyndns.fules.ck_20.apk
861s 2024-03-26 05:43:56,063 INFO: Starting analysis on AndroidManifest.xml
861s 2024-03-26 05:43:56,064 INFO: APK file was successfully validated!
861s 2024-03-26 05:43:56,066 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk
861s 2024-03-26 05:43:56,351 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies
861s Verified using v1 scheme (JAR signing): true
861s Verified using v2 scheme (APK Signature Scheme v2): false
861s Verified using v3 scheme (APK Signature Scheme v3): false
861s Verified using v4 scheme (APK Signature Scheme v4): false
861s Verified for SourceStamp: false
861s Number of signers: 1
861s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
861s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
861s 
861s 2024-03-26 05:43:56,353 DEBUG: Processing souch.smsbypass_9.apk
861s 2024-03-26 05:43:56,353 INFO: Starting analysis on AndroidManifest.xml
861s 2024-03-26 05:43:56,354 INFO: APK file was successfully validated!
861s 2024-03-26 05:43:56,358 DEBUG: Getting signature of souch.smsbypass_9.apk
861s 2024-03-26 05:43:56,642 DEBUG: repo/souch.smsbypass_9.apk: Verifies
861s Verified using v1 scheme (JAR signing): true
861s Verified using v2 scheme (APK Signature Scheme v2): false
861s Verified using v3 scheme (APK Signature Scheme v3): false
861s Verified using v4 scheme (APK Signature Scheme v4): false
861s Verified for SourceStamp: false
861s Number of signers: 1
861s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
861s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
861s 
861s 2024-03-26 05:43:56,643 DEBUG: Density 120 not available, resizing down from 160
861s 2024-03-26 05:43:56,645 DEBUG: Processing v1.v2.sig_1020.apk
861s 2024-03-26 05:43:56,645 INFO: Starting analysis on AndroidManifest.xml
861s 2024-03-26 05:43:56,647 INFO: APK file was successfully validated!
861s 2024-03-26 05:43:56,648 DEBUG: Getting signature of v1.v2.sig_1020.apk
862s 2024-03-26 05:43:56,981 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
862s Verified using v1 scheme (JAR signing): true
862s Verified using v2 scheme (APK Signature Scheme v2): true
862s Verified using v3 scheme (APK Signature Scheme v3): false
862s Verified using v4 scheme (APK Signature Scheme v4): false
862s Verified for SourceStamp: false
862s Number of signers: 1
862s 
862s 2024-03-26 05:43:56,982 DEBUG: Density 120 not available, resizing down from 160
862s 2024-03-26 05:43:56,983 DEBUG: Processing v2.only.sig_2.apk
862s 2024-03-26 05:43:56,983 INFO: Starting analysis on AndroidManifest.xml
862s 2024-03-26 05:43:56,985 INFO: APK file was successfully validated!
862s 2024-03-26 05:43:56,986 DEBUG: Getting signature of v2.only.sig_2.apk
862s 2024-03-26 05:43:56,986 INFO: Starting analysis on AndroidManifest.xml
862s 2024-03-26 05:43:56,988 INFO: APK file was successfully validated!
862s 2024-03-26 05:43:56,988 DEBUG: Using APK Signature v2
862s 2024-03-26 05:43:56,989 INFO: Starting analysis on AndroidManifest.xml
862s 2024-03-26 05:43:56,990 INFO: APK file was successfully validated!
862s 2024-03-26 05:43:56,991 DEBUG: Using APK Signature v2
862s 2024-03-26 05:43:57,213 DEBUG: repo/v2.only.sig_2.apk: Verifies
862s Verified using v1 scheme (JAR signing): false
862s Verified using v2 scheme (APK Signature Scheme v2): true
862s Verified using v3 scheme (APK Signature Scheme v3): false
862s Verified using v4 scheme (APK Signature Scheme v4): false
862s Verified for SourceStamp: false
862s Number of signers: 1
862s 
862s 2024-03-26 05:43:57,213 DEBUG: Density 120 not available, resizing down from 160
862s 2024-03-26 05:43:57,216 INFO: Generated skeleton metadata for SpeedoMeterApp.main
862s 2024-03-26 05:43:57,218 INFO: Generated skeleton metadata for apk.embedded
862s 2024-03-26 05:43:57,219 INFO: Generated skeleton metadata for com.example.test.helloworld
862s 2024-03-26 05:43:57,221 INFO: Generated skeleton metadata for com.politedroid
862s 2024-03-26 05:43:57,223 INFO: Generated skeleton metadata for duplicate.permisssions
862s 2024-03-26 05:43:57,226 INFO: Generated skeleton metadata for info.guardianproject.urzip
862s 2024-03-26 05:43:57,229 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile
862s 2024-03-26 05:43:57,232 INFO: Generated skeleton metadata for no.min.target.sdk
862s 2024-03-26 05:43:57,236 INFO: Generated skeleton metadata for obb.main.oldversion
862s 2024-03-26 05:43:57,241 INFO: Generated skeleton metadata for obb.main.twoversions
862s 2024-03-26 05:43:57,245 INFO: Generated skeleton metadata for obb.mainpatch.current
862s 2024-03-26 05:43:57,250 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror
862s 2024-03-26 05:43:57,256 INFO: Generated skeleton metadata for org.dyndns.fules.ck
862s 2024-03-26 05:43:57,262 INFO: Generated skeleton metadata for souch.smsbypass
862s 2024-03-26 05:43:57,268 INFO: Generated skeleton metadata for v1.v2.sig
862s 2024-03-26 05:43:57,274 INFO: Generated skeleton metadata for v2.only.sig
862s 2024-03-26 05:43:57,284 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
862s 
862s Warning:
862s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
862s 2024-03-26 05:43:57,791 INFO: Creating signed index with this key (SHA256):
862s 2024-03-26 05:43:57,791 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
862s 2024-03-26 05:43:57,791 DEBUG: Directory: repo
862s 2024-03-26 05:43:57,791 DEBUG: > jar cf index.jar index.xml
863s 2024-03-26 05:43:57,997 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS
863s jar signed.
863s 
863s Warning: 
863s The signer's certificate is self-signed.
863s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
863s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
863s 2024-03-26 05:43:58,705 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
863s 2024-03-26 05:43:58,714 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS
864s jar signed.
864s 
864s Warning: 
864s The signer's certificate is self-signed.
864s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
864s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
864s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
864s 2024-03-26 05:43:59,426 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
864s 2024-03-26 05:43:59,831 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
865s 
865s Warning:
865s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
865s 2024-03-26 05:44:00,352 DEBUG: Outputting JSON
865s 2024-03-26 05:44:00,352 DEBUG: skip deploying full build logs: not enabled in config
865s 2024-03-26 05:44:00,352 DEBUG: skip deploying full build logs: not enabled in config
865s 2024-03-26 05:44:00,353 DEBUG: skip deploying full build logs: not enabled in config
865s 2024-03-26 05:44:00,353 INFO: Finished
865s + /usr/bin/fdroid readmeta
866s + grep -F '<application id=' repo/index.xml
866s ==============================================================================
866s setup a new repo from scratch and generate a keystore
866s + echo_header 'setup a new repo from scratch and generate a keystore'
866s ++ create_test_dir
866s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
866s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
866s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S
866s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12
866s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S
866s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12
866s 2024-03-26 05:44:01,848 INFO: "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12" does not exist, creating a new keystore there.
866s 2024-03-26 05:44:01,864 INFO: Generating a new key in "keystore.p12"...
871s 2024-03-26 05:44:06,161 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
871s Creation date: Mar 26, 2024
871s Entry type: PrivateKeyEntry
871s Certificate chain length: 1
871s Certificate[1]:
871s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
871s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
871s Serial number: 4392fb7abbe77817
871s Valid from: Tue Mar 26 05:44:04 UTC 2024 until: Sat Aug 12 05:44:04 UTC 2051
871s Certificate fingerprints:
871s 	 SHA1: 17:C0:B6:F7:21:F9:AF:1F:B5:43:81:20:67:D2:A5:FD:40:22:30:17
871s 	 SHA256: D2:AA:FE:96:5D:3C:6A:05:E7:91:5A:32:E1:B1:BF:CA:2D:06:1B:EA:58:BC:2D:75:92:8B:1F:08:BD:A9:3A:9F
871s Signature algorithm name: SHA256withRSA
871s Subject Public Key Algorithm: 4096-bit RSA key
871s Version: 3
871s 
871s Extensions: 
871s 
871s #1: ObjectId: 2.5.29.14 Criticality=false
871s SubjectKeyIdentifier [
871s KeyIdentifier [
871s 0000: B8 8A 06 4C 52 46 6A 8E   6C DE 0D 16 92 E2 09 44  ...LRFj.l......D
871s 0010: 9B F9 0C 0E                                        ....
871s ]
871s ]
871s 
871s 
871s 2024-03-26 05:44:06,877 INFO: 
871s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S" with this config:
871s 
871s   Android SDK:			/usr/lib/android-sdk
871s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12
871s 
871s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/repo"
871s then run "fdroid update -c; fdroid update".  You might also want to edit
871s "config.yml" to set the URL, repo name, and more.  You should also set up
871s a signing key (a temporary one might have been automatically generated).
871s 
871s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
871s and https://f-droid.org/docs/Signing_Process
872s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12
872s + copy_apks_into_repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S
872s + set +x
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk
872s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
873s Requested API level 30 is larger than maximum we have, returning API level 28 instead.
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk --> repo/obb.mainpatch.current_1619.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk
873s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk
874s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk
875s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk
876s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk
877s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk
877s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk
877s + /usr/bin/fdroid update --create-metadata --verbose
877s 2024-03-26 05:44:12,682 DEBUG: Reading 'config.yml'
877s 2024-03-26 05:44:12,693 DEBUG: ipfs_cid not found, skipping CIDv1 generation
877s 2024-03-26 05:44:12,694 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
877s 2024-03-26 05:44:12,694 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
877s 2024-03-26 05:44:12,695 DEBUG: Processing SpeedoMeterApp.main_1.apk
877s 2024-03-26 05:44:12,781 INFO: Starting analysis on AndroidManifest.xml
877s 2024-03-26 05:44:12,790 INFO: APK file was successfully validated!
877s 2024-03-26 05:44:12,791 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk
877s 2024-03-26 05:44:12,797 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3).
878s 2024-03-26 05:44:13,142 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies
878s Verified using v1 scheme (JAR signing): true
878s Verified using v2 scheme (APK Signature Scheme v2): false
878s Verified using v3 scheme (APK Signature Scheme v3): false
878s Verified using v4 scheme (APK Signature Scheme v4): false
878s Verified for SourceStamp: false
878s Number of signers: 1
878s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
878s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
878s 
878s 2024-03-26 05:44:13,143 DEBUG: Processing apk.embedded_1.apk
878s 2024-03-26 05:44:13,143 INFO: Starting analysis on AndroidManifest.xml
878s 2024-03-26 05:44:13,144 INFO: APK file was successfully validated!
878s 2024-03-26 05:44:13,146 DEBUG: Getting signature of apk.embedded_1.apk
878s 2024-03-26 05:44:13,507 DEBUG: repo/apk.embedded_1.apk: Verifies
878s Verified using v1 scheme (JAR signing): true
878s Verified using v2 scheme (APK Signature Scheme v2): true
878s Verified using v3 scheme (APK Signature Scheme v3): true
878s Verified using v4 scheme (APK Signature Scheme v4): false
878s Verified for SourceStamp: false
878s Number of signers: 1
878s 
878s 2024-03-26 05:44:13,508 DEBUG: Processing com.example.test.helloworld_1.apk
878s 2024-03-26 05:44:13,508 INFO: Starting analysis on AndroidManifest.xml
878s 2024-03-26 05:44:13,509 INFO: APK file was successfully validated!
878s 2024-03-26 05:44:13,511 DEBUG: Getting signature of com.example.test.helloworld_1.apk
878s 2024-03-26 05:44:13,846 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
878s Verified using v1 scheme (JAR signing): true
878s Verified using v2 scheme (APK Signature Scheme v2): false
878s Verified using v3 scheme (APK Signature Scheme v3): false
878s Verified using v4 scheme (APK Signature Scheme v4): false
878s Verified for SourceStamp: false
878s Number of signers: 1
878s 
878s 2024-03-26 05:44:13,846 DEBUG: Processing com.politedroid_3.apk
878s 2024-03-26 05:44:13,846 INFO: Starting analysis on AndroidManifest.xml
878s 2024-03-26 05:44:13,847 INFO: APK file was successfully validated!
878s 2024-03-26 05:44:13,849 DEBUG: Getting signature of com.politedroid_3.apk
879s 2024-03-26 05:44:14,345 DEBUG: repo/com.politedroid_3.apk: Verifies
879s Verified using v1 scheme (JAR signing): true
879s Verified using v2 scheme (APK Signature Scheme v2): false
879s Verified using v3 scheme (APK Signature Scheme v3): false
879s Verified using v4 scheme (APK Signature Scheme v4): false
879s Verified for SourceStamp: false
879s Number of signers: 1
879s 
879s 2024-03-26 05:44:14,349 DEBUG: Processing com.politedroid_4.apk
879s 2024-03-26 05:44:14,350 INFO: Starting analysis on AndroidManifest.xml
879s 2024-03-26 05:44:14,350 INFO: APK file was successfully validated!
879s 2024-03-26 05:44:14,352 DEBUG: Getting signature of com.politedroid_4.apk
879s 2024-03-26 05:44:14,938 DEBUG: repo/com.politedroid_4.apk: Verifies
879s Verified using v1 scheme (JAR signing): true
879s Verified using v2 scheme (APK Signature Scheme v2): false
879s Verified using v3 scheme (APK Signature Scheme v3): false
879s Verified using v4 scheme (APK Signature Scheme v4): false
879s Verified for SourceStamp: false
879s Number of signers: 1
879s 
879s 2024-03-26 05:44:14,940 DEBUG: Processing com.politedroid_5.apk
879s 2024-03-26 05:44:14,940 INFO: Starting analysis on AndroidManifest.xml
879s 2024-03-26 05:44:14,941 INFO: APK file was successfully validated!
879s 2024-03-26 05:44:14,942 DEBUG: Getting signature of com.politedroid_5.apk
880s 2024-03-26 05:44:15,291 DEBUG: repo/com.politedroid_5.apk: Verifies
880s Verified using v1 scheme (JAR signing): true
880s Verified using v2 scheme (APK Signature Scheme v2): false
880s Verified using v3 scheme (APK Signature Scheme v3): false
880s Verified using v4 scheme (APK Signature Scheme v4): false
880s Verified for SourceStamp: false
880s Number of signers: 1
880s 
880s 2024-03-26 05:44:15,292 DEBUG: Processing com.politedroid_6.apk
880s 2024-03-26 05:44:15,293 INFO: Starting analysis on AndroidManifest.xml
880s 2024-03-26 05:44:15,294 INFO: APK file was successfully validated!
880s 2024-03-26 05:44:15,296 DEBUG: Getting signature of com.politedroid_6.apk
880s 2024-03-26 05:44:15,648 DEBUG: repo/com.politedroid_6.apk: Verifies
880s Verified using v1 scheme (JAR signing): true
880s Verified using v2 scheme (APK Signature Scheme v2): false
880s Verified using v3 scheme (APK Signature Scheme v3): false
880s Verified using v4 scheme (APK Signature Scheme v4): false
880s Verified for SourceStamp: false
880s Number of signers: 1
880s 
880s 2024-03-26 05:44:15,650 DEBUG: Processing duplicate.permisssions_9999999.apk
880s 2024-03-26 05:44:15,650 INFO: Starting analysis on AndroidManifest.xml
880s 2024-03-26 05:44:15,652 INFO: APK file was successfully validated!
880s 2024-03-26 05:44:15,654 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
880s 2024-03-26 05:44:15,660 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
880s 2024-03-26 05:44:15,926 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
880s Verified using v1 scheme (JAR signing): true
880s Verified using v2 scheme (APK Signature Scheme v2): true
880s Verified using v3 scheme (APK Signature Scheme v3): false
880s Verified using v4 scheme (APK Signature Scheme v4): false
880s Verified for SourceStamp: false
880s Number of signers: 1
880s 
880s 2024-03-26 05:44:15,927 DEBUG: Density 120 not available, resizing down from 160
880s 2024-03-26 05:44:15,928 DEBUG: Processing info.guardianproject.urzip_100.apk
880s 2024-03-26 05:44:15,929 INFO: Starting analysis on AndroidManifest.xml
880s 2024-03-26 05:44:15,930 INFO: APK file was successfully validated!
880s 2024-03-26 05:44:15,931 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
881s 2024-03-26 05:44:16,183 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
881s Verified using v1 scheme (JAR signing): true
881s Verified using v2 scheme (APK Signature Scheme v2): false
881s Verified using v3 scheme (APK Signature Scheme v3): false
881s Verified using v4 scheme (APK Signature Scheme v4): false
881s Verified for SourceStamp: false
881s Number of signers: 1
881s 
881s 2024-03-26 05:44:16,184 DEBUG: Density 120 not available, resizing down from 160
881s 2024-03-26 05:44:16,185 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
881s 2024-03-26 05:44:16,186 INFO: Starting analysis on AndroidManifest.xml
881s 2024-03-26 05:44:16,186 INFO: APK file was successfully validated!
881s 2024-03-26 05:44:16,188 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
881s 2024-03-26 05:44:16,449 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
881s Verified using v1 scheme (JAR signing): true
881s Verified using v2 scheme (APK Signature Scheme v2): false
881s Verified using v3 scheme (APK Signature Scheme v3): false
881s Verified using v4 scheme (APK Signature Scheme v4): false
881s Verified for SourceStamp: false
881s Number of signers: 1
881s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
881s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
881s 
881s 2024-03-26 05:44:16,450 DEBUG: Processing no.min.target.sdk_987.apk
881s 2024-03-26 05:44:16,450 INFO: Starting analysis on AndroidManifest.xml
881s 2024-03-26 05:44:16,451 INFO: APK file was successfully validated!
881s 2024-03-26 05:44:16,453 DEBUG: Getting signature of no.min.target.sdk_987.apk
881s 2024-03-26 05:44:16,461 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
881s 2024-03-26 05:44:16,728 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
881s Verified using v1 scheme (JAR signing): true
881s Verified using v2 scheme (APK Signature Scheme v2): true
881s Verified using v3 scheme (APK Signature Scheme v3): false
881s Verified using v4 scheme (APK Signature Scheme v4): false
881s Verified for SourceStamp: false
881s Number of signers: 1
881s 
881s 2024-03-26 05:44:16,729 DEBUG: Density 120 not available, resizing down from 160
881s 2024-03-26 05:44:16,730 DEBUG: Processing obb.main.oldversion_1444412523.apk
881s 2024-03-26 05:44:16,730 INFO: Starting analysis on AndroidManifest.xml
881s 2024-03-26 05:44:16,732 INFO: APK file was successfully validated!
881s 2024-03-26 05:44:16,734 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
882s 2024-03-26 05:44:17,040 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
882s Verified using v1 scheme (JAR signing): true
882s Verified using v2 scheme (APK Signature Scheme v2): true
882s Verified using v3 scheme (APK Signature Scheme v3): false
882s Verified using v4 scheme (APK Signature Scheme v4): false
882s Verified for SourceStamp: false
882s Number of signers: 1
882s 
882s 2024-03-26 05:44:17,040 DEBUG: Density 120 not available, resizing down from 160
882s 2024-03-26 05:44:17,042 DEBUG: Processing obb.main.twoversions_1101613.apk
882s 2024-03-26 05:44:17,042 INFO: Starting analysis on AndroidManifest.xml
882s 2024-03-26 05:44:17,044 INFO: APK file was successfully validated!
882s 2024-03-26 05:44:17,045 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
882s 2024-03-26 05:44:17,313 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
882s Verified using v1 scheme (JAR signing): true
882s Verified using v2 scheme (APK Signature Scheme v2): false
882s Verified using v3 scheme (APK Signature Scheme v3): false
882s Verified using v4 scheme (APK Signature Scheme v4): false
882s Verified for SourceStamp: false
882s Number of signers: 1
882s 
882s 2024-03-26 05:44:17,313 DEBUG: Density 120 not available, resizing down from 160
882s 2024-03-26 05:44:17,315 DEBUG: Processing obb.main.twoversions_1101615.apk
882s 2024-03-26 05:44:17,315 INFO: Starting analysis on AndroidManifest.xml
882s 2024-03-26 05:44:17,317 INFO: APK file was successfully validated!
882s 2024-03-26 05:44:17,318 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
882s 2024-03-26 05:44:17,588 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
882s Verified using v1 scheme (JAR signing): true
882s Verified using v2 scheme (APK Signature Scheme v2): false
882s Verified using v3 scheme (APK Signature Scheme v3): false
882s Verified using v4 scheme (APK Signature Scheme v4): false
882s Verified for SourceStamp: false
882s Number of signers: 1
882s 
882s 2024-03-26 05:44:17,588 DEBUG: Density 120 not available, resizing down from 160
882s 2024-03-26 05:44:17,590 DEBUG: Processing obb.main.twoversions_1101617.apk
882s 2024-03-26 05:44:17,590 INFO: Starting analysis on AndroidManifest.xml
882s 2024-03-26 05:44:17,591 INFO: APK file was successfully validated!
882s 2024-03-26 05:44:17,593 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
883s 2024-03-26 05:44:17,984 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
883s Verified using v1 scheme (JAR signing): true
883s Verified using v2 scheme (APK Signature Scheme v2): false
883s Verified using v3 scheme (APK Signature Scheme v3): false
883s Verified using v4 scheme (APK Signature Scheme v4): false
883s Verified for SourceStamp: false
883s Number of signers: 1
883s 
883s 2024-03-26 05:44:17,989 DEBUG: Density 120 not available, resizing down from 160
883s 2024-03-26 05:44:17,991 DEBUG: Processing obb.mainpatch.current_1619.apk
883s 2024-03-26 05:44:17,991 INFO: Starting analysis on AndroidManifest.xml
883s 2024-03-26 05:44:17,993 INFO: APK file was successfully validated!
883s 2024-03-26 05:44:17,994 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
883s 2024-03-26 05:44:18,271 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
883s Verified using v1 scheme (JAR signing): true
883s Verified using v2 scheme (APK Signature Scheme v2): false
883s Verified using v3 scheme (APK Signature Scheme v3): false
883s Verified using v4 scheme (APK Signature Scheme v4): false
883s Verified for SourceStamp: false
883s Number of signers: 1
883s 
883s 2024-03-26 05:44:18,271 DEBUG: Density 120 not available, resizing down from 160
883s 2024-03-26 05:44:18,273 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk
883s 2024-03-26 05:44:18,273 INFO: Starting analysis on AndroidManifest.xml
883s 2024-03-26 05:44:18,274 INFO: APK file was successfully validated!
883s 2024-03-26 05:44:18,276 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk
883s 2024-03-26 05:44:18,539 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies
883s Verified using v1 scheme (JAR signing): true
883s Verified using v2 scheme (APK Signature Scheme v2): false
883s Verified using v3 scheme (APK Signature Scheme v3): false
883s Verified using v4 scheme (APK Signature Scheme v4): false
883s Verified for SourceStamp: false
883s Number of signers: 1
883s 
883s 2024-03-26 05:44:18,539 DEBUG: Density 120 not available, resizing down from 160
883s 2024-03-26 05:44:18,541 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk
883s 2024-03-26 05:44:18,541 INFO: Starting analysis on AndroidManifest.xml
883s 2024-03-26 05:44:18,542 INFO: APK file was successfully validated!
883s 2024-03-26 05:44:18,543 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk
883s 2024-03-26 05:44:18,795 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies
883s Verified using v1 scheme (JAR signing): true
883s Verified using v2 scheme (APK Signature Scheme v2): false
883s Verified using v3 scheme (APK Signature Scheme v3): false
883s Verified using v4 scheme (APK Signature Scheme v4): false
883s Verified for SourceStamp: false
883s Number of signers: 1
883s 
883s 2024-03-26 05:44:18,795 DEBUG: Density 120 not available, resizing down from 160
883s 2024-03-26 05:44:18,797 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk
883s 2024-03-26 05:44:18,797 INFO: Starting analysis on AndroidManifest.xml
883s 2024-03-26 05:44:18,798 INFO: APK file was successfully validated!
883s 2024-03-26 05:44:18,799 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk
884s 2024-03-26 05:44:19,053 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies
884s Verified using v1 scheme (JAR signing): true
884s Verified using v2 scheme (APK Signature Scheme v2): false
884s Verified using v3 scheme (APK Signature Scheme v3): false
884s Verified using v4 scheme (APK Signature Scheme v4): false
884s Verified for SourceStamp: false
884s Number of signers: 1
884s 
884s 2024-03-26 05:44:19,054 DEBUG: Density 120 not available, resizing down from 160
884s 2024-03-26 05:44:19,055 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk
884s 2024-03-26 05:44:19,055 INFO: Starting analysis on AndroidManifest.xml
884s 2024-03-26 05:44:19,056 INFO: APK file was successfully validated!
884s 2024-03-26 05:44:19,057 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk
884s 2024-03-26 05:44:19,339 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies
884s Verified using v1 scheme (JAR signing): true
884s Verified using v2 scheme (APK Signature Scheme v2): false
884s Verified using v3 scheme (APK Signature Scheme v3): false
884s Verified using v4 scheme (APK Signature Scheme v4): false
884s Verified for SourceStamp: false
884s Number of signers: 1
884s 
884s 2024-03-26 05:44:19,340 DEBUG: Density 120 not available, resizing down from 160
884s 2024-03-26 05:44:19,341 DEBUG: Processing org.dyndns.fules.ck_20.apk
884s 2024-03-26 05:44:19,342 INFO: Starting analysis on AndroidManifest.xml
884s 2024-03-26 05:44:19,343 INFO: APK file was successfully validated!
884s 2024-03-26 05:44:19,345 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk
884s 2024-03-26 05:44:19,635 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies
884s Verified using v1 scheme (JAR signing): true
884s Verified using v2 scheme (APK Signature Scheme v2): false
884s Verified using v3 scheme (APK Signature Scheme v3): false
884s Verified using v4 scheme (APK Signature Scheme v4): false
884s Verified for SourceStamp: false
884s Number of signers: 1
884s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
884s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
884s 
884s 2024-03-26 05:44:19,637 DEBUG: Processing souch.smsbypass_9.apk
884s 2024-03-26 05:44:19,637 INFO: Starting analysis on AndroidManifest.xml
884s 2024-03-26 05:44:19,638 INFO: APK file was successfully validated!
884s 2024-03-26 05:44:19,641 DEBUG: Getting signature of souch.smsbypass_9.apk
884s 2024-03-26 05:44:19,923 DEBUG: repo/souch.smsbypass_9.apk: Verifies
884s Verified using v1 scheme (JAR signing): true
884s Verified using v2 scheme (APK Signature Scheme v2): false
884s Verified using v3 scheme (APK Signature Scheme v3): false
884s Verified using v4 scheme (APK Signature Scheme v4): false
884s Verified for SourceStamp: false
884s Number of signers: 1
884s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
884s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
884s 
884s 2024-03-26 05:44:19,924 DEBUG: Density 120 not available, resizing down from 160
884s 2024-03-26 05:44:19,926 DEBUG: Processing v1.v2.sig_1020.apk
884s 2024-03-26 05:44:19,926 INFO: Starting analysis on AndroidManifest.xml
884s 2024-03-26 05:44:19,927 INFO: APK file was successfully validated!
884s 2024-03-26 05:44:19,929 DEBUG: Getting signature of v1.v2.sig_1020.apk
885s 2024-03-26 05:44:20,415 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
885s Verified using v1 scheme (JAR signing): true
885s Verified using v2 scheme (APK Signature Scheme v2): true
885s Verified using v3 scheme (APK Signature Scheme v3): false
885s Verified using v4 scheme (APK Signature Scheme v4): false
885s Verified for SourceStamp: false
885s Number of signers: 1
885s 
885s 2024-03-26 05:44:20,415 DEBUG: Density 120 not available, resizing down from 160
885s 2024-03-26 05:44:20,426 DEBUG: Processing v2.only.sig_2.apk
885s 2024-03-26 05:44:20,426 INFO: Starting analysis on AndroidManifest.xml
885s 2024-03-26 05:44:20,441 INFO: APK file was successfully validated!
885s 2024-03-26 05:44:20,442 DEBUG: Getting signature of v2.only.sig_2.apk
885s 2024-03-26 05:44:20,442 INFO: Starting analysis on AndroidManifest.xml
885s 2024-03-26 05:44:20,444 INFO: APK file was successfully validated!
885s 2024-03-26 05:44:20,445 DEBUG: Using APK Signature v2
885s 2024-03-26 05:44:20,445 INFO: Starting analysis on AndroidManifest.xml
885s 2024-03-26 05:44:20,446 INFO: APK file was successfully validated!
885s 2024-03-26 05:44:20,447 DEBUG: Using APK Signature v2
885s 2024-03-26 05:44:20,697 DEBUG: repo/v2.only.sig_2.apk: Verifies
885s Verified using v1 scheme (JAR signing): false
885s Verified using v2 scheme (APK Signature Scheme v2): true
885s Verified using v3 scheme (APK Signature Scheme v3): false
885s Verified using v4 scheme (APK Signature Scheme v4): false
885s Verified for SourceStamp: false
885s Number of signers: 1
885s 
885s 2024-03-26 05:44:20,698 DEBUG: Density 120 not available, resizing down from 160
885s 2024-03-26 05:44:20,700 INFO: Generated skeleton metadata for SpeedoMeterApp.main
885s 2024-03-26 05:44:20,711 INFO: Generated skeleton metadata for apk.embedded
885s 2024-03-26 05:44:20,713 INFO: Generated skeleton metadata for com.example.test.helloworld
885s 2024-03-26 05:44:20,715 INFO: Generated skeleton metadata for com.politedroid
885s 2024-03-26 05:44:20,717 INFO: Generated skeleton metadata for duplicate.permisssions
885s 2024-03-26 05:44:20,720 INFO: Generated skeleton metadata for info.guardianproject.urzip
885s 2024-03-26 05:44:20,723 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile
885s 2024-03-26 05:44:20,726 INFO: Generated skeleton metadata for no.min.target.sdk
885s 2024-03-26 05:44:20,730 INFO: Generated skeleton metadata for obb.main.oldversion
885s 2024-03-26 05:44:20,735 INFO: Generated skeleton metadata for obb.main.twoversions
885s 2024-03-26 05:44:20,740 INFO: Generated skeleton metadata for obb.mainpatch.current
885s 2024-03-26 05:44:20,745 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror
885s 2024-03-26 05:44:20,751 INFO: Generated skeleton metadata for org.dyndns.fules.ck
885s 2024-03-26 05:44:20,756 INFO: Generated skeleton metadata for souch.smsbypass
885s 2024-03-26 05:44:20,763 INFO: Generated skeleton metadata for v1.v2.sig
885s 2024-03-26 05:44:20,769 INFO: Generated skeleton metadata for v2.only.sig
885s 2024-03-26 05:44:20,779 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
886s 2024-03-26 05:44:21,587 INFO: Creating signed index with this key (SHA256):
886s 2024-03-26 05:44:21,588 INFO: D2 AA FE 96 5D 3C 6A 05 E7 91 5A 32 E1 B1 BF CA 2D 06 1B EA 58 BC 2D 75 92 8B 1F 08 BD A9 3A 9F
886s 2024-03-26 05:44:21,588 DEBUG: Directory: repo
886s 2024-03-26 05:44:21,588 DEBUG: > jar cf index.jar index.xml
886s 2024-03-26 05:44:21,789 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
887s jar signed.
887s 
887s Warning: 
887s The signer's certificate is self-signed.
887s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
887s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
887s 2024-03-26 05:44:22,894 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
887s 2024-03-26 05:44:22,903 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
888s jar signed.
888s 
888s Warning: 
888s The signer's certificate is self-signed.
888s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
888s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
888s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
888s 2024-03-26 05:44:23,919 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar
889s 2024-03-26 05:44:24,738 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Bx4S/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
890s 2024-03-26 05:44:25,576 DEBUG: Outputting JSON
890s 2024-03-26 05:44:25,577 DEBUG: skip deploying full build logs: not enabled in config
890s 2024-03-26 05:44:25,577 DEBUG: skip deploying full build logs: not enabled in config
890s 2024-03-26 05:44:25,577 DEBUG: skip deploying full build logs: not enabled in config
890s 2024-03-26 05:44:25,577 INFO: Finished
890s + /usr/bin/fdroid readmeta
891s + test -e repo/index.xml
891s + test -e repo/index.jar
891s + test -e repo/index-v1.jar
891s + test -e tmp/apkcache.json
891s + test -z tmp/apkcache.json
891s + grep -F '<application id=' repo/index.xml
891s + echo_header 'setup a new repo manually and generate a keystore'
891s ==============================================================================
891s setup a new repo manually and generate a keystore
891s ++ create_test_dir
891s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
891s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
891s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.0Nd9
891s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.0Nd9/keystore.p12
891s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.0Nd9
891s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.0Nd9/keystore.p12
891s + set +e
891s + /usr/bin/fdroid update
891s 2024-03-26 05:44:26,732 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
891s 2024-03-26 05:44:26,734 CRITICAL: 'repo_keyalias' not found in config.yml!
891s 2024-03-26 05:44:26,734 CRITICAL: 'keystore.p12' does not exist!
891s 2024-03-26 05:44:26,734 CRITICAL: 'keystorepass' not found in config.yml!
891s 2024-03-26 05:44:26,734 CRITICAL: 'keypass' not found in config.yml!
891s 2024-03-26 05:44:26,734 CRITICAL: This command requires a signing key, you can create one using: fdroid update --create-key
891s + '[' 1 -eq 0 ']'
891s + echo '`fdroid update` prompted to add keystore'
891s `fdroid update` prompted to add keystore
891s + set -e
891s + /usr/bin/fdroid update --create-key
892s 2024-03-26 05:44:27,173 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
892s 2024-03-26 05:44:27,182 INFO: Creating empty config.yml
892s 2024-03-26 05:44:27,184 INFO: Generating a new key in "keystore.p12"...
895s 2024-03-26 05:44:30,674 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
895s Creation date: Mar 26, 2024
895s Entry type: PrivateKeyEntry
895s Certificate chain length: 1
895s Certificate[1]:
895s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
895s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
895s Serial number: 15e57f4fa6edc8ea
895s Valid from: Tue Mar 26 05:44:29 UTC 2024 until: Sat Aug 12 05:44:29 UTC 2051
895s Certificate fingerprints:
895s 	 SHA1: 70:D1:E7:36:EF:CA:EC:8D:F5:8E:C7:5D:91:20:CA:A6:C5:70:5C:6D
895s 	 SHA256: 54:43:F8:DB:76:DE:D6:D9:0B:DD:C4:11:61:87:0C:1B:89:11:03:4A:8F:4B:88:75:35:DF:DD:7E:E7:34:B8:3D
895s Signature algorithm name: SHA256withRSA
895s Subject Public Key Algorithm: 4096-bit RSA key
895s Version: 3
895s 
895s Extensions: 
895s 
895s #1: ObjectId: 2.5.29.14 Criticality=false
895s SubjectKeyIdentifier [
895s KeyIdentifier [
895s 0000: AC 0A D4 C7 3A FA FD 64   88 B2 7A 2E BB 05 D4 38  ....:..d..z....8
895s 0010: 58 C3 D4 70                                        X..p
895s ]
895s ]
895s 
895s 
897s 2024-03-26 05:44:32,011 INFO: Creating signed index with this key (SHA256):
897s 2024-03-26 05:44:32,011 INFO: 54 43 F8 DB 76 DE D6 D9 0B DD C4 11 61 87 0C 1B 89 11 03 4A 8F 4B 88 75 35 DF DD 7E E7 34 B8 3D
898s 2024-03-26 05:44:33,217 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
900s 2024-03-26 05:44:35,568 INFO: Finished
900s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.0Nd9/keystore.p12
900s + copy_apks_into_repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.0Nd9
900s + set +x
900s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk
900s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk
900s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
901s Requested API level 30 is larger than maximum we have, returning API level 28 instead.
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk
901s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk --> repo/obb.mainpatch.current_1619.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk
902s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk
903s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk
904s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk
905s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk
905s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk
905s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk
905s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk
905s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk
905s + /usr/bin/fdroid update --create-metadata --verbose
906s 2024-03-26 05:44:41,030 DEBUG: Reading 'config.yml'
906s 2024-03-26 05:44:41,031 WARNING: unsafe permissions on 'config.yml' (should be 0600)!
906s 2024-03-26 05:44:41,033 DEBUG: ipfs_cid not found, skipping CIDv1 generation
906s 2024-03-26 05:44:41,034 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
906s 2024-03-26 05:44:41,034 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
906s 2024-03-26 05:44:41,035 DEBUG: Processing SpeedoMeterApp.main_1.apk
906s 2024-03-26 05:44:41,122 INFO: Starting analysis on AndroidManifest.xml
906s 2024-03-26 05:44:41,131 INFO: APK file was successfully validated!
906s 2024-03-26 05:44:41,133 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk
906s 2024-03-26 05:44:41,139 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3).
906s 2024-03-26 05:44:41,462 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies
906s Verified using v1 scheme (JAR signing): true
906s Verified using v2 scheme (APK Signature Scheme v2): false
906s Verified using v3 scheme (APK Signature Scheme v3): false
906s Verified using v4 scheme (APK Signature Scheme v4): false
906s Verified for SourceStamp: false
906s Number of signers: 1
906s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
906s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
906s 
906s 2024-03-26 05:44:41,463 DEBUG: Processing apk.embedded_1.apk
906s 2024-03-26 05:44:41,463 INFO: Starting analysis on AndroidManifest.xml
906s 2024-03-26 05:44:41,464 INFO: APK file was successfully validated!
906s 2024-03-26 05:44:41,466 DEBUG: Getting signature of apk.embedded_1.apk
906s 2024-03-26 05:44:41,783 DEBUG: repo/apk.embedded_1.apk: Verifies
906s Verified using v1 scheme (JAR signing): true
906s Verified using v2 scheme (APK Signature Scheme v2): true
906s Verified using v3 scheme (APK Signature Scheme v3): true
906s Verified using v4 scheme (APK Signature Scheme v4): false
906s Verified for SourceStamp: false
906s Number of signers: 1
906s 
906s 2024-03-26 05:44:41,784 DEBUG: Processing com.example.test.helloworld_1.apk
906s 2024-03-26 05:44:41,784 INFO: Starting analysis on AndroidManifest.xml
906s 2024-03-26 05:44:41,785 INFO: APK file was successfully validated!
906s 2024-03-26 05:44:41,787 DEBUG: Getting signature of com.example.test.helloworld_1.apk
907s 2024-03-26 05:44:42,068 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
907s Verified using v1 scheme (JAR signing): true
907s Verified using v2 scheme (APK Signature Scheme v2): false
907s Verified using v3 scheme (APK Signature Scheme v3): false
907s Verified using v4 scheme (APK Signature Scheme v4): false
907s Verified for SourceStamp: false
907s Number of signers: 1
907s 
907s 2024-03-26 05:44:42,068 DEBUG: Processing com.politedroid_3.apk
907s 2024-03-26 05:44:42,069 INFO: Starting analysis on AndroidManifest.xml
907s 2024-03-26 05:44:42,069 INFO: APK file was successfully validated!
907s 2024-03-26 05:44:42,071 DEBUG: Getting signature of com.politedroid_3.apk
907s 2024-03-26 05:44:42,477 DEBUG: repo/com.politedroid_3.apk: Verifies
907s Verified using v1 scheme (JAR signing): true
907s Verified using v2 scheme (APK Signature Scheme v2): false
907s Verified using v3 scheme (APK Signature Scheme v3): false
907s Verified using v4 scheme (APK Signature Scheme v4): false
907s Verified for SourceStamp: false
907s Number of signers: 1
907s 
907s 2024-03-26 05:44:42,486 DEBUG: Processing com.politedroid_4.apk
907s 2024-03-26 05:44:42,486 INFO: Starting analysis on AndroidManifest.xml
907s 2024-03-26 05:44:42,487 INFO: APK file was successfully validated!
907s 2024-03-26 05:44:42,494 DEBUG: Getting signature of com.politedroid_4.apk
907s 2024-03-26 05:44:42,830 DEBUG: repo/com.politedroid_4.apk: Verifies
907s Verified using v1 scheme (JAR signing): true
907s Verified using v2 scheme (APK Signature Scheme v2): false
907s Verified using v3 scheme (APK Signature Scheme v3): false
907s Verified using v4 scheme (APK Signature Scheme v4): false
907s Verified for SourceStamp: false
907s Number of signers: 1
907s 
907s 2024-03-26 05:44:42,832 DEBUG: Processing com.politedroid_5.apk
907s 2024-03-26 05:44:42,832 INFO: Starting analysis on AndroidManifest.xml
907s 2024-03-26 05:44:42,833 INFO: APK file was successfully validated!
907s 2024-03-26 05:44:42,834 DEBUG: Getting signature of com.politedroid_5.apk
908s 2024-03-26 05:44:43,142 DEBUG: repo/com.politedroid_5.apk: Verifies
908s Verified using v1 scheme (JAR signing): true
908s Verified using v2 scheme (APK Signature Scheme v2): false
908s Verified using v3 scheme (APK Signature Scheme v3): false
908s Verified using v4 scheme (APK Signature Scheme v4): false
908s Verified for SourceStamp: false
908s Number of signers: 1
908s 
908s 2024-03-26 05:44:43,144 DEBUG: Processing com.politedroid_6.apk
908s 2024-03-26 05:44:43,145 INFO: Starting analysis on AndroidManifest.xml
908s 2024-03-26 05:44:43,146 INFO: APK file was successfully validated!
908s 2024-03-26 05:44:43,148 DEBUG: Getting signature of com.politedroid_6.apk
908s 2024-03-26 05:44:43,449 DEBUG: repo/com.politedroid_6.apk: Verifies
908s Verified using v1 scheme (JAR signing): true
908s Verified using v2 scheme (APK Signature Scheme v2): false
908s Verified using v3 scheme (APK Signature Scheme v3): false
908s Verified using v4 scheme (APK Signature Scheme v4): false
908s Verified for SourceStamp: false
908s Number of signers: 1
908s 
908s 2024-03-26 05:44:43,451 DEBUG: Processing duplicate.permisssions_9999999.apk
908s 2024-03-26 05:44:43,452 INFO: Starting analysis on AndroidManifest.xml
908s 2024-03-26 05:44:43,453 INFO: APK file was successfully validated!
908s 2024-03-26 05:44:43,455 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
908s 2024-03-26 05:44:43,462 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
909s 2024-03-26 05:44:44,065 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
909s Verified using v1 scheme (JAR signing): true
909s Verified using v2 scheme (APK Signature Scheme v2): true
909s Verified using v3 scheme (APK Signature Scheme v3): false
909s Verified using v4 scheme (APK Signature Scheme v4): false
909s Verified for SourceStamp: false
909s Number of signers: 1
909s 
909s 2024-03-26 05:44:44,066 DEBUG: Density 120 not available, resizing down from 160
909s 2024-03-26 05:44:44,073 DEBUG: Processing info.guardianproject.urzip_100.apk
909s 2024-03-26 05:44:44,073 INFO: Starting analysis on AndroidManifest.xml
909s 2024-03-26 05:44:44,088 INFO: APK file was successfully validated!
909s 2024-03-26 05:44:44,090 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
909s 2024-03-26 05:44:44,379 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
909s Verified using v1 scheme (JAR signing): true
909s Verified using v2 scheme (APK Signature Scheme v2): false
909s Verified using v3 scheme (APK Signature Scheme v3): false
909s Verified using v4 scheme (APK Signature Scheme v4): false
909s Verified for SourceStamp: false
909s Number of signers: 1
909s 
909s 2024-03-26 05:44:44,379 DEBUG: Density 120 not available, resizing down from 160
909s 2024-03-26 05:44:44,381 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
909s 2024-03-26 05:44:44,381 INFO: Starting analysis on AndroidManifest.xml
909s 2024-03-26 05:44:44,382 INFO: APK file was successfully validated!
909s 2024-03-26 05:44:44,384 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
909s 2024-03-26 05:44:44,669 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
909s Verified using v1 scheme (JAR signing): true
909s Verified using v2 scheme (APK Signature Scheme v2): false
909s Verified using v3 scheme (APK Signature Scheme v3): false
909s Verified using v4 scheme (APK Signature Scheme v4): false
909s Verified for SourceStamp: false
909s Number of signers: 1
909s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
909s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
909s 
909s 2024-03-26 05:44:44,670 DEBUG: Processing no.min.target.sdk_987.apk
909s 2024-03-26 05:44:44,670 INFO: Starting analysis on AndroidManifest.xml
909s 2024-03-26 05:44:44,671 INFO: APK file was successfully validated!
909s 2024-03-26 05:44:44,673 DEBUG: Getting signature of no.min.target.sdk_987.apk
909s 2024-03-26 05:44:44,681 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
909s 2024-03-26 05:44:44,969 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
909s Verified using v1 scheme (JAR signing): true
909s Verified using v2 scheme (APK Signature Scheme v2): true
909s Verified using v3 scheme (APK Signature Scheme v3): false
909s Verified using v4 scheme (APK Signature Scheme v4): false
909s Verified for SourceStamp: false
909s Number of signers: 1
909s 
909s 2024-03-26 05:44:44,970 DEBUG: Density 120 not available, resizing down from 160
909s 2024-03-26 05:44:44,972 DEBUG: Processing obb.main.oldversion_1444412523.apk
909s 2024-03-26 05:44:44,972 INFO: Starting analysis on AndroidManifest.xml
910s 2024-03-26 05:44:44,974 INFO: APK file was successfully validated!
910s 2024-03-26 05:44:44,976 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
910s 2024-03-26 05:44:45,242 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
910s Verified using v1 scheme (JAR signing): true
910s Verified using v2 scheme (APK Signature Scheme v2): true
910s Verified using v3 scheme (APK Signature Scheme v3): false
910s Verified using v4 scheme (APK Signature Scheme v4): false
910s Verified for SourceStamp: false
910s Number of signers: 1
910s 
910s 2024-03-26 05:44:45,243 DEBUG: Density 120 not available, resizing down from 160
910s 2024-03-26 05:44:45,244 DEBUG: Processing obb.main.twoversions_1101613.apk
910s 2024-03-26 05:44:45,245 INFO: Starting analysis on AndroidManifest.xml
910s 2024-03-26 05:44:45,246 INFO: APK file was successfully validated!
910s 2024-03-26 05:44:45,248 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
910s 2024-03-26 05:44:45,526 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
910s Verified using v1 scheme (JAR signing): true
910s Verified using v2 scheme (APK Signature Scheme v2): false
910s Verified using v3 scheme (APK Signature Scheme v3): false
910s Verified using v4 scheme (APK Signature Scheme v4): false
910s Verified for SourceStamp: false
910s Number of signers: 1
910s 
910s 2024-03-26 05:44:45,527 DEBUG: Density 120 not available, resizing down from 160
910s 2024-03-26 05:44:45,529 DEBUG: Processing obb.main.twoversions_1101615.apk
910s 2024-03-26 05:44:45,529 INFO: Starting analysis on AndroidManifest.xml
910s 2024-03-26 05:44:45,530 INFO: APK file was successfully validated!
910s 2024-03-26 05:44:45,532 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
910s 2024-03-26 05:44:45,964 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
910s Verified using v1 scheme (JAR signing): true
910s Verified using v2 scheme (APK Signature Scheme v2): false
910s Verified using v3 scheme (APK Signature Scheme v3): false
910s Verified using v4 scheme (APK Signature Scheme v4): false
910s Verified for SourceStamp: false
910s Number of signers: 1
910s 
910s 2024-03-26 05:44:45,965 DEBUG: Density 120 not available, resizing down from 160
910s 2024-03-26 05:44:45,966 DEBUG: Processing obb.main.twoversions_1101617.apk
910s 2024-03-26 05:44:45,967 INFO: Starting analysis on AndroidManifest.xml
910s 2024-03-26 05:44:45,968 INFO: APK file was successfully validated!
910s 2024-03-26 05:44:45,970 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
911s 2024-03-26 05:44:46,280 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
911s Verified using v1 scheme (JAR signing): true
911s Verified using v2 scheme (APK Signature Scheme v2): false
911s Verified using v3 scheme (APK Signature Scheme v3): false
911s Verified using v4 scheme (APK Signature Scheme v4): false
911s Verified for SourceStamp: false
911s Number of signers: 1
911s 
911s 2024-03-26 05:44:46,280 DEBUG: Density 120 not available, resizing down from 160
911s 2024-03-26 05:44:46,282 DEBUG: Processing obb.mainpatch.current_1619.apk
911s 2024-03-26 05:44:46,282 INFO: Starting analysis on AndroidManifest.xml
911s 2024-03-26 05:44:46,283 INFO: APK file was successfully validated!
911s 2024-03-26 05:44:46,285 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
911s 2024-03-26 05:44:46,554 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
911s Verified using v1 scheme (JAR signing): true
911s Verified using v2 scheme (APK Signature Scheme v2): false
911s Verified using v3 scheme (APK Signature Scheme v3): false
911s Verified using v4 scheme (APK Signature Scheme v4): false
911s Verified for SourceStamp: false
911s Number of signers: 1
911s 
911s 2024-03-26 05:44:46,555 DEBUG: Density 120 not available, resizing down from 160
911s 2024-03-26 05:44:46,556 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk
911s 2024-03-26 05:44:46,557 INFO: Starting analysis on AndroidManifest.xml
911s 2024-03-26 05:44:46,557 INFO: APK file was successfully validated!
911s 2024-03-26 05:44:46,559 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk
911s 2024-03-26 05:44:46,814 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies
911s Verified using v1 scheme (JAR signing): true
911s Verified using v2 scheme (APK Signature Scheme v2): false
911s Verified using v3 scheme (APK Signature Scheme v3): false
911s Verified using v4 scheme (APK Signature Scheme v4): false
911s Verified for SourceStamp: false
911s Number of signers: 1
911s 
911s 2024-03-26 05:44:46,815 DEBUG: Density 120 not available, resizing down from 160
911s 2024-03-26 05:44:46,817 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk
911s 2024-03-26 05:44:46,817 INFO: Starting analysis on AndroidManifest.xml
911s 2024-03-26 05:44:46,818 INFO: APK file was successfully validated!
911s 2024-03-26 05:44:46,820 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk
912s 2024-03-26 05:44:47,107 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies
912s Verified using v1 scheme (JAR signing): true
912s Verified using v2 scheme (APK Signature Scheme v2): false
912s Verified using v3 scheme (APK Signature Scheme v3): false
912s Verified using v4 scheme (APK Signature Scheme v4): false
912s Verified for SourceStamp: false
912s Number of signers: 1
912s 
912s 2024-03-26 05:44:47,107 DEBUG: Density 120 not available, resizing down from 160
912s 2024-03-26 05:44:47,109 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk
912s 2024-03-26 05:44:47,109 INFO: Starting analysis on AndroidManifest.xml
912s 2024-03-26 05:44:47,110 INFO: APK file was successfully validated!
912s 2024-03-26 05:44:47,111 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk
912s 2024-03-26 05:44:47,393 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies
912s Verified using v1 scheme (JAR signing): true
912s Verified using v2 scheme (APK Signature Scheme v2): false
912s Verified using v3 scheme (APK Signature Scheme v3): false
912s Verified using v4 scheme (APK Signature Scheme v4): false
912s Verified for SourceStamp: false
912s Number of signers: 1
912s 
912s 2024-03-26 05:44:47,394 DEBUG: Density 120 not available, resizing down from 160
912s 2024-03-26 05:44:47,395 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk
912s 2024-03-26 05:44:47,395 INFO: Starting analysis on AndroidManifest.xml
912s 2024-03-26 05:44:47,396 INFO: APK file was successfully validated!
912s 2024-03-26 05:44:47,397 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk
912s 2024-03-26 05:44:47,638 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies
912s Verified using v1 scheme (JAR signing): true
912s Verified using v2 scheme (APK Signature Scheme v2): false
912s Verified using v3 scheme (APK Signature Scheme v3): false
912s Verified using v4 scheme (APK Signature Scheme v4): false
912s Verified for SourceStamp: false
912s Number of signers: 1
912s 
912s 2024-03-26 05:44:47,638 DEBUG: Density 120 not available, resizing down from 160
912s 2024-03-26 05:44:47,640 DEBUG: Processing org.dyndns.fules.ck_20.apk
912s 2024-03-26 05:44:47,640 INFO: Starting analysis on AndroidManifest.xml
912s 2024-03-26 05:44:47,641 INFO: APK file was successfully validated!
912s 2024-03-26 05:44:47,644 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk
912s 2024-03-26 05:44:47,915 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies
912s Verified using v1 scheme (JAR signing): true
912s Verified using v2 scheme (APK Signature Scheme v2): false
912s Verified using v3 scheme (APK Signature Scheme v3): false
912s Verified using v4 scheme (APK Signature Scheme v4): false
912s Verified for SourceStamp: false
912s Number of signers: 1
912s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
912s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
912s 
912s 2024-03-26 05:44:47,917 DEBUG: Processing souch.smsbypass_9.apk
912s 2024-03-26 05:44:47,917 INFO: Starting analysis on AndroidManifest.xml
912s 2024-03-26 05:44:47,918 INFO: APK file was successfully validated!
912s 2024-03-26 05:44:47,921 DEBUG: Getting signature of souch.smsbypass_9.apk
913s 2024-03-26 05:44:48,203 DEBUG: repo/souch.smsbypass_9.apk: Verifies
913s Verified using v1 scheme (JAR signing): true
913s Verified using v2 scheme (APK Signature Scheme v2): false
913s Verified using v3 scheme (APK Signature Scheme v3): false
913s Verified using v4 scheme (APK Signature Scheme v4): false
913s Verified for SourceStamp: false
913s Number of signers: 1
913s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
913s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
913s 
913s 2024-03-26 05:44:48,204 DEBUG: Density 120 not available, resizing down from 160
913s 2024-03-26 05:44:48,206 DEBUG: Processing v1.v2.sig_1020.apk
913s 2024-03-26 05:44:48,206 INFO: Starting analysis on AndroidManifest.xml
913s 2024-03-26 05:44:48,208 INFO: APK file was successfully validated!
913s 2024-03-26 05:44:48,209 DEBUG: Getting signature of v1.v2.sig_1020.apk
913s 2024-03-26 05:44:48,474 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
913s Verified using v1 scheme (JAR signing): true
913s Verified using v2 scheme (APK Signature Scheme v2): true
913s Verified using v3 scheme (APK Signature Scheme v3): false
913s Verified using v4 scheme (APK Signature Scheme v4): false
913s Verified for SourceStamp: false
913s Number of signers: 1
913s 
913s 2024-03-26 05:44:48,474 DEBUG: Density 120 not available, resizing down from 160
913s 2024-03-26 05:44:48,476 DEBUG: Processing v2.only.sig_2.apk
913s 2024-03-26 05:44:48,476 INFO: Starting analysis on AndroidManifest.xml
913s 2024-03-26 05:44:48,477 INFO: APK file was successfully validated!
913s 2024-03-26 05:44:48,479 DEBUG: Getting signature of v2.only.sig_2.apk
913s 2024-03-26 05:44:48,479 INFO: Starting analysis on AndroidManifest.xml
913s 2024-03-26 05:44:48,480 INFO: APK file was successfully validated!
913s 2024-03-26 05:44:48,481 DEBUG: Using APK Signature v2
913s 2024-03-26 05:44:48,481 INFO: Starting analysis on AndroidManifest.xml
913s 2024-03-26 05:44:48,482 INFO: APK file was successfully validated!
913s 2024-03-26 05:44:48,483 DEBUG: Using APK Signature v2
913s 2024-03-26 05:44:48,717 DEBUG: repo/v2.only.sig_2.apk: Verifies
913s Verified using v1 scheme (JAR signing): false
913s Verified using v2 scheme (APK Signature Scheme v2): true
913s Verified using v3 scheme (APK Signature Scheme v3): false
913s Verified using v4 scheme (APK Signature Scheme v4): false
913s Verified for SourceStamp: false
913s Number of signers: 1
913s 
913s 2024-03-26 05:44:48,717 DEBUG: Density 120 not available, resizing down from 160
913s 2024-03-26 05:44:48,720 INFO: Generated skeleton metadata for SpeedoMeterApp.main
913s 2024-03-26 05:44:48,722 INFO: Generated skeleton metadata for apk.embedded
913s 2024-03-26 05:44:48,723 INFO: Generated skeleton metadata for com.example.test.helloworld
913s 2024-03-26 05:44:48,725 INFO: Generated skeleton metadata for com.politedroid
913s 2024-03-26 05:44:48,728 INFO: Generated skeleton metadata for duplicate.permisssions
913s 2024-03-26 05:44:48,730 INFO: Generated skeleton metadata for info.guardianproject.urzip
913s 2024-03-26 05:44:48,734 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile
913s 2024-03-26 05:44:48,737 INFO: Generated skeleton metadata for no.min.target.sdk
913s 2024-03-26 05:44:48,741 INFO: Generated skeleton metadata for obb.main.oldversion
913s 2024-03-26 05:44:48,746 INFO: Generated skeleton metadata for obb.main.twoversions
913s 2024-03-26 05:44:48,750 INFO: Generated skeleton metadata for obb.mainpatch.current
913s 2024-03-26 05:44:48,755 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror
913s 2024-03-26 05:44:48,761 INFO: Generated skeleton metadata for org.dyndns.fules.ck
913s 2024-03-26 05:44:48,767 INFO: Generated skeleton metadata for souch.smsbypass
913s 2024-03-26 05:44:48,773 INFO: Generated skeleton metadata for v1.v2.sig
913s 2024-03-26 05:44:48,779 INFO: Generated skeleton metadata for v2.only.sig
913s 2024-03-26 05:44:48,789 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
914s 2024-03-26 05:44:49,509 INFO: Creating signed index with this key (SHA256):
914s 2024-03-26 05:44:49,509 INFO: 54 43 F8 DB 76 DE D6 D9 0B DD C4 11 61 87 0C 1B 89 11 03 4A 8F 4B 88 75 35 DF DD 7E E7 34 B8 3D
914s 2024-03-26 05:44:49,509 DEBUG: Directory: repo
914s 2024-03-26 05:44:49,509 DEBUG: > jar cf index.jar index.xml
914s 2024-03-26 05:44:49,710 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
915s jar signed.
915s 
915s Warning: 
915s The signer's certificate is self-signed.
915s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
915s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
915s 2024-03-26 05:44:50,859 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
915s 2024-03-26 05:44:50,886 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
916s jar signed.
916s 
916s Warning: 
916s The signer's certificate is self-signed.
916s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
916s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
916s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
916s 2024-03-26 05:44:51,799 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar
917s 2024-03-26 05:44:52,504 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
918s 2024-03-26 05:44:53,220 DEBUG: Outputting JSON
918s 2024-03-26 05:44:53,221 DEBUG: skip deploying full build logs: not enabled in config
918s 2024-03-26 05:44:53,221 DEBUG: skip deploying full build logs: not enabled in config
918s 2024-03-26 05:44:53,222 DEBUG: skip deploying full build logs: not enabled in config
918s 2024-03-26 05:44:53,222 INFO: Finished
918s + /usr/bin/fdroid readmeta
918s 2024-03-26 05:44:53,700 WARNING: unsafe permissions on 'config.yml' (should be 0600)!
918s + test -e repo/index.xml
918s + test -e repo/index.jar
918s + test -e repo/index-v1.jar
918s + test -e tmp/apkcache.json
918s + test -z tmp/apkcache.json
918s + grep -F '<application id=' repo/index.xml
918s + echo_header 'setup a new repo from scratch, generate a keystore, then add APK and update'
918s ==============================================================================
918s setup a new repo from scratch, generate a keystore, then add APK and update
918s ++ create_test_dir
918s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
918s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
918s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz
918s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12
918s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz
918s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12
919s 2024-03-26 05:44:54,122 INFO: "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12" does not exist, creating a new keystore there.
919s 2024-03-26 05:44:54,125 INFO: Generating a new key in "keystore.p12"...
922s 2024-03-26 05:44:57,034 INFO: Alias name: adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal
922s Creation date: Mar 26, 2024
922s Entry type: PrivateKeyEntry
922s Certificate chain length: 1
922s Certificate[1]:
922s Owner: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
922s Issuer: CN=adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal, OU=F-Droid
922s Serial number: 226564d0f20f5590
922s Valid from: Tue Mar 26 05:44:55 UTC 2024 until: Sat Aug 12 05:44:55 UTC 2051
922s Certificate fingerprints:
922s 	 SHA1: 6D:A6:94:37:6F:34:F0:95:BE:ED:CB:9C:31:7B:00:93:4A:0A:2E:24
922s 	 SHA256: 33:93:A1:1D:7F:8F:0B:9A:56:46:82:B9:43:6B:8E:C6:1B:15:D8:AD:F6:D3:A4:78:31:22:A8:F0:9C:02:62:19
922s Signature algorithm name: SHA256withRSA
922s Subject Public Key Algorithm: 4096-bit RSA key
922s Version: 3
922s 
922s Extensions: 
922s 
922s #1: ObjectId: 2.5.29.14 Criticality=false
922s SubjectKeyIdentifier [
922s KeyIdentifier [
922s 0000: 04 34 79 A5 FD 36 B2 C2   79 72 3B F8 72 44 AD 8C  .4y..6..yr;.rD..
922s 0010: D9 7A 22 C7                                        .z".
922s ]
922s ]
922s 
922s 
922s 2024-03-26 05:44:57,754 INFO: 
922s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz" with this config:
922s 
922s   Android SDK:			/usr/lib/android-sdk
922s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12
922s 
922s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/repo"
922s then run "fdroid update -c; fdroid update".  You might also want to edit
922s "config.yml" to set the URL, repo name, and more.  You should also set up
922s a signing key (a temporary one might have been automatically generated).
922s 
922s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
922s and https://f-droid.org/docs/Signing_Process
922s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12
922s + copy_apks_into_repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz
922s + set +x
922s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk
923s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk
924s Requested API level 30 is larger than maximum we have, returning API level 28 instead.
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk --> repo/obb.mainpatch.current_1619.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk
924s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk
925s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.mainpatch.current_1619.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk
926s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk
927s /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release.apk
927s + /usr/bin/fdroid update --create-metadata --verbose
928s 2024-03-26 05:45:03,133 DEBUG: Reading 'config.yml'
928s 2024-03-26 05:45:03,143 DEBUG: ipfs_cid not found, skipping CIDv1 generation
928s 2024-03-26 05:45:03,144 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
928s 2024-03-26 05:45:03,144 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
928s 2024-03-26 05:45:03,145 DEBUG: Processing SpeedoMeterApp.main_1.apk
928s 2024-03-26 05:45:03,223 INFO: Starting analysis on AndroidManifest.xml
928s 2024-03-26 05:45:03,231 INFO: APK file was successfully validated!
928s 2024-03-26 05:45:03,233 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk
928s 2024-03-26 05:45:03,238 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3).
928s 2024-03-26 05:45:03,481 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies
928s Verified using v1 scheme (JAR signing): true
928s Verified using v2 scheme (APK Signature Scheme v2): false
928s Verified using v3 scheme (APK Signature Scheme v3): false
928s Verified using v4 scheme (APK Signature Scheme v4): false
928s Verified for SourceStamp: false
928s Number of signers: 1
928s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
928s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
928s 
928s 2024-03-26 05:45:03,482 DEBUG: Processing apk.embedded_1.apk
928s 2024-03-26 05:45:03,482 INFO: Starting analysis on AndroidManifest.xml
928s 2024-03-26 05:45:03,483 INFO: APK file was successfully validated!
928s 2024-03-26 05:45:03,485 DEBUG: Getting signature of apk.embedded_1.apk
928s 2024-03-26 05:45:03,776 DEBUG: repo/apk.embedded_1.apk: Verifies
928s Verified using v1 scheme (JAR signing): true
928s Verified using v2 scheme (APK Signature Scheme v2): true
928s Verified using v3 scheme (APK Signature Scheme v3): true
928s Verified using v4 scheme (APK Signature Scheme v4): false
928s Verified for SourceStamp: false
928s Number of signers: 1
928s 
928s 2024-03-26 05:45:03,776 DEBUG: Processing com.example.test.helloworld_1.apk
928s 2024-03-26 05:45:03,776 INFO: Starting analysis on AndroidManifest.xml
928s 2024-03-26 05:45:03,777 INFO: APK file was successfully validated!
928s 2024-03-26 05:45:03,779 DEBUG: Getting signature of com.example.test.helloworld_1.apk
929s 2024-03-26 05:45:04,030 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
929s Verified using v1 scheme (JAR signing): true
929s Verified using v2 scheme (APK Signature Scheme v2): false
929s Verified using v3 scheme (APK Signature Scheme v3): false
929s Verified using v4 scheme (APK Signature Scheme v4): false
929s Verified for SourceStamp: false
929s Number of signers: 1
929s 
929s 2024-03-26 05:45:04,030 DEBUG: Processing com.politedroid_3.apk
929s 2024-03-26 05:45:04,031 INFO: Starting analysis on AndroidManifest.xml
929s 2024-03-26 05:45:04,031 INFO: APK file was successfully validated!
929s 2024-03-26 05:45:04,033 DEBUG: Getting signature of com.politedroid_3.apk
929s 2024-03-26 05:45:04,280 DEBUG: repo/com.politedroid_3.apk: Verifies
929s Verified using v1 scheme (JAR signing): true
929s Verified using v2 scheme (APK Signature Scheme v2): false
929s Verified using v3 scheme (APK Signature Scheme v3): false
929s Verified using v4 scheme (APK Signature Scheme v4): false
929s Verified for SourceStamp: false
929s Number of signers: 1
929s 
929s 2024-03-26 05:45:04,284 DEBUG: Processing com.politedroid_4.apk
929s 2024-03-26 05:45:04,284 INFO: Starting analysis on AndroidManifest.xml
929s 2024-03-26 05:45:04,285 INFO: APK file was successfully validated!
929s 2024-03-26 05:45:04,287 DEBUG: Getting signature of com.politedroid_4.apk
929s 2024-03-26 05:45:04,523 DEBUG: repo/com.politedroid_4.apk: Verifies
929s Verified using v1 scheme (JAR signing): true
929s Verified using v2 scheme (APK Signature Scheme v2): false
929s Verified using v3 scheme (APK Signature Scheme v3): false
929s Verified using v4 scheme (APK Signature Scheme v4): false
929s Verified for SourceStamp: false
929s Number of signers: 1
929s 
929s 2024-03-26 05:45:04,524 DEBUG: Processing com.politedroid_5.apk
929s 2024-03-26 05:45:04,525 INFO: Starting analysis on AndroidManifest.xml
929s 2024-03-26 05:45:04,526 INFO: APK file was successfully validated!
929s 2024-03-26 05:45:04,527 DEBUG: Getting signature of com.politedroid_5.apk
929s 2024-03-26 05:45:04,776 DEBUG: repo/com.politedroid_5.apk: Verifies
929s Verified using v1 scheme (JAR signing): true
929s Verified using v2 scheme (APK Signature Scheme v2): false
929s Verified using v3 scheme (APK Signature Scheme v3): false
929s Verified using v4 scheme (APK Signature Scheme v4): false
929s Verified for SourceStamp: false
929s Number of signers: 1
929s 
929s 2024-03-26 05:45:04,778 DEBUG: Processing com.politedroid_6.apk
929s 2024-03-26 05:45:04,778 INFO: Starting analysis on AndroidManifest.xml
929s 2024-03-26 05:45:04,779 INFO: APK file was successfully validated!
929s 2024-03-26 05:45:04,781 DEBUG: Getting signature of com.politedroid_6.apk
930s 2024-03-26 05:45:05,029 DEBUG: repo/com.politedroid_6.apk: Verifies
930s Verified using v1 scheme (JAR signing): true
930s Verified using v2 scheme (APK Signature Scheme v2): false
930s Verified using v3 scheme (APK Signature Scheme v3): false
930s Verified using v4 scheme (APK Signature Scheme v4): false
930s Verified for SourceStamp: false
930s Number of signers: 1
930s 
930s 2024-03-26 05:45:05,030 DEBUG: Processing duplicate.permisssions_9999999.apk
930s 2024-03-26 05:45:05,031 INFO: Starting analysis on AndroidManifest.xml
930s 2024-03-26 05:45:05,033 INFO: APK file was successfully validated!
930s 2024-03-26 05:45:05,035 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
930s 2024-03-26 05:45:05,041 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
930s 2024-03-26 05:45:05,280 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
930s Verified using v1 scheme (JAR signing): true
930s Verified using v2 scheme (APK Signature Scheme v2): true
930s Verified using v3 scheme (APK Signature Scheme v3): false
930s Verified using v4 scheme (APK Signature Scheme v4): false
930s Verified for SourceStamp: false
930s Number of signers: 1
930s 
930s 2024-03-26 05:45:05,281 DEBUG: Density 120 not available, resizing down from 160
930s 2024-03-26 05:45:05,282 DEBUG: Processing info.guardianproject.urzip_100.apk
930s 2024-03-26 05:45:05,283 INFO: Starting analysis on AndroidManifest.xml
930s 2024-03-26 05:45:05,284 INFO: APK file was successfully validated!
930s 2024-03-26 05:45:05,285 DEBUG: Getting signature of info.guardianproject.urzip_100.apk
930s 2024-03-26 05:45:05,540 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies
930s Verified using v1 scheme (JAR signing): true
930s Verified using v2 scheme (APK Signature Scheme v2): false
930s Verified using v3 scheme (APK Signature Scheme v3): false
930s Verified using v4 scheme (APK Signature Scheme v4): false
930s Verified for SourceStamp: false
930s Number of signers: 1
930s 
930s 2024-03-26 05:45:05,541 DEBUG: Density 120 not available, resizing down from 160
930s 2024-03-26 05:45:05,543 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
930s 2024-03-26 05:45:05,543 INFO: Starting analysis on AndroidManifest.xml
930s 2024-03-26 05:45:05,544 INFO: APK file was successfully validated!
930s 2024-03-26 05:45:05,545 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
930s 2024-03-26 05:45:05,803 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
930s Verified using v1 scheme (JAR signing): true
930s Verified using v2 scheme (APK Signature Scheme v2): false
930s Verified using v3 scheme (APK Signature Scheme v3): false
930s Verified using v4 scheme (APK Signature Scheme v4): false
930s Verified for SourceStamp: false
930s Number of signers: 1
930s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
930s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
930s 
930s 2024-03-26 05:45:05,804 DEBUG: Processing no.min.target.sdk_987.apk
930s 2024-03-26 05:45:05,804 INFO: Starting analysis on AndroidManifest.xml
930s 2024-03-26 05:45:05,805 INFO: APK file was successfully validated!
930s 2024-03-26 05:45:05,807 DEBUG: Getting signature of no.min.target.sdk_987.apk
930s 2024-03-26 05:45:05,814 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
931s 2024-03-26 05:45:06,088 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
931s Verified using v1 scheme (JAR signing): true
931s Verified using v2 scheme (APK Signature Scheme v2): true
931s Verified using v3 scheme (APK Signature Scheme v3): false
931s Verified using v4 scheme (APK Signature Scheme v4): false
931s Verified for SourceStamp: false
931s Number of signers: 1
931s 
931s 2024-03-26 05:45:06,089 DEBUG: Density 120 not available, resizing down from 160
931s 2024-03-26 05:45:06,090 DEBUG: Processing obb.main.oldversion_1444412523.apk
931s 2024-03-26 05:45:06,090 INFO: Starting analysis on AndroidManifest.xml
931s 2024-03-26 05:45:06,092 INFO: APK file was successfully validated!
931s 2024-03-26 05:45:06,094 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
931s 2024-03-26 05:45:06,364 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
931s Verified using v1 scheme (JAR signing): true
931s Verified using v2 scheme (APK Signature Scheme v2): true
931s Verified using v3 scheme (APK Signature Scheme v3): false
931s Verified using v4 scheme (APK Signature Scheme v4): false
931s Verified for SourceStamp: false
931s Number of signers: 1
931s 
931s 2024-03-26 05:45:06,365 DEBUG: Density 120 not available, resizing down from 160
931s 2024-03-26 05:45:06,366 DEBUG: Processing obb.main.twoversions_1101613.apk
931s 2024-03-26 05:45:06,367 INFO: Starting analysis on AndroidManifest.xml
931s 2024-03-26 05:45:06,368 INFO: APK file was successfully validated!
931s 2024-03-26 05:45:06,369 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
931s 2024-03-26 05:45:06,625 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
931s Verified using v1 scheme (JAR signing): true
931s Verified using v2 scheme (APK Signature Scheme v2): false
931s Verified using v3 scheme (APK Signature Scheme v3): false
931s Verified using v4 scheme (APK Signature Scheme v4): false
931s Verified for SourceStamp: false
931s Number of signers: 1
931s 
931s 2024-03-26 05:45:06,626 DEBUG: Density 120 not available, resizing down from 160
931s 2024-03-26 05:45:06,627 DEBUG: Processing obb.main.twoversions_1101615.apk
931s 2024-03-26 05:45:06,627 INFO: Starting analysis on AndroidManifest.xml
931s 2024-03-26 05:45:06,629 INFO: APK file was successfully validated!
931s 2024-03-26 05:45:06,630 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
931s 2024-03-26 05:45:06,887 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
931s Verified using v1 scheme (JAR signing): true
931s Verified using v2 scheme (APK Signature Scheme v2): false
931s Verified using v3 scheme (APK Signature Scheme v3): false
931s Verified using v4 scheme (APK Signature Scheme v4): false
931s Verified for SourceStamp: false
931s Number of signers: 1
931s 
931s 2024-03-26 05:45:06,887 DEBUG: Density 120 not available, resizing down from 160
931s 2024-03-26 05:45:06,889 DEBUG: Processing obb.main.twoversions_1101617.apk
931s 2024-03-26 05:45:06,889 INFO: Starting analysis on AndroidManifest.xml
931s 2024-03-26 05:45:06,891 INFO: APK file was successfully validated!
931s 2024-03-26 05:45:06,892 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
932s 2024-03-26 05:45:07,159 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
932s Verified using v1 scheme (JAR signing): true
932s Verified using v2 scheme (APK Signature Scheme v2): false
932s Verified using v3 scheme (APK Signature Scheme v3): false
932s Verified using v4 scheme (APK Signature Scheme v4): false
932s Verified for SourceStamp: false
932s Number of signers: 1
932s 
932s 2024-03-26 05:45:07,160 DEBUG: Density 120 not available, resizing down from 160
932s 2024-03-26 05:45:07,161 DEBUG: Processing obb.mainpatch.current_1619.apk
932s 2024-03-26 05:45:07,161 INFO: Starting analysis on AndroidManifest.xml
932s 2024-03-26 05:45:07,163 INFO: APK file was successfully validated!
932s 2024-03-26 05:45:07,164 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
932s 2024-03-26 05:45:07,407 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
932s Verified using v1 scheme (JAR signing): true
932s Verified using v2 scheme (APK Signature Scheme v2): false
932s Verified using v3 scheme (APK Signature Scheme v3): false
932s Verified using v4 scheme (APK Signature Scheme v4): false
932s Verified for SourceStamp: false
932s Number of signers: 1
932s 
932s 2024-03-26 05:45:07,407 DEBUG: Density 120 not available, resizing down from 160
932s 2024-03-26 05:45:07,409 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk
932s 2024-03-26 05:45:07,409 INFO: Starting analysis on AndroidManifest.xml
932s 2024-03-26 05:45:07,410 INFO: APK file was successfully validated!
932s 2024-03-26 05:45:07,411 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk
932s 2024-03-26 05:45:07,644 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies
932s Verified using v1 scheme (JAR signing): true
932s Verified using v2 scheme (APK Signature Scheme v2): false
932s Verified using v3 scheme (APK Signature Scheme v3): false
932s Verified using v4 scheme (APK Signature Scheme v4): false
932s Verified for SourceStamp: false
932s Number of signers: 1
932s 
932s 2024-03-26 05:45:07,645 DEBUG: Density 120 not available, resizing down from 160
932s 2024-03-26 05:45:07,646 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk
932s 2024-03-26 05:45:07,646 INFO: Starting analysis on AndroidManifest.xml
932s 2024-03-26 05:45:07,647 INFO: APK file was successfully validated!
932s 2024-03-26 05:45:07,649 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk
932s 2024-03-26 05:45:07,878 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies
932s Verified using v1 scheme (JAR signing): true
932s Verified using v2 scheme (APK Signature Scheme v2): false
932s Verified using v3 scheme (APK Signature Scheme v3): false
932s Verified using v4 scheme (APK Signature Scheme v4): false
932s Verified for SourceStamp: false
932s Number of signers: 1
932s 
932s 2024-03-26 05:45:07,879 DEBUG: Density 120 not available, resizing down from 160
932s 2024-03-26 05:45:07,881 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk
932s 2024-03-26 05:45:07,881 INFO: Starting analysis on AndroidManifest.xml
932s 2024-03-26 05:45:07,881 INFO: APK file was successfully validated!
932s 2024-03-26 05:45:07,883 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk
933s 2024-03-26 05:45:08,124 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies
933s Verified using v1 scheme (JAR signing): true
933s Verified using v2 scheme (APK Signature Scheme v2): false
933s Verified using v3 scheme (APK Signature Scheme v3): false
933s Verified using v4 scheme (APK Signature Scheme v4): false
933s Verified for SourceStamp: false
933s Number of signers: 1
933s 
933s 2024-03-26 05:45:08,125 DEBUG: Density 120 not available, resizing down from 160
933s 2024-03-26 05:45:08,127 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk
933s 2024-03-26 05:45:08,127 INFO: Starting analysis on AndroidManifest.xml
933s 2024-03-26 05:45:08,128 INFO: APK file was successfully validated!
933s 2024-03-26 05:45:08,129 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk
933s 2024-03-26 05:45:08,376 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies
933s Verified using v1 scheme (JAR signing): true
933s Verified using v2 scheme (APK Signature Scheme v2): false
933s Verified using v3 scheme (APK Signature Scheme v3): false
933s Verified using v4 scheme (APK Signature Scheme v4): false
933s Verified for SourceStamp: false
933s Number of signers: 1
933s 
933s 2024-03-26 05:45:08,377 DEBUG: Density 120 not available, resizing down from 160
933s 2024-03-26 05:45:08,378 DEBUG: Processing org.dyndns.fules.ck_20.apk
933s 2024-03-26 05:45:08,379 INFO: Starting analysis on AndroidManifest.xml
933s 2024-03-26 05:45:08,380 INFO: APK file was successfully validated!
933s 2024-03-26 05:45:08,382 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk
933s 2024-03-26 05:45:08,663 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies
933s Verified using v1 scheme (JAR signing): true
933s Verified using v2 scheme (APK Signature Scheme v2): false
933s Verified using v3 scheme (APK Signature Scheme v3): false
933s Verified using v4 scheme (APK Signature Scheme v4): false
933s Verified for SourceStamp: false
933s Number of signers: 1
933s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
933s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
933s 
933s 2024-03-26 05:45:08,664 DEBUG: Processing souch.smsbypass_9.apk
933s 2024-03-26 05:45:08,665 INFO: Starting analysis on AndroidManifest.xml
933s 2024-03-26 05:45:08,666 INFO: APK file was successfully validated!
933s 2024-03-26 05:45:08,669 DEBUG: Getting signature of souch.smsbypass_9.apk
933s 2024-03-26 05:45:08,940 DEBUG: repo/souch.smsbypass_9.apk: Verifies
933s Verified using v1 scheme (JAR signing): true
933s Verified using v2 scheme (APK Signature Scheme v2): false
933s Verified using v3 scheme (APK Signature Scheme v3): false
933s Verified using v4 scheme (APK Signature Scheme v4): false
933s Verified for SourceStamp: false
933s Number of signers: 1
933s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
933s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
933s 
933s 2024-03-26 05:45:08,941 DEBUG: Density 120 not available, resizing down from 160
933s 2024-03-26 05:45:08,943 DEBUG: Processing v1.v2.sig_1020.apk
933s 2024-03-26 05:45:08,943 INFO: Starting analysis on AndroidManifest.xml
933s 2024-03-26 05:45:08,944 INFO: APK file was successfully validated!
933s 2024-03-26 05:45:08,946 DEBUG: Getting signature of v1.v2.sig_1020.apk
934s 2024-03-26 05:45:09,231 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
934s Verified using v1 scheme (JAR signing): true
934s Verified using v2 scheme (APK Signature Scheme v2): true
934s Verified using v3 scheme (APK Signature Scheme v3): false
934s Verified using v4 scheme (APK Signature Scheme v4): false
934s Verified for SourceStamp: false
934s Number of signers: 1
934s 
934s 2024-03-26 05:45:09,232 DEBUG: Density 120 not available, resizing down from 160
934s 2024-03-26 05:45:09,233 DEBUG: Processing v2.only.sig_2.apk
934s 2024-03-26 05:45:09,234 INFO: Starting analysis on AndroidManifest.xml
934s 2024-03-26 05:45:09,235 INFO: APK file was successfully validated!
934s 2024-03-26 05:45:09,236 DEBUG: Getting signature of v2.only.sig_2.apk
934s 2024-03-26 05:45:09,237 INFO: Starting analysis on AndroidManifest.xml
934s 2024-03-26 05:45:09,238 INFO: APK file was successfully validated!
934s 2024-03-26 05:45:09,239 DEBUG: Using APK Signature v2
934s 2024-03-26 05:45:09,239 INFO: Starting analysis on AndroidManifest.xml
934s 2024-03-26 05:45:09,240 INFO: APK file was successfully validated!
934s 2024-03-26 05:45:09,241 DEBUG: Using APK Signature v2
934s 2024-03-26 05:45:09,459 DEBUG: repo/v2.only.sig_2.apk: Verifies
934s Verified using v1 scheme (JAR signing): false
934s Verified using v2 scheme (APK Signature Scheme v2): true
934s Verified using v3 scheme (APK Signature Scheme v3): false
934s Verified using v4 scheme (APK Signature Scheme v4): false
934s Verified for SourceStamp: false
934s Number of signers: 1
934s 
934s 2024-03-26 05:45:09,459 DEBUG: Density 120 not available, resizing down from 160
934s 2024-03-26 05:45:09,462 INFO: Generated skeleton metadata for SpeedoMeterApp.main
934s 2024-03-26 05:45:09,464 INFO: Generated skeleton metadata for apk.embedded
934s 2024-03-26 05:45:09,465 INFO: Generated skeleton metadata for com.example.test.helloworld
934s 2024-03-26 05:45:09,467 INFO: Generated skeleton metadata for com.politedroid
934s 2024-03-26 05:45:09,469 INFO: Generated skeleton metadata for duplicate.permisssions
934s 2024-03-26 05:45:09,472 INFO: Generated skeleton metadata for info.guardianproject.urzip
934s 2024-03-26 05:45:09,475 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile
934s 2024-03-26 05:45:09,478 INFO: Generated skeleton metadata for no.min.target.sdk
934s 2024-03-26 05:45:09,482 INFO: Generated skeleton metadata for obb.main.oldversion
934s 2024-03-26 05:45:09,486 INFO: Generated skeleton metadata for obb.main.twoversions
934s 2024-03-26 05:45:09,491 INFO: Generated skeleton metadata for obb.mainpatch.current
934s 2024-03-26 05:45:09,496 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror
934s 2024-03-26 05:45:09,502 INFO: Generated skeleton metadata for org.dyndns.fules.ck
934s 2024-03-26 05:45:09,507 INFO: Generated skeleton metadata for souch.smsbypass
934s 2024-03-26 05:45:09,513 INFO: Generated skeleton metadata for v1.v2.sig
934s 2024-03-26 05:45:09,519 INFO: Generated skeleton metadata for v2.only.sig
934s 2024-03-26 05:45:09,528 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
935s 2024-03-26 05:45:10,336 INFO: Creating signed index with this key (SHA256):
935s 2024-03-26 05:45:10,336 INFO: 33 93 A1 1D 7F 8F 0B 9A 56 46 82 B9 43 6B 8E C6 1B 15 D8 AD F6 D3 A4 78 31 22 A8 F0 9C 02 62 19
935s 2024-03-26 05:45:10,337 DEBUG: Directory: repo
935s 2024-03-26 05:45:10,337 DEBUG: > jar cf index.jar index.xml
935s 2024-03-26 05:45:10,539 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
936s jar signed.
936s 
936s Warning: 
936s The signer's certificate is self-signed.
936s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
936s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
936s 2024-03-26 05:45:11,442 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
936s 2024-03-26 05:45:11,452 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
937s jar signed.
937s 
937s Warning: 
937s The signer's certificate is self-signed.
937s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
937s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
937s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
937s 2024-03-26 05:45:12,364 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar
938s 2024-03-26 05:45:13,068 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
938s 2024-03-26 05:45:13,885 DEBUG: Outputting JSON
938s 2024-03-26 05:45:13,885 DEBUG: skip deploying full build logs: not enabled in config
938s 2024-03-26 05:45:13,885 DEBUG: skip deploying full build logs: not enabled in config
938s 2024-03-26 05:45:13,886 DEBUG: skip deploying full build logs: not enabled in config
938s 2024-03-26 05:45:13,886 INFO: Finished
939s + /usr/bin/fdroid readmeta
939s + test -e repo/index.xml
939s + test -e repo/index.jar
939s + test -e repo/index-v1.jar
939s + grep -F '<application id=' repo/index.xml
939s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/repo/info.guardianproject.urzip_100.apk
939s + /usr/bin/fdroid update --create-metadata --verbose
939s 2024-03-26 05:45:14,831 DEBUG: Reading 'config.yml'
939s 2024-03-26 05:45:14,841 DEBUG: ipfs_cid not found, skipping CIDv1 generation
939s 2024-03-26 05:45:14,842 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
939s 2024-03-26 05:45:14,842 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
939s 2024-03-26 05:45:14,852 DEBUG: Reading SpeedoMeterApp.main_1.apk from cache
939s 2024-03-26 05:45:14,852 DEBUG: Reading apk.embedded_1.apk from cache
939s 2024-03-26 05:45:14,852 DEBUG: Reading com.example.test.helloworld_1.apk from cache
939s 2024-03-26 05:45:14,852 DEBUG: Reading com.politedroid_3.apk from cache
939s 2024-03-26 05:45:14,852 DEBUG: Reading com.politedroid_4.apk from cache
939s 2024-03-26 05:45:14,852 DEBUG: Reading com.politedroid_5.apk from cache
939s 2024-03-26 05:45:14,852 DEBUG: Reading com.politedroid_6.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading duplicate.permisssions_9999999.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading info.guardianproject.urzip_100.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading info.zwanenburg.caffeinetile_4.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading no.min.target.sdk_987.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading obb.main.oldversion_1444412523.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading obb.main.twoversions_1101613.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading obb.main.twoversions_1101615.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading obb.main.twoversions_1101617.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading obb.mainpatch.current_1619.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading org.bitbucket.tickytacky.mirrormirror_1.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading org.bitbucket.tickytacky.mirrormirror_2.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading org.bitbucket.tickytacky.mirrormirror_3.apk from cache
939s 2024-03-26 05:45:14,853 DEBUG: Reading org.bitbucket.tickytacky.mirrormirror_4.apk from cache
939s 2024-03-26 05:45:14,854 DEBUG: Reading org.dyndns.fules.ck_20.apk from cache
939s 2024-03-26 05:45:14,854 DEBUG: Reading souch.smsbypass_9.apk from cache
939s 2024-03-26 05:45:14,854 DEBUG: Reading v1.v2.sig_1020.apk from cache
939s 2024-03-26 05:45:14,854 DEBUG: Reading v2.only.sig_2.apk from cache
939s 2024-03-26 05:45:14,856 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
940s 2024-03-26 05:45:15,565 INFO: Creating signed index with this key (SHA256):
940s 2024-03-26 05:45:15,565 INFO: 33 93 A1 1D 7F 8F 0B 9A 56 46 82 B9 43 6B 8E C6 1B 15 D8 AD F6 D3 A4 78 31 22 A8 F0 9C 02 62 19
940s 2024-03-26 05:45:15,565 DEBUG: Directory: repo
940s 2024-03-26 05:45:15,565 DEBUG: > jar cf index.jar index.xml
940s 2024-03-26 05:45:15,767 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
941s jar signed.
941s 
941s Warning: 
941s The signer's certificate is self-signed.
941s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
941s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
941s 2024-03-26 05:45:16,956 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
941s 2024-03-26 05:45:16,972 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS
942s jar signed.
942s 
942s Warning: 
942s The signer's certificate is self-signed.
942s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
942s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
942s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
943s 2024-03-26 05:45:17,985 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar
943s 2024-03-26 05:45:18,790 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XUCz/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
944s 2024-03-26 05:45:19,508 DEBUG: Outputting JSON
944s 2024-03-26 05:45:19,509 DEBUG: skip deploying full build logs: not enabled in config
944s 2024-03-26 05:45:19,509 DEBUG: skip deploying full build logs: not enabled in config
944s 2024-03-26 05:45:19,509 DEBUG: skip deploying full build logs: not enabled in config
944s 2024-03-26 05:45:19,509 INFO: Finished
944s + /usr/bin/fdroid readmeta
945s + test -e repo/index.xml
945s + test -e repo/index.jar
945s + test -e repo/index-v1.jar
945s + test -e tmp/apkcache.json
945s + test -z tmp/apkcache.json
945s + grep -F '<application id=' repo/index.xml
945s + echo_header 'setup a new repo from scratch with a HSM/smartcard'
945s ==============================================================================
945s setup a new repo from scratch with a HSM/smartcard
945s ++ create_test_dir
945s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
945s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
945s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.V5fr
945s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.V5fr
945s + /usr/bin/fdroid init --keystore NONE
945s 2024-03-26 05:45:20,399 WARNING: No OpenSC PKCS#11 module found, install OpenSC then edit "opensc-fdroid.cfg"!
945s 2024-03-26 05:45:20,399 INFO: Repo setup using a smartcard HSM. Please edit keystorepass and repo_keyalias in config.yml.
945s 2024-03-26 05:45:20,399 INFO: If you want to generate a new repo signing key in the HSM you can do that with 'fdroid update --create-key'.
945s 2024-03-26 05:45:20,399 INFO: 
945s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.V5fr" with this config:
945s 
945s   Android SDK:			/usr/lib/android-sdk
945s   Keystore for signing key:	NONE
945s 
945s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.V5fr/repo"
945s then run "fdroid update -c; fdroid update".  You might also want to edit
945s "config.yml" to set the URL, repo name, and more.  You should also set up
945s a signing key (a temporary one might have been automatically generated).
945s 
945s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
945s and https://f-droid.org/docs/Signing_Process
945s + test -e opensc-fdroid.cfg
945s + test '!' -e NONE
945s + echo_header 'setup a new repo with no keystore, add APK, and update'
945s ==============================================================================
945s setup a new repo with no keystore, add APK, and update
945s ++ create_test_dir
945s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
945s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
945s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy
945s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy/keystore.p12
945s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy
945s + touch fdroid-icon.png
945s + mkdir repo
945s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy/repo/
945s + set +e
945s + /usr/bin/fdroid update --create-metadata --verbose
945s 2024-03-26 05:45:20,840 DEBUG: ipfs_cid not found, skipping CIDv1 generation
945s 2024-03-26 05:45:20,841 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
945s 2024-03-26 05:45:20,841 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
945s 2024-03-26 05:45:20,842 DEBUG: Processing urzip.apk
945s 2024-03-26 05:45:20,943 INFO: Starting analysis on AndroidManifest.xml
945s 2024-03-26 05:45:20,952 INFO: APK file was successfully validated!
945s 2024-03-26 05:45:20,954 DEBUG: Getting signature of urzip.apk
945s 2024-03-26 05:45:20,960 WARNING: repo/urzip.apk is set to android:debuggable="true"
946s 2024-03-26 05:45:21,375 DEBUG: repo/urzip.apk: Verifies
946s Verified using v1 scheme (JAR signing): true
946s Verified using v2 scheme (APK Signature Scheme v2): false
946s Verified using v3 scheme (APK Signature Scheme v3): false
946s Verified using v4 scheme (APK Signature Scheme v4): false
946s Verified for SourceStamp: false
946s Number of signers: 1
946s 
946s 2024-03-26 05:45:21,379 DEBUG: Density 120 not available, resizing down from 160
946s 2024-03-26 05:45:21,381 INFO: Generated skeleton metadata for info.guardianproject.urzip
946s 2024-03-26 05:45:21,384 CRITICAL: 'repo_keyalias' not found in config.yml!
946s 2024-03-26 05:45:21,384 CRITICAL: 'keystore.p12' does not exist!
946s 2024-03-26 05:45:21,384 CRITICAL: 'keystorepass' not found in config.yml!
946s 2024-03-26 05:45:21,384 CRITICAL: 'keypass' not found in config.yml!
948s Traceback (most recent call last):
948s   File "/usr/bin/fdroid", line 33, in <module>
948s     sys.exit(load_entry_point('fdroidserver==2.2.1', 'console_scripts', 'fdroid')())
948s              ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
948s   File "/usr/lib/python3/dist-packages/fdroidserver/__main__.py", line 211, in main
948s     mod.main()
948s   File "/usr/lib/python3/dist-packages/fdroidserver/update.py", line 2347, in main
948s     index.make(repoapps, apks, repodirs[0], False)
948s   File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 71, in make
948s     common.assert_config_keystore(common.config)
948s   File "/usr/lib/python3/dist-packages/fdroidserver/common.py", line 555, in assert_config_keystore
948s     raise FDroidException("This command requires a signing key, "
948s fdroidserver.exception.FDroidException: This command requires a signing key, you can create one using: fdroid update --create-key
949s `fdroid update` prompted to add keystore
949s + '[' 1 -eq 0 ']'
949s + echo '`fdroid update` prompted to add keystore'
949s + set -e
949s + touch /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy/keystore.p12
949s + echo 'keystore: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy/keystore.p12'
949s + echo 'repo_keyalias: foo'
949s + echo 'keystorepass: foo'
949s + echo 'keypass: foo'
949s + set +e
949s + /usr/bin/fdroid update --create-metadata --verbose
949s 2024-03-26 05:45:24,578 DEBUG: Reading 'config.yml'
949s 2024-03-26 05:45:24,579 WARNING: unsafe permissions on 'config.yml' (should be 0600)!
949s 2024-03-26 05:45:24,581 DEBUG: ipfs_cid not found, skipping CIDv1 generation
949s 2024-03-26 05:45:24,581 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
949s 2024-03-26 05:45:24,581 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
949s 2024-03-26 05:45:24,583 DEBUG: Reading urzip.apk from cache
949s 2024-03-26 05:45:24,584 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias foo -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.bRqy/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS
952s Traceback (most recent call last):
952s   File "/usr/bin/fdroid", line 33, in <module>
952s     sys.exit(load_entry_point('fdroidserver==2.2.1', 'console_scripts', 'fdroid')())
952s              ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
952s   File "/usr/lib/python3/dist-packages/fdroidserver/__main__.py", line 211, in main
952s     mod.main()
952s   File "/usr/lib/python3/dist-packages/fdroidserver/update.py", line 2347, in main
952s     index.make(repoapps, apks, repodirs[0], False)
952s   File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 139, in make
952s     make_v0(sortedapps, apks, repodir, repodict, requestsdict,
952s   File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 1086, in make_v0
952s     pubkey, repo_pubkey_fingerprint = extract_pubkey()
952s                                       ^^^^^^^^^^^^^^^^
952s   File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 1392, in extract_pubkey
952s     raise FDroidException(msg)
952s fdroidserver.exception.FDroidException: Failed to get repo pubkey!
952s + '[' 1 -eq 0 ']'
952s + echo '`fdroid update` prompted to add keystore'
952s + set -e
952s + echo_header 'copy tests/repo, update with binary transparency log'
952s `fdroid update` prompted to add keystore
952s ==============================================================================
952s copy tests/repo, update with binary transparency log
952s ++ create_test_dir
952s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
952s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
952s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN
952s ++ create_test_dir
952s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
952s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
952s + GIT_REMOTE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk
952s + GNUPGHOME=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/gnupghome
952s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN
952s + fdroid_init_with_prebuilt_keystore
952s + '[' -z '' ']'
952s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
952s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
952s 2024-03-26 05:45:27,826 WARNING: 
952s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
952s Now set these in config.yml: keystorepass, keypass, keydname
952s 
952s 2024-03-26 05:45:27,826 INFO: 
952s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN" with this config:
952s 
952s   Android SDK:			/usr/lib/android-sdk
952s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
952s   Alias for key in store:	sova
952s 
952s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/repo"
952s then run "fdroid update -c; fdroid update".  You might also want to edit
952s "config.yml" to set the URL, repo name, and more.  You should also set up
952s a signing key (a temporary one might have been automatically generated).
952s 
952s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
952s and https://f-droid.org/docs/Signing_Process
952s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
952s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
952s + cp -a /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/stats /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/
952s + echo 'binary_transparency_remote: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk'
952s + /usr/bin/fdroid update --verbose
953s 2024-03-26 05:45:28,251 DEBUG: Reading 'config.yml'
953s 2024-03-26 05:45:28,262 DEBUG: ipfs_cid not found, skipping CIDv1 generation
953s 2024-03-26 05:45:28,262 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
953s 2024-03-26 05:45:28,262 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
953s 2024-03-26 05:45:28,329 DEBUG: Processing com.example.test.helloworld_1.apk
953s 2024-03-26 05:45:28,395 INFO: Starting analysis on AndroidManifest.xml
953s 2024-03-26 05:45:28,403 INFO: APK file was successfully validated!
953s 2024-03-26 05:45:28,407 DEBUG: Getting signature of com.example.test.helloworld_1.apk
953s 2024-03-26 05:45:28,722 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies
953s Verified using v1 scheme (JAR signing): true
953s Verified using v2 scheme (APK Signature Scheme v2): false
953s Verified using v3 scheme (APK Signature Scheme v3): false
953s Verified using v4 scheme (APK Signature Scheme v4): false
953s Verified for SourceStamp: false
953s Number of signers: 1
953s 
953s 2024-03-26 05:45:28,723 DEBUG: Processing com.politedroid_3.apk
953s 2024-03-26 05:45:28,723 INFO: Starting analysis on AndroidManifest.xml
953s 2024-03-26 05:45:28,724 INFO: APK file was successfully validated!
953s 2024-03-26 05:45:28,726 DEBUG: Getting signature of com.politedroid_3.apk
954s 2024-03-26 05:45:29,007 DEBUG: repo/com.politedroid_3.apk: Verifies
954s Verified using v1 scheme (JAR signing): true
954s Verified using v2 scheme (APK Signature Scheme v2): false
954s Verified using v3 scheme (APK Signature Scheme v3): false
954s Verified using v4 scheme (APK Signature Scheme v4): false
954s Verified for SourceStamp: false
954s Number of signers: 1
954s 
954s 2024-03-26 05:45:29,012 DEBUG: Processing com.politedroid_4.apk
954s 2024-03-26 05:45:29,012 INFO: Starting analysis on AndroidManifest.xml
954s 2024-03-26 05:45:29,013 INFO: APK file was successfully validated!
954s 2024-03-26 05:45:29,015 DEBUG: Getting signature of com.politedroid_4.apk
954s 2024-03-26 05:45:29,265 DEBUG: repo/com.politedroid_4.apk: Verifies
954s Verified using v1 scheme (JAR signing): true
954s Verified using v2 scheme (APK Signature Scheme v2): false
954s Verified using v3 scheme (APK Signature Scheme v3): false
954s Verified using v4 scheme (APK Signature Scheme v4): false
954s Verified for SourceStamp: false
954s Number of signers: 1
954s 
954s 2024-03-26 05:45:29,267 DEBUG: Processing com.politedroid_5.apk
954s 2024-03-26 05:45:29,267 INFO: Starting analysis on AndroidManifest.xml
954s 2024-03-26 05:45:29,268 INFO: APK file was successfully validated!
954s 2024-03-26 05:45:29,270 DEBUG: Getting signature of com.politedroid_5.apk
954s 2024-03-26 05:45:29,515 DEBUG: repo/com.politedroid_5.apk: Verifies
954s Verified using v1 scheme (JAR signing): true
954s Verified using v2 scheme (APK Signature Scheme v2): false
954s Verified using v3 scheme (APK Signature Scheme v3): false
954s Verified using v4 scheme (APK Signature Scheme v4): false
954s Verified for SourceStamp: false
954s Number of signers: 1
954s 
954s 2024-03-26 05:45:29,516 DEBUG: Processing com.politedroid_6.apk
954s 2024-03-26 05:45:29,517 INFO: Starting analysis on AndroidManifest.xml
954s 2024-03-26 05:45:29,518 INFO: APK file was successfully validated!
954s 2024-03-26 05:45:29,520 DEBUG: Getting signature of com.politedroid_6.apk
954s 2024-03-26 05:45:29,756 DEBUG: repo/com.politedroid_6.apk: Verifies
954s Verified using v1 scheme (JAR signing): true
954s Verified using v2 scheme (APK Signature Scheme v2): false
954s Verified using v3 scheme (APK Signature Scheme v3): false
954s Verified using v4 scheme (APK Signature Scheme v4): false
954s Verified for SourceStamp: false
954s Number of signers: 1
954s 
954s 2024-03-26 05:45:29,758 DEBUG: Processing duplicate.permisssions_9999999.apk
954s 2024-03-26 05:45:29,758 INFO: Starting analysis on AndroidManifest.xml
954s 2024-03-26 05:45:29,760 INFO: APK file was successfully validated!
954s 2024-03-26 05:45:29,762 DEBUG: Getting signature of duplicate.permisssions_9999999.apk
954s 2024-03-26 05:45:29,768 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
955s 2024-03-26 05:45:30,009 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies
955s Verified using v1 scheme (JAR signing): true
955s Verified using v2 scheme (APK Signature Scheme v2): true
955s Verified using v3 scheme (APK Signature Scheme v3): false
955s Verified using v4 scheme (APK Signature Scheme v4): false
955s Verified for SourceStamp: false
955s Number of signers: 1
955s 
955s 2024-03-26 05:45:30,010 DEBUG: Density 120 not available, resizing down from 160
955s 2024-03-26 05:45:30,011 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk
955s 2024-03-26 05:45:30,011 INFO: Starting analysis on AndroidManifest.xml
955s 2024-03-26 05:45:30,012 INFO: APK file was successfully validated!
955s 2024-03-26 05:45:30,014 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk
955s 2024-03-26 05:45:30,245 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies
955s Verified using v1 scheme (JAR signing): true
955s Verified using v2 scheme (APK Signature Scheme v2): false
955s Verified using v3 scheme (APK Signature Scheme v3): false
955s Verified using v4 scheme (APK Signature Scheme v4): false
955s Verified for SourceStamp: false
955s Number of signers: 1
955s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
955s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
955s 
955s 2024-03-26 05:45:30,246 DEBUG: Processing no.min.target.sdk_987.apk
955s 2024-03-26 05:45:30,246 INFO: Starting analysis on AndroidManifest.xml
955s 2024-03-26 05:45:30,247 INFO: APK file was successfully validated!
955s 2024-03-26 05:45:30,249 DEBUG: Getting signature of no.min.target.sdk_987.apk
955s 2024-03-26 05:45:30,256 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
955s 2024-03-26 05:45:30,535 DEBUG: repo/no.min.target.sdk_987.apk: Verifies
955s Verified using v1 scheme (JAR signing): true
955s Verified using v2 scheme (APK Signature Scheme v2): true
955s Verified using v3 scheme (APK Signature Scheme v3): false
955s Verified using v4 scheme (APK Signature Scheme v4): false
955s Verified for SourceStamp: false
955s Number of signers: 1
955s 
955s 2024-03-26 05:45:30,536 DEBUG: Density 120 not available, resizing down from 160
955s 2024-03-26 05:45:30,538 DEBUG: Processing obb.main.oldversion_1444412523.apk
955s 2024-03-26 05:45:30,538 INFO: Starting analysis on AndroidManifest.xml
955s 2024-03-26 05:45:30,540 INFO: APK file was successfully validated!
955s 2024-03-26 05:45:30,542 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk
955s 2024-03-26 05:45:30,803 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies
955s Verified using v1 scheme (JAR signing): true
955s Verified using v2 scheme (APK Signature Scheme v2): true
955s Verified using v3 scheme (APK Signature Scheme v3): false
955s Verified using v4 scheme (APK Signature Scheme v4): false
955s Verified for SourceStamp: false
955s Number of signers: 1
955s 
955s 2024-03-26 05:45:30,804 DEBUG: Density 120 not available, resizing down from 160
955s 2024-03-26 05:45:30,805 DEBUG: Processing obb.main.twoversions_1101613.apk
955s 2024-03-26 05:45:30,806 INFO: Starting analysis on AndroidManifest.xml
955s 2024-03-26 05:45:30,807 INFO: APK file was successfully validated!
955s 2024-03-26 05:45:30,809 DEBUG: Getting signature of obb.main.twoversions_1101613.apk
956s 2024-03-26 05:45:31,047 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies
956s Verified using v1 scheme (JAR signing): true
956s Verified using v2 scheme (APK Signature Scheme v2): false
956s Verified using v3 scheme (APK Signature Scheme v3): false
956s Verified using v4 scheme (APK Signature Scheme v4): false
956s Verified for SourceStamp: false
956s Number of signers: 1
956s 
956s 2024-03-26 05:45:31,047 DEBUG: Density 120 not available, resizing down from 160
956s 2024-03-26 05:45:31,049 DEBUG: Processing obb.main.twoversions_1101615.apk
956s 2024-03-26 05:45:31,049 INFO: Starting analysis on AndroidManifest.xml
956s 2024-03-26 05:45:31,050 INFO: APK file was successfully validated!
956s 2024-03-26 05:45:31,052 DEBUG: Getting signature of obb.main.twoversions_1101615.apk
956s 2024-03-26 05:45:31,295 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies
956s Verified using v1 scheme (JAR signing): true
956s Verified using v2 scheme (APK Signature Scheme v2): false
956s Verified using v3 scheme (APK Signature Scheme v3): false
956s Verified using v4 scheme (APK Signature Scheme v4): false
956s Verified for SourceStamp: false
956s Number of signers: 1
956s 
956s 2024-03-26 05:45:31,295 DEBUG: Density 120 not available, resizing down from 160
956s 2024-03-26 05:45:31,297 DEBUG: Processing obb.main.twoversions_1101617.apk
956s 2024-03-26 05:45:31,297 INFO: Starting analysis on AndroidManifest.xml
956s 2024-03-26 05:45:31,299 INFO: APK file was successfully validated!
956s 2024-03-26 05:45:31,300 DEBUG: Getting signature of obb.main.twoversions_1101617.apk
956s 2024-03-26 05:45:31,541 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies
956s Verified using v1 scheme (JAR signing): true
956s Verified using v2 scheme (APK Signature Scheme v2): false
956s Verified using v3 scheme (APK Signature Scheme v3): false
956s Verified using v4 scheme (APK Signature Scheme v4): false
956s Verified for SourceStamp: false
956s Number of signers: 1
956s 
956s 2024-03-26 05:45:31,541 DEBUG: Density 120 not available, resizing down from 160
956s 2024-03-26 05:45:31,543 DEBUG: Processing obb.mainpatch.current_1619.apk
956s 2024-03-26 05:45:31,543 INFO: Starting analysis on AndroidManifest.xml
956s 2024-03-26 05:45:31,545 INFO: APK file was successfully validated!
956s 2024-03-26 05:45:31,546 DEBUG: Getting signature of obb.mainpatch.current_1619.apk
956s 2024-03-26 05:45:31,805 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies
956s Verified using v1 scheme (JAR signing): true
956s Verified using v2 scheme (APK Signature Scheme v2): false
956s Verified using v3 scheme (APK Signature Scheme v3): false
956s Verified using v4 scheme (APK Signature Scheme v4): false
956s Verified for SourceStamp: false
956s Number of signers: 1
956s 
956s 2024-03-26 05:45:31,806 DEBUG: Density 120 not available, resizing down from 160
956s 2024-03-26 05:45:31,807 DEBUG: Processing obb.mainpatch.current_1619_another-release-key.apk
956s 2024-03-26 05:45:31,808 INFO: Starting analysis on AndroidManifest.xml
956s 2024-03-26 05:45:31,809 INFO: APK file was successfully validated!
956s 2024-03-26 05:45:31,810 DEBUG: Getting signature of obb.mainpatch.current_1619_another-release-key.apk
957s 2024-03-26 05:45:32,046 DEBUG: repo/obb.mainpatch.current_1619_another-release-key.apk: Verifies
957s Verified using v1 scheme (JAR signing): true
957s Verified using v2 scheme (APK Signature Scheme v2): false
957s Verified using v3 scheme (APK Signature Scheme v3): false
957s Verified using v4 scheme (APK Signature Scheme v4): false
957s Verified for SourceStamp: false
957s Number of signers: 1
957s 
957s 2024-03-26 05:45:32,047 DEBUG: Density 120 not available, resizing down from 160
957s 2024-03-26 05:45:32,049 DEBUG: Processing souch.smsbypass_9.apk
957s 2024-03-26 05:45:32,049 INFO: Starting analysis on AndroidManifest.xml
957s 2024-03-26 05:45:32,050 INFO: APK file was successfully validated!
957s 2024-03-26 05:45:32,053 DEBUG: Getting signature of souch.smsbypass_9.apk
957s 2024-03-26 05:45:32,336 DEBUG: repo/souch.smsbypass_9.apk: Verifies
957s Verified using v1 scheme (JAR signing): true
957s Verified using v2 scheme (APK Signature Scheme v2): false
957s Verified using v3 scheme (APK Signature Scheme v3): false
957s Verified using v4 scheme (APK Signature Scheme v4): false
957s Verified for SourceStamp: false
957s Number of signers: 1
957s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
957s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/.
957s 
957s 2024-03-26 05:45:32,337 DEBUG: Density 120 not available, resizing down from 160
957s 2024-03-26 05:45:32,339 DEBUG: Processing urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
957s 2024-03-26 05:45:32,340 INFO: Starting analysis on AndroidManifest.xml
957s 2024-03-26 05:45:32,341 INFO: APK file was successfully validated!
957s 2024-03-26 05:45:32,342 DEBUG: Getting signature of urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
957s 2024-03-26 05:45:32,590 DEBUG: repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk: Verifies
957s Verified using v1 scheme (JAR signing): true
957s Verified using v2 scheme (APK Signature Scheme v2): false
957s Verified using v3 scheme (APK Signature Scheme v3): false
957s Verified using v4 scheme (APK Signature Scheme v4): false
957s Verified for SourceStamp: false
957s Number of signers: 1
957s 
957s 2024-03-26 05:45:32,591 DEBUG: Density 120 not available, resizing down from 160
957s 2024-03-26 05:45:32,592 DEBUG: Processing v1.v2.sig_1020.apk
957s 2024-03-26 05:45:32,592 INFO: Starting analysis on AndroidManifest.xml
957s 2024-03-26 05:45:32,594 INFO: APK file was successfully validated!
957s 2024-03-26 05:45:32,595 DEBUG: Getting signature of v1.v2.sig_1020.apk
957s 2024-03-26 05:45:32,882 DEBUG: repo/v1.v2.sig_1020.apk: Verifies
957s Verified using v1 scheme (JAR signing): true
957s Verified using v2 scheme (APK Signature Scheme v2): true
957s Verified using v3 scheme (APK Signature Scheme v3): false
957s Verified using v4 scheme (APK Signature Scheme v4): false
957s Verified for SourceStamp: false
957s Number of signers: 1
957s 
957s 2024-03-26 05:45:32,883 DEBUG: Density 120 not available, resizing down from 160
957s 2024-03-26 05:45:32,884 DEBUG: Processing fake.ota.update_1234.zip
957s 2024-03-26 05:45:32,885 DEBUG: skipping source tarball: repo/obb.main.twoversions_1101617_src.tar.gz
957s 2024-03-26 05:45:32,885 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata!
957s 	Use `fdroid update -c` to create it.
957s 2024-03-26 05:45:32,885 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata!
957s 	Use `fdroid update -c` to create it.
957s 2024-03-26 05:45:32,887 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan.
957s 2024-03-26 05:45:32,887 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan.
957s 2024-03-26 05:45:32,887 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan.
957s 2024-03-26 05:45:32,887 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/icon.png repo/info.guardianproject.urzip/en-US
957s 2024-03-26 05:45:32,888 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/featureGraphic.png repo/info.guardianproject.urzip/en-US
957s 2024-03-26 05:45:32,969 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan.
957s 2024-03-26 05:45:32,969 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan.
957s 2024-03-26 05:45:32,969 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan.
957s 2024-03-26 05:45:32,970 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"!
957s 2024-03-26 05:45:32,970 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"!
958s 2024-03-26 05:45:32,971 DEBUG: adding to phoneScreenshots: repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png
958s 2024-03-26 05:45:32,971 DEBUG: adding to sevenInchScreenshots: repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
958s 2024-03-26 05:45:32,972 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,972 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"!
958s 2024-03-26 05:45:32,973 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
958s 
958s Warning:
958s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
958s 2024-03-26 05:45:33,484 INFO: Creating signed index with this key (SHA256):
958s 2024-03-26 05:45:33,484 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
958s 2024-03-26 05:45:33,484 DEBUG: Directory: repo
958s 2024-03-26 05:45:33,484 DEBUG: > jar cf index.jar index.xml
958s 2024-03-26 05:45:33,687 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS
959s jar signed.
959s 
959s Warning: 
959s The signer's certificate is self-signed.
959s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
959s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
959s 2024-03-26 05:45:34,390 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
959s 2024-03-26 05:45:34,397 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
959s 2024-03-26 05:45:34,397 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
959s 2024-03-26 05:45:34,399 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS
959s jar signed.
959s 
959s Warning: 
959s The signer's certificate is self-signed.
959s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
959s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
959s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
960s 2024-03-26 05:45:35,002 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
960s 2024-03-26 05:45:35,003 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
960s 2024-03-26 05:45:35,007 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
960s 2024-03-26 05:45:35,409 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
960s 
960s Warning:
960s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks -deststoretype pkcs12".
960s 2024-03-26 05:45:35,926 INFO: Committing indexes to binary_transparency
960s 2024-03-26 05:45:35,926 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/binary_transparency, universal_newlines=False, shell=None, istream=None)
960s 2024-03-26 05:45:35,933 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/binary_transparency, universal_newlines=False, shell=None, istream=<valid stream>)
960s 2024-03-26 05:45:35,935 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/binary_transparency, universal_newlines=False, shell=None, istream=<valid stream>)
960s 2024-03-26 05:45:35,958 DEBUG: Outputting JSON
960s 2024-03-26 05:45:35,958 DEBUG: skip deploying full build logs: not enabled in config
960s 2024-03-26 05:45:35,959 DEBUG: skip deploying full build logs: not enabled in config
960s 2024-03-26 05:45:35,959 DEBUG: skip deploying full build logs: not enabled in config
960s 2024-03-26 05:45:35,959 INFO: Finished
961s + /usr/bin/fdroid deploy --verbose
961s 2024-03-26 05:45:36,437 DEBUG: Reading 'config.yml'
961s 2024-03-26 05:45:36,448 DEBUG: ipfs_cid not found, skipping CIDv1 generation
961s 2024-03-26 05:45:36,448 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk
961s 2024-03-26 05:45:36,448 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk, universal_newlines=False, shell=None, istream=None)
961s 2024-03-26 05:45:36,453 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk, universal_newlines=False, shell=None, istream=None)
961s 2024-03-26 05:45:36,455 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk, universal_newlines=True, shell=None, istream=None)
961s 2024-03-26 05:45:36,495 DEBUG: Fetch head lines do not match lines provided via progress information
961s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
961s Will ignore extra progress lines or fetch head lines.
961s 2024-03-26 05:45:36,495 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' * [new branch]      master     -> local/master']"
961s 2024-03-26 05:45:36,495 DEBUG: b'head info: ["98e833bb087dfce5a2fd394492dbaa11dee9180f\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.tqPN/binary_transparency\\n"]'
961s 2024-03-26 05:45:36,496 DEBUG: skip deploying full build logs: not enabled in config
961s 2024-03-26 05:45:36,496 DEBUG: skip deploying full build logs: not enabled in config
961s 2024-03-26 05:45:36,496 DEBUG: skip deploying full build logs: not enabled in config
961s + test -e repo/index.xml
961s + test -e repo/index.jar
961s + test -e repo/index-v1.jar
961s + grep -F '<application id=' repo/index.xml
961s + cd binary_transparency
961s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD
961s + '[' 2 == 2 ']'
961s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qesk
961s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD
961s + '[' 2 == 2 ']'
961s + echo_header 'setup a new repo with keystore with APK, update, then without key'
961s ==============================================================================
961s setup a new repo with keystore with APK, update, then without key
961s ++ create_test_dir
961s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
961s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
961s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds
961s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
961s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds
961s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
961s + fdroid_init_with_prebuilt_keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
961s + '[' -z /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks ']'
961s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
961s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks --repo-keyalias=sova
961s 2024-03-26 05:45:36,933 WARNING: 
961s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks"
961s Now set these in config.yml: keystorepass, keypass, keydname
961s 
961s 2024-03-26 05:45:36,934 INFO: 
961s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds" with this config:
961s 
961s   Android SDK:			/usr/lib/android-sdk
961s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
961s   Alias for key in store:	sova
961s 
961s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/repo"
961s then run "fdroid update -c; fdroid update".  You might also want to edit
961s "config.yml" to set the URL, repo name, and more.  You should also set up
961s a signing key (a temporary one might have been automatically generated).
961s 
961s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
961s and https://f-droid.org/docs/Signing_Process
962s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
962s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
962s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
962s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/repo/
962s + /usr/bin/fdroid update --create-metadata --verbose
962s 2024-03-26 05:45:37,351 DEBUG: Reading 'config.yml'
962s 2024-03-26 05:45:37,361 DEBUG: ipfs_cid not found, skipping CIDv1 generation
962s 2024-03-26 05:45:37,362 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py"
962s 2024-03-26 05:45:37,362 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
962s 2024-03-26 05:45:37,363 DEBUG: Processing urzip.apk
962s 2024-03-26 05:45:37,444 INFO: Starting analysis on AndroidManifest.xml
962s 2024-03-26 05:45:37,453 INFO: APK file was successfully validated!
962s 2024-03-26 05:45:37,455 DEBUG: Getting signature of urzip.apk
962s 2024-03-26 05:45:37,462 WARNING: repo/urzip.apk is set to android:debuggable="true"
962s 2024-03-26 05:45:37,713 DEBUG: repo/urzip.apk: Verifies
962s Verified using v1 scheme (JAR signing): true
962s Verified using v2 scheme (APK Signature Scheme v2): false
962s Verified using v3 scheme (APK Signature Scheme v3): false
962s Verified using v4 scheme (APK Signature Scheme v4): false
962s Verified for SourceStamp: false
962s Number of signers: 1
962s 
962s 2024-03-26 05:45:37,716 DEBUG: Density 120 not available, resizing down from 160
962s 2024-03-26 05:45:37,719 INFO: Generated skeleton metadata for info.guardianproject.urzip
962s 2024-03-26 05:45:37,722 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
963s 
963s Warning:
963s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -deststoretype pkcs12".
963s 2024-03-26 05:45:38,325 INFO: Creating signed index with this key (SHA256):
963s 2024-03-26 05:45:38,325 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
963s 2024-03-26 05:45:38,325 DEBUG: Directory: repo
963s 2024-03-26 05:45:38,325 DEBUG: > jar cf index.jar index.xml
963s 2024-03-26 05:45:38,526 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS
964s jar signed.
964s 
964s Warning: 
964s The signer's certificate is self-signed.
964s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
964s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
964s 2024-03-26 05:45:39,129 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
964s 2024-03-26 05:45:39,136 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS
964s jar signed.
964s 
964s Warning: 
964s The signer's certificate is self-signed.
964s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled.
964s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled.
964s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature.
964s 2024-03-26 05:45:39,844 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar
965s 2024-03-26 05:45:40,347 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -storepass:env FDROID_KEY_STORE_PASS
965s 
965s Warning:
965s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -destkeystore /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks -deststoretype pkcs12".
965s 2024-03-26 05:45:40,866 DEBUG: Outputting JSON
965s 2024-03-26 05:45:40,866 DEBUG: skip deploying full build logs: not enabled in config
965s 2024-03-26 05:45:40,867 DEBUG: skip deploying full build logs: not enabled in config
965s 2024-03-26 05:45:40,867 DEBUG: skip deploying full build logs: not enabled in config
965s 2024-03-26 05:45:40,867 INFO: Finished
966s + /usr/bin/fdroid readmeta
966s + test -e repo/index.xml
966s + test -e repo/index.jar
966s + test -e repo/index-v1.jar
966s + test -e tmp/apkcache.json
966s + test -z tmp/apkcache.json
966s + grep -F '<application id=' repo/index.xml
966s + sed -i.tmp 's,^ *repo_keyalias.*,repo_keyalias: fake,' /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/config.yml
966s + set +e
966s + /usr/bin/fdroid update
966s 2024-03-26 05:45:41,765 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
967s 2024-03-26 05:45:42,174 CRITICAL: Failed to get repo pubkey!
967s `fdroid update` prompted to add keystore
967s + '[' 1 -eq 0 ']'
967s + echo '`fdroid update` prompted to add keystore'
967s + set -e
967s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
967s + set +e
967s + /usr/bin/fdroid update --create-key
967s 2024-03-26 05:45:42,605 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
967s 2024-03-26 05:45:42,605 CRITICAL: Cowardily refusing to overwrite existing signing key setup!
967s 2024-03-26 05:45:42,605 CRITICAL: 	'/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks'
967s `fdroid update` complained about existing keystore
967s + '[' 1 -eq 0 ']'
967s + echo '`fdroid update` complained about existing keystore'
967s + set -e
967s + rm -f /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
967s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
967s + /usr/bin/fdroid update --create-key
968s 2024-03-26 05:45:43,042 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
968s 2024-03-26 05:45:43,044 INFO: Generating a new key in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks"...
972s 2024-03-26 05:45:47,272 INFO: Alias name: fake
972s Creation date: Mar 26, 2024
972s Entry type: PrivateKeyEntry
972s Certificate chain length: 1
972s Certificate[1]:
972s Owner: CN=fake, OU=F-Droid
972s Issuer: CN=fake, OU=F-Droid
972s Serial number: e80eed07d9aa8955
972s Valid from: Tue Mar 26 05:45:46 UTC 2024 until: Sat Aug 12 05:45:46 UTC 2051
972s Certificate fingerprints:
972s 	 SHA1: AD:48:00:B4:44:00:D2:1F:E2:54:F3:EC:BC:BC:D0:D7:B5:37:F3:8E
972s 	 SHA256: E5:61:A4:A7:C7:F1:8F:2F:8B:E3:89:49:FE:2D:44:7F:07:0B:24:5B:8E:AF:27:0E:95:7B:0D:59:CF:38:78:69
972s Signature algorithm name: SHA256withRSA
972s Subject Public Key Algorithm: 4096-bit RSA key
972s Version: 3
972s 
972s Extensions: 
972s 
972s #1: ObjectId: 2.5.29.14 Criticality=false
972s SubjectKeyIdentifier [
972s KeyIdentifier [
972s 0000: 6B CB 29 2B A6 49 73 81   1A 61 D2 B6 C3 54 E7 F2  k.)+.Is..a...T..
972s 0010: 3E 79 0A 42                                        >y.B
972s ]
972s ]
972s 
972s 
973s 2024-03-26 05:45:48,581 INFO: Creating signed index with this key (SHA256):
973s 2024-03-26 05:45:48,582 INFO: E5 61 A4 A7 C7 F1 8F 2F 8B E3 89 49 FE 2D 44 7F 07 0B 24 5B 8E AF 27 0E 95 7B 0D 59 CF 38 78 69
974s 2024-03-26 05:45:49,692 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
977s 2024-03-26 05:45:52,128 INFO: Finished
977s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Kvds/keystore.jks
977s + echo_header 'setup a new repo from scratch using ANDROID_HOME with git mirror'
977s ==============================================================================
977s setup a new repo from scratch using ANDROID_HOME with git mirror
977s ++ create_test_dir
977s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
977s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
977s + SERVER_GIT_MIRROR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc
977s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc
977s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
977s hint: Using 'master' as the name for the initial branch. This default branch name
977s hint: is subject to change. To configure the initial branch name to use in all
977s hint: of your new repositories, which will suppress this warning, call:
977s hint: 
977s hint: 	git config --global init.defaultBranch <name>
977s hint: 
977s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
977s hint: 'development'. The just-created branch can be renamed via this command:
977s hint: 
977s hint: 	git branch -m <name>
977s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/.git/
977s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git config receive.denyCurrentBranch updateInstead
977s ++ create_test_dir
977s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
977s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
977s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw
977s + GIT_MIRROR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror
977s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw
977s + fdroid_init_with_prebuilt_keystore
977s + '[' -z '' ']'
977s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
977s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
977s 2024-03-26 05:45:52,566 WARNING: 
977s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
977s Now set these in config.yml: keystorepass, keypass, keydname
977s 
977s 2024-03-26 05:45:52,566 INFO: 
977s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw" with this config:
977s 
977s   Android SDK:			/usr/lib/android-sdk
977s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
977s   Alias for key in store:	sova
977s 
977s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/repo"
977s then run "fdroid update -c; fdroid update".  You might also want to edit
977s "config.yml" to set the URL, repo name, and more.  You should also set up
977s a signing key (a temporary one might have been automatically generated).
977s 
977s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
977s and https://f-droid.org/docs/Signing_Process
977s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
977s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
977s + printf '\narchive_older: 3\n'
977s + echo 'servergitmirrors: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc'
977s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_5.apk repo/
977s + /usr/bin/fdroid update --create-metadata
978s 2024-03-26 05:45:52,983 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
978s 2024-03-26 05:45:53,063 INFO: Starting analysis on AndroidManifest.xml
978s 2024-03-26 05:45:53,071 INFO: APK file was successfully validated!
978s 2024-03-26 05:45:53,317 INFO: Starting analysis on AndroidManifest.xml
978s 2024-03-26 05:45:53,318 INFO: APK file was successfully validated!
978s 2024-03-26 05:45:53,563 INFO: Starting analysis on AndroidManifest.xml
978s 2024-03-26 05:45:53,564 INFO: APK file was successfully validated!
978s 2024-03-26 05:45:53,805 INFO: Generated skeleton metadata for com.politedroid
979s 2024-03-26 05:45:54,210 INFO: Creating signed index with this key (SHA256):
979s 2024-03-26 05:45:54,210 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
980s 2024-03-26 05:45:55,019 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
982s 2024-03-26 05:45:57,270 INFO: Creating signed index with this key (SHA256):
982s 2024-03-26 05:45:57,271 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
983s 2024-03-26 05:45:58,175 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
985s 2024-03-26 05:46:00,165 INFO: Finished
985s + /usr/bin/fdroid deploy
985s 2024-03-26 05:46:00,695 INFO: Mirroring to: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc
985s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/repo/com.politedroid_3.apk
985s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/repo/com.politedroid_4.apk
985s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/repo/com.politedroid_5.apk
985s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/repo/com.politedroid_3.apk
985s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/repo/com.politedroid_4.apk
985s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/repo/com.politedroid_5.apk
985s + date
985s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk repo/
985s + /usr/bin/fdroid update
986s 2024-03-26 05:46:01,183 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
986s 2024-03-26 05:46:01,261 INFO: Starting analysis on AndroidManifest.xml
986s 2024-03-26 05:46:01,270 INFO: APK file was successfully validated!
986s 2024-03-26 05:46:01,527 INFO: Moving com.politedroid_3.apk from repo to archive
987s 2024-03-26 05:46:02,031 INFO: Creating signed index with this key (SHA256):
987s 2024-03-26 05:46:02,031 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
988s 2024-03-26 05:46:03,244 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
990s 2024-03-26 05:46:05,278 INFO: Creating signed index with this key (SHA256):
990s 2024-03-26 05:46:05,278 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
991s 2024-03-26 05:46:06,284 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
992s 2024-03-26 05:46:07,930 INFO: Finished
993s + /usr/bin/fdroid deploy
993s 2024-03-26 05:46:08,457 INFO: Mirroring to: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/archive/com.politedroid_3.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/archive/com.politedroid_3.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/archive/com.politedroid_3.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/repo/com.politedroid_4.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/repo/com.politedroid_5.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/fdroid/repo/com.politedroid_6.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/repo/com.politedroid_4.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/repo/com.politedroid_5.apk
993s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/repo/com.politedroid_6.apk
993s ++ du -s --bytes /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/.git/
993s ++ awk '{print $1}'
993s + before=133076
993s + echo 'git_mirror_size_limit: 60kb'
993s + /usr/bin/fdroid update
993s 2024-03-26 05:46:08,958 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
994s 2024-03-26 05:46:09,365 INFO: Creating signed index with this key (SHA256):
994s 2024-03-26 05:46:09,365 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
995s 2024-03-26 05:46:10,374 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
997s 2024-03-26 05:46:12,429 INFO: Creating signed index with this key (SHA256):
997s 2024-03-26 05:46:12,434 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
998s 2024-03-26 05:46:13,350 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
1000s 2024-03-26 05:46:15,203 INFO: Finished
1000s + /usr/bin/fdroid deploy
1000s 2024-03-26 05:46:15,785 WARNING: Deleting git-mirror history, repo is too big (133076 max 60000)
1000s 2024-03-26 05:46:15,860 INFO: Mirroring to: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc
1001s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/archive/com.politedroid_3.apk
1001s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc/fdroid/archive/com.politedroid_3.apk
1001s ++ du -s --bytes /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/.git/
1001s ++ awk '{print $1}'
1001s + after=101407
1001s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror/.git/test-stamp
1001s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git -C /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LYqw/git-mirror gc
1001s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git -C /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.uPUc gc
1001s ==============================================================================
1001s sign binary repo in offline box, then publishing from online box
1001s + test 133076 -gt 101407
1001s + echo_header 'sign binary repo in offline box, then publishing from online box'
1001s ++ create_test_dir
1001s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1001s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1001s + OFFLINE_ROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm
1001s + KEYSTORE=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.p12
1001s ++ create_test_dir
1001s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1001s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1001s + LOCAL_COPY_DIR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid
1001s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid
1001s ++ create_test_dir
1001s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1001s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1001s + ONLINE_ROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0
1001s ++ create_test_dir
1001s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1001s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1001s + SERVERWEBROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.az6s/fdroid
1001s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm
1001s + mkdir binary_transparency
1001s + cd binary_transparency
1001s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1001s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency/.git/
1001s hint: Using 'master' as the name for the initial branch. This default branch name
1001s hint: is subject to change. To configure the initial branch name to use in all
1001s hint: of your new repositories, which will suppress this warning, call:
1001s hint: 
1001s hint: 	git config --global init.defaultBranch <name>
1001s hint: 
1001s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1001s hint: 'development'. The just-created branch can be renamed via this command:
1001s hint: 
1001s hint: 	git branch -m <name>
1001s ++ create_test_dir
1001s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1001s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1001s + BINARY_TRANSPARENCY_REMOTE=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv
1001s ++ create_test_dir
1001s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1001s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1001s + SERVER_GIT_MIRROR=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1
1001s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1
1001s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1001s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1/.git/
1001s hint: Using 'master' as the name for the initial branch. This default branch name
1001s hint: is subject to change. To configure the initial branch name to use in all
1001s hint: of your new repositories, which will suppress this warning, call:
1001s hint: 
1001s hint: 	git config --global init.defaultBranch <name>
1001s hint: 
1001s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1001s hint: 'development'. The just-created branch can be renamed via this command:
1001s hint: 
1001s hint: 	git branch -m <name>
1001s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git config receive.denyCurrentBranch updateInstead
1001s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm
1001s + fdroid_init_with_prebuilt_keystore
1001s + '[' -z '' ']'
1001s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
1001s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
1001s 2024-03-26 05:46:16,512 WARNING: 
1001s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
1001s Now set these in config.yml: keystorepass, keypass, keydname
1001s 
1001s 2024-03-26 05:46:16,512 INFO: 
1001s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm" with this config:
1001s 
1001s   Android SDK:			/usr/lib/android-sdk
1001s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
1001s   Alias for key in store:	sova
1001s 
1001s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/repo"
1001s then run "fdroid update -c; fdroid update".  You might also want to edit
1001s "config.yml" to set the URL, repo name, and more.  You should also set up
1001s a signing key (a temporary one might have been automatically generated).
1001s 
1001s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
1001s and https://f-droid.org/docs/Signing_Process
1001s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
1001s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
1001s + printf '\narchive_older: 3\n'
1001s + cp -a /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/stats /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/
1001s + mkdir /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/unsigned
1001s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/urzip-release-unsigned.apk /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/unsigned
1001s + echo 'mirrors: ['\''http://foo.bar/fdroid'\'', '\''http://asdflkdsfjafdsdfhkjh.onion/fdroid'\'']'
1001s + echo 'servergitmirrors: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1'
1001s + echo 'local_copy_dir: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid'
1001s + /usr/bin/fdroid update --pretty
1002s 2024-03-26 05:46:16,995 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
1002s 2024-03-26 05:46:17,159 INFO: Starting analysis on AndroidManifest.xml
1002s 2024-03-26 05:46:17,168 INFO: APK file was successfully validated!
1002s 2024-03-26 05:46:17,418 INFO: Starting analysis on AndroidManifest.xml
1002s 2024-03-26 05:46:17,419 INFO: APK file was successfully validated!
1002s 2024-03-26 05:46:17,688 INFO: Starting analysis on AndroidManifest.xml
1002s 2024-03-26 05:46:17,689 INFO: APK file was successfully validated!
1002s 2024-03-26 05:46:17,949 INFO: Starting analysis on AndroidManifest.xml
1002s 2024-03-26 05:46:17,949 INFO: APK file was successfully validated!
1003s 2024-03-26 05:46:18,233 INFO: Starting analysis on AndroidManifest.xml
1003s 2024-03-26 05:46:18,234 INFO: APK file was successfully validated!
1003s 2024-03-26 05:46:18,534 INFO: Starting analysis on AndroidManifest.xml
1003s 2024-03-26 05:46:18,536 INFO: APK file was successfully validated!
1003s 2024-03-26 05:46:18,544 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
1003s 2024-03-26 05:46:18,873 INFO: Starting analysis on AndroidManifest.xml
1003s 2024-03-26 05:46:18,874 INFO: APK file was successfully validated!
1004s 2024-03-26 05:46:19,125 INFO: Starting analysis on AndroidManifest.xml
1004s 2024-03-26 05:46:19,127 INFO: APK file was successfully validated!
1004s 2024-03-26 05:46:19,136 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
1004s 2024-03-26 05:46:19,397 INFO: Starting analysis on AndroidManifest.xml
1004s 2024-03-26 05:46:19,398 INFO: APK file was successfully validated!
1004s 2024-03-26 05:46:19,677 INFO: Starting analysis on AndroidManifest.xml
1004s 2024-03-26 05:46:19,678 INFO: APK file was successfully validated!
1004s 2024-03-26 05:46:19,933 INFO: Starting analysis on AndroidManifest.xml
1004s 2024-03-26 05:46:19,934 INFO: APK file was successfully validated!
1005s 2024-03-26 05:46:20,197 INFO: Starting analysis on AndroidManifest.xml
1005s 2024-03-26 05:46:20,198 INFO: APK file was successfully validated!
1005s 2024-03-26 05:46:20,448 INFO: Starting analysis on AndroidManifest.xml
1005s 2024-03-26 05:46:20,450 INFO: APK file was successfully validated!
1005s 2024-03-26 05:46:20,701 INFO: Starting analysis on AndroidManifest.xml
1005s 2024-03-26 05:46:20,702 INFO: APK file was successfully validated!
1005s 2024-03-26 05:46:20,956 INFO: Starting analysis on AndroidManifest.xml
1005s 2024-03-26 05:46:20,957 INFO: APK file was successfully validated!
1006s 2024-03-26 05:46:21,271 INFO: Starting analysis on AndroidManifest.xml
1006s 2024-03-26 05:46:21,273 INFO: APK file was successfully validated!
1006s 2024-03-26 05:46:21,807 INFO: Starting analysis on AndroidManifest.xml
1006s 2024-03-26 05:46:21,809 INFO: APK file was successfully validated!
1008s 2024-03-26 05:46:23,008 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata!
1008s 	Use `fdroid update -c` to create it.
1008s 2024-03-26 05:46:23,008 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata!
1008s 	Use `fdroid update -c` to create it.
1008s 2024-03-26 05:46:23,517 INFO: Creating signed index with this key (SHA256):
1008s 2024-03-26 05:46:23,517 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
1009s 2024-03-26 05:46:24,422 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
1011s 2024-03-26 05:46:26,031 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"!
1011s 2024-03-26 05:46:26,031 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"!
1011s 2024-03-26 05:46:26,033 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,033 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,033 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,033 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,033 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,033 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,034 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,035 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,036 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,036 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,036 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"!
1011s 2024-03-26 05:46:26,543 INFO: Creating signed index with this key (SHA256):
1011s 2024-03-26 05:46:26,543 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
1012s 2024-03-26 05:46:27,348 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
1012s 2024-03-26 05:46:27,354 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
1012s 2024-03-26 05:46:27,354 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
1013s 2024-03-26 05:46:28,061 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
1013s 2024-03-26 05:46:28,061 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
1013s 2024-03-26 05:46:28,885 INFO: Committing indexes to binary_transparency
1013s 2024-03-26 05:46:28,920 INFO: Finished
1014s + grep -F '<application id=' repo/index.xml
1014s + grep -F '/fdroid/repo</mirror>' repo/index.xml
1014s 		<mirror>http://foo.bar/fdroid/repo</mirror>
1014s 		<mirror>http://asdflkdsfjafdsdfhkjh.onion/fdroid/repo</mirror>
1014s + grep -F '/fdroid/archive</mirror>' archive/index.xml
1014s 		<mirror>http://foo.bar/fdroid/archive</mirror>
1014s 		<mirror>http://asdflkdsfjafdsdfhkjh.onion/fdroid/archive</mirror>
1014s ++ grep '<mirror>' repo/index.xml
1014s ++ wc -l
1014s + test 2 -eq 2
1014s ++ grep '<mirror>' archive/index.xml
1014s ++ wc -l
1014s + test 2 -eq 2
1014s + cd binary_transparency
1014s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD
1014s + '[' 1 == 1 ']'
1014s + cd ..
1014s + /usr/bin/fdroid deploy --verbose
1014s 2024-03-26 05:46:29,389 DEBUG: Reading 'config.yml'
1014s 2024-03-26 05:46:29,400 DEBUG: ipfs_cid not found, skipping CIDv1 generation
1014s 2024-03-26 05:46:29,400 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/
1014s sending incremental file list
1014s repo/
1014s repo/categories.txt
1014s repo/com.example.test.helloworld_1.apk
1014s repo/com.politedroid_3.apk
1014s repo/com.politedroid_4.apk
1014s repo/com.politedroid_5.apk
1014s repo/com.politedroid_6.apk
1014s repo/duplicate.permisssions_9999999.apk
1014s repo/entry.jar
1014s repo/entry.json
1014s repo/fake.ota.update_1234.zip
1014s repo/index-v1.jar
1014s repo/index-v1.json
1014s repo/index-v2.json
1014s repo/index.css
1014s repo/index.html
1014s repo/index.jar
1014s repo/index.png
1014s repo/index.xml
1014s repo/info.zwanenburg.caffeinetile_4.apk
1014s repo/main.1101613.obb.main.twoversions.obb
1014s repo/main.1101615.obb.main.twoversions.obb
1014s repo/main.1434483388.obb.main.oldversion.obb
1014s repo/main.1619.obb.mainpatch.current.obb
1014s repo/no.min.target.sdk_987.apk
1014s repo/obb.main.oldversion_1444412523.apk
1014s repo/obb.main.twoversions_1101613.apk
1014s repo/obb.main.twoversions_1101615.apk
1014s repo/obb.main.twoversions_1101617.apk
1014s repo/obb.main.twoversions_1101617_src.tar.gz
1014s repo/obb.mainpatch.current_1619.apk
1014s repo/obb.mainpatch.current_1619_another-release-key.apk
1014s repo/patch.1619.obb.mainpatch.current.obb
1014s repo/souch.smsbypass_9.apk
1014s repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
1014s repo/v1.v2.sig_1020.apk
1014s repo/icons-120/
1014s repo/icons-120/com.politedroid.3.png
1014s repo/icons-120/com.politedroid.4.png
1014s repo/icons-120/com.politedroid.5.png
1014s repo/icons-120/com.politedroid.6.png
1014s repo/icons-120/duplicate.permisssions.9999999.png
1014s repo/icons-120/info.guardianproject.urzip.100.png
1014s repo/icons-120/no.min.target.sdk.987.png
1014s repo/icons-120/obb.main.oldversion.1444412523.png
1014s repo/icons-120/obb.main.twoversions.1101613.png
1014s repo/icons-120/obb.main.twoversions.1101615.png
1014s repo/icons-120/obb.main.twoversions.1101617.png
1014s repo/icons-120/obb.mainpatch.current.1619.png
1014s repo/icons-120/souch.smsbypass.9.png
1014s repo/icons-120/v1.v2.sig.1020.png
1014s repo/icons-160/
1014s repo/icons-160/com.politedroid.3.png
1014s repo/icons-160/com.politedroid.4.png
1014s repo/icons-160/com.politedroid.5.png
1014s repo/icons-160/com.politedroid.6.png
1014s repo/icons-160/duplicate.permisssions.9999999.png
1014s repo/icons-160/info.guardianproject.urzip.100.png
1014s repo/icons-160/no.min.target.sdk.987.png
1014s repo/icons-160/obb.main.oldversion.1444412523.png
1014s repo/icons-160/obb.main.twoversions.1101613.png
1014s repo/icons-160/obb.main.twoversions.1101615.png
1014s repo/icons-160/obb.main.twoversions.1101617.png
1014s repo/icons-160/obb.mainpatch.current.1619.png
1014s repo/icons-160/souch.smsbypass.9.png
1014s repo/icons-160/v1.v2.sig.1020.png
1014s repo/icons-240/
1014s repo/icons-240/com.politedroid.3.png
1014s repo/icons-240/com.politedroid.4.png
1014s repo/icons-240/com.politedroid.5.png
1014s repo/icons-240/com.politedroid.6.png
1014s repo/icons-240/duplicate.permisssions.9999999.png
1014s repo/icons-240/info.guardianproject.urzip.100.png
1014s repo/icons-240/no.min.target.sdk.987.png
1014s repo/icons-240/obb.main.oldversion.1444412523.png
1014s repo/icons-240/obb.main.twoversions.1101613.png
1014s repo/icons-240/obb.main.twoversions.1101615.png
1014s repo/icons-240/obb.main.twoversions.1101617.png
1014s repo/icons-240/obb.mainpatch.current.1619.png
1014s repo/icons-240/souch.smsbypass.9.png
1014s repo/icons-240/v1.v2.sig.1020.png
1014s repo/icons-320/
1014s repo/icons-320/com.politedroid.3.png
1014s repo/icons-320/com.politedroid.4.png
1014s repo/icons-320/com.politedroid.5.png
1014s repo/icons-320/com.politedroid.6.png
1014s repo/icons-320/duplicate.permisssions.9999999.png
1014s repo/icons-320/info.guardianproject.urzip.100.png
1014s repo/icons-320/no.min.target.sdk.987.png
1014s repo/icons-320/obb.main.oldversion.1444412523.png
1014s repo/icons-320/obb.main.twoversions.1101613.png
1014s repo/icons-320/obb.main.twoversions.1101615.png
1014s repo/icons-320/obb.main.twoversions.1101617.png
1014s repo/icons-320/obb.mainpatch.current.1619.png
1014s repo/icons-320/souch.smsbypass.9.png
1014s repo/icons-320/v1.v2.sig.1020.png
1014s repo/icons-480/
1014s repo/icons-480/com.politedroid.3.png
1014s repo/icons-480/com.politedroid.4.png
1014s repo/icons-480/com.politedroid.5.png
1014s repo/icons-480/com.politedroid.6.png
1014s repo/icons-480/duplicate.permisssions.9999999.png
1014s repo/icons-480/info.guardianproject.urzip.100.png
1014s repo/icons-480/no.min.target.sdk.987.png
1014s repo/icons-480/obb.main.oldversion.1444412523.png
1014s repo/icons-480/obb.main.twoversions.1101613.png
1014s repo/icons-480/obb.main.twoversions.1101615.png
1014s repo/icons-480/obb.main.twoversions.1101617.png
1014s repo/icons-480/obb.mainpatch.current.1619.png
1014s repo/icons-480/souch.smsbypass.9.png
1014s repo/icons-480/v1.v2.sig.1020.png
1014s repo/icons-640/
1014s repo/icons-640/com.politedroid.3.png
1014s repo/icons-640/com.politedroid.4.png
1014s repo/icons-640/com.politedroid.5.png
1014s repo/icons-640/com.politedroid.6.png
1014s repo/icons-640/duplicate.permisssions.9999999.png
1014s repo/icons-640/info.guardianproject.urzip.100.png
1014s repo/icons-640/no.min.target.sdk.987.png
1014s repo/icons-640/obb.main.oldversion.1444412523.png
1014s repo/icons-640/obb.main.twoversions.1101613.png
1014s repo/icons-640/obb.main.twoversions.1101615.png
1014s repo/icons-640/obb.main.twoversions.1101617.png
1014s repo/icons-640/obb.mainpatch.current.1619.png
1014s repo/icons-640/souch.smsbypass.9.png
1014s repo/icons-640/v1.v2.sig.1020.png
1014s repo/icons/
1014s repo/icons/com.politedroid.3.png
1014s repo/icons/com.politedroid.4.png
1014s repo/icons/com.politedroid.5.png
1014s repo/icons/com.politedroid.6.png
1014s repo/icons/duplicate.permisssions.9999999.png
1014s repo/icons/icon.png
1014s repo/icons/info.guardianproject.urzip.100.png
1014s repo/icons/no.min.target.sdk.987.png
1014s repo/icons/obb.main.oldversion.1444412523.png
1014s repo/icons/obb.main.twoversions.1101613.png
1014s repo/icons/obb.main.twoversions.1101615.png
1014s repo/icons/obb.main.twoversions.1101617.png
1014s repo/icons/obb.mainpatch.current.1619.png
1014s repo/icons/souch.smsbypass.9.png
1014s repo/icons/v1.v2.sig.1020.png
1014s repo/info.guardianproject.checkey/
1014s repo/info.guardianproject.checkey/en-US/
1014s repo/info.guardianproject.checkey/en-US/phoneScreenshots/
1014s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png
1014s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png
1014s repo/info.guardianproject.urzip/
1014s repo/info.guardianproject.urzip/en-US/
1014s repo/info.guardianproject.urzip/en-US/featureGraphic.png
1014s repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png
1014s repo/info.guardianproject.urzip/en-US/icon.png
1014s repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png
1014s repo/obb.mainpatch.current/
1014s repo/obb.mainpatch.current/en-US/
1014s repo/obb.mainpatch.current/en-US/featureGraphic.png
1014s repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png
1014s repo/obb.mainpatch.current/en-US/icon.png
1014s repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png
1014s repo/obb.mainpatch.current/en-US/phoneScreenshots/
1014s repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png
1014s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/
1014s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
1014s repo/org.videolan.vlc/
1014s repo/org.videolan.vlc/en-US/
1014s repo/org.videolan.vlc/en-US/icon.png
1014s repo/org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png
1014s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png
1014s 2024-03-26 05:46:29,466 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency
1014s 2024-03-26 05:46:29,467 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None)
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png
1014s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png
1014s repo/status/
1014s repo/status/running.json
1014s repo/status/update.json
1014s 
1014s sent 3,728,057 bytes  received 3,462 bytes  7,463,038.00 bytes/sec
1014s total size is 3,709,734  speedup is 0.99
1014s 2024-03-26 05:46:29,471 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None)
1014s 2024-03-26 05:46:29,473 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None)
1014s 2024-03-26 05:46:29,499 DEBUG: Fetch head lines do not match lines provided via progress information
1014s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
1014s Will ignore extra progress lines or fetch head lines.
1014s 2024-03-26 05:46:29,500 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' * [new branch]      master     -> local/master']"
1014s 2024-03-26 05:46:29,500 DEBUG: b'head info: ["c2932d9bf6b5e699d823a76e586c33d4b08b22dd\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency\\n"]'
1014s 2024-03-26 05:46:29,506 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy`
1014s 2024-03-26 05:46:29,506 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose archive /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/
1014s sending incremental file list
1014s archive/
1014s archive/entry.jar
1014s archive/entry.json
1014s archive/index-v1.jar
1014s archive/index-v1.json
1014s archive/index-v2.json
1014s archive/index.css
1014s archive/index.html
1014s archive/index.jar
1014s archive/index.png
1014s archive/index.xml
1014s archive/icons-120/
1014s archive/icons-160/
1014s archive/icons-240/
1014s archive/icons-320/
1014s archive/icons-480/
1014s archive/icons-640/
1014s archive/icons/
1014s archive/icons/icon.png
1014s 
1014s sent 25,386 bytes  received 261 bytes  51,294.00 bytes/sec
1014s total size is 24,134  speedup is 0.94
1014s 2024-03-26 05:46:29,553 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency
1014s 2024-03-26 05:46:29,554 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None)
1014s 2024-03-26 05:46:29,556 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None)
1014s 2024-03-26 05:46:29,567 DEBUG: Fetch head lines do not match lines provided via progress information
1014s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
1014s Will ignore extra progress lines or fetch head lines.
1014s 2024-03-26 05:46:29,567 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' = [up to date]      master     -> local/master']"
1014s 2024-03-26 05:46:29,567 DEBUG: b'head info: ["c2932d9bf6b5e699d823a76e586c33d4b08b22dd\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency\\n"]'
1014s 2024-03-26 05:46:29,568 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy`
1014s 2024-03-26 05:46:29,568 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose unsigned /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/
1014s sending incremental file list
1014s unsigned/
1014s unsigned/urzip-release-unsigned.apk
1014s 
1014s sent 8,635 bytes  received 39 bytes  17,348.00 bytes/sec
1014s total size is 8,471  speedup is 0.98
1014s 2024-03-26 05:46:29,613 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency
1014s 2024-03-26 05:46:29,614 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None)
1014s 2024-03-26 05:46:29,616 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None)
1014s 2024-03-26 05:46:29,628 DEBUG: Fetch head lines do not match lines provided via progress information
1014s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
1014s Will ignore extra progress lines or fetch head lines.
1014s 2024-03-26 05:46:29,628 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' = [up to date]      master     -> local/master']"
1014s 2024-03-26 05:46:29,628 DEBUG: b'head info: ["c2932d9bf6b5e699d823a76e586c33d4b08b22dd\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.xVhm/binary_transparency\\n"]'
1014s 2024-03-26 05:46:29,628 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy`
1014s 2024-03-26 05:46:29,629 DEBUG: skip deploying full build logs: not enabled in config
1014s 2024-03-26 05:46:29,629 DEBUG: skip deploying full build logs: not enabled in config
1014s 2024-03-26 05:46:29,629 DEBUG: skip deploying full build logs: not enabled in config
1014s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/unsigned/urzip-release-unsigned.apk
1014s + grep -F '<application id=' /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/repo/index.xml
1014s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0
1014s + echo 'local_copy_dir: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid'
1014s + echo 'sync_from_local_copy_dir: True'
1014s + echo 'serverwebroot: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.az6s/fdroid'
1014s + echo 'servergitmirrors: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1'
1014s + echo 'binary_transparency_remote: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv'
1014s + /usr/bin/fdroid deploy --verbose
1015s 2024-03-26 05:46:30,046 DEBUG: Reading 'config.yml'
1015s 2024-03-26 05:46:30,049 DEBUG: ipfs_cid not found, skipping CIDv1 generation
1015s 2024-03-26 05:46:30,049 INFO: Syncing from local_copy_dir to this repo.
1015s 2024-03-26 05:46:30,049 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/repo/ repo/
1015s sending incremental file list
1015s created directory repo
1015s ./
1015s categories.txt
1015s com.example.test.helloworld_1.apk
1015s com.politedroid_3.apk
1015s com.politedroid_4.apk
1015s com.politedroid_5.apk
1015s com.politedroid_6.apk
1015s duplicate.permisssions_9999999.apk
1015s entry.jar
1015s entry.json
1015s fake.ota.update_1234.zip
1015s index-v1.jar
1015s index-v1.json
1015s index-v2.json
1015s index.css
1015s index.html
1015s index.jar
1015s index.png
1015s index.xml
1015s info.zwanenburg.caffeinetile_4.apk
1015s main.1101613.obb.main.twoversions.obb
1015s main.1101615.obb.main.twoversions.obb
1015s main.1434483388.obb.main.oldversion.obb
1015s main.1619.obb.mainpatch.current.obb
1015s no.min.target.sdk_987.apk
1015s obb.main.oldversion_1444412523.apk
1015s obb.main.twoversions_1101613.apk
1015s obb.main.twoversions_1101615.apk
1015s obb.main.twoversions_1101617.apk
1015s obb.main.twoversions_1101617_src.tar.gz
1015s obb.mainpatch.current_1619.apk
1015s obb.mainpatch.current_1619_another-release-key.apk
1015s patch.1619.obb.mainpatch.current.obb
1015s souch.smsbypass_9.apk
1015s urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
1015s v1.v2.sig_1020.apk
1015s icons-120/
1015s icons-120/com.politedroid.3.png
1015s icons-120/com.politedroid.4.png
1015s icons-120/com.politedroid.5.png
1015s icons-120/com.politedroid.6.png
1015s icons-120/duplicate.permisssions.9999999.png
1015s icons-120/info.guardianproject.urzip.100.png
1015s icons-120/no.min.target.sdk.987.png
1015s icons-120/obb.main.oldversion.1444412523.png
1015s icons-120/obb.main.twoversions.1101613.png
1015s icons-120/obb.main.twoversions.1101615.png
1015s icons-120/obb.main.twoversions.1101617.png
1015s icons-120/obb.mainpatch.current.1619.png
1015s icons-120/souch.smsbypass.9.png
1015s icons-120/v1.v2.sig.1020.png
1015s icons-160/
1015s icons-160/com.politedroid.3.png
1015s icons-160/com.politedroid.4.png
1015s icons-160/com.politedroid.5.png
1015s icons-160/com.politedroid.6.png
1015s icons-160/duplicate.permisssions.9999999.png
1015s icons-160/info.guardianproject.urzip.100.png
1015s icons-160/no.min.target.sdk.987.png
1015s icons-160/obb.main.oldversion.1444412523.png
1015s icons-160/obb.main.twoversions.1101613.png
1015s icons-160/obb.main.twoversions.1101615.png
1015s icons-160/obb.main.twoversions.1101617.png
1015s icons-160/obb.mainpatch.current.1619.png
1015s icons-160/souch.smsbypass.9.png
1015s icons-160/v1.v2.sig.1020.png
1015s icons-240/
1015s icons-240/com.politedroid.3.png
1015s icons-240/com.politedroid.4.png
1015s icons-240/com.politedroid.5.png
1015s icons-240/com.politedroid.6.png
1015s icons-240/duplicate.permisssions.9999999.png
1015s icons-240/info.guardianproject.urzip.100.png
1015s icons-240/no.min.target.sdk.987.png
1015s icons-240/obb.main.oldversion.1444412523.png
1015s icons-240/obb.main.twoversions.1101613.png
1015s icons-240/obb.main.twoversions.1101615.png
1015s icons-240/obb.main.twoversions.1101617.png
1015s icons-240/obb.mainpatch.current.1619.png
1015s icons-240/souch.smsbypass.9.png
1015s icons-240/v1.v2.sig.1020.png
1015s icons-320/
1015s icons-320/com.politedroid.3.png
1015s icons-320/com.politedroid.4.png
1015s icons-320/com.politedroid.5.png
1015s icons-320/com.politedroid.6.png
1015s icons-320/duplicate.permisssions.9999999.png
1015s icons-320/info.guardianproject.urzip.100.png
1015s icons-320/no.min.target.sdk.987.png
1015s icons-320/obb.main.oldversion.1444412523.png
1015s icons-320/obb.main.twoversions.1101613.png
1015s icons-320/obb.main.twoversions.1101615.png
1015s icons-320/obb.main.twoversions.1101617.png
1015s icons-320/obb.mainpatch.current.1619.png
1015s icons-320/souch.smsbypass.9.png
1015s icons-320/v1.v2.sig.1020.png
1015s icons-480/
1015s icons-480/com.politedroid.3.png
1015s icons-480/com.politedroid.4.png
1015s icons-480/com.politedroid.5.png
1015s icons-480/com.politedroid.6.png
1015s icons-480/duplicate.permisssions.9999999.png
1015s icons-480/info.guardianproject.urzip.100.png
1015s icons-480/no.min.target.sdk.987.png
1015s icons-480/obb.main.oldversion.1444412523.png
1015s icons-480/obb.main.twoversions.1101613.png
1015s icons-480/obb.main.twoversions.1101615.png
1015s icons-480/obb.main.twoversions.1101617.png
1015s icons-480/obb.mainpatch.current.1619.png
1015s icons-480/souch.smsbypass.9.png
1015s icons-480/v1.v2.sig.1020.png
1015s icons-640/
1015s icons-640/com.politedroid.3.png
1015s icons-640/com.politedroid.4.png
1015s icons-640/com.politedroid.5.png
1015s icons-640/com.politedroid.6.png
1015s icons-640/duplicate.permisssions.9999999.png
1015s icons-640/info.guardianproject.urzip.100.png
1015s icons-640/no.min.target.sdk.987.png
1015s icons-640/obb.main.oldversion.1444412523.png
1015s icons-640/obb.main.twoversions.1101613.png
1015s icons-640/obb.main.twoversions.1101615.png
1015s icons-640/obb.main.twoversions.1101617.png
1015s icons-640/obb.mainpatch.current.1619.png
1015s icons-640/souch.smsbypass.9.png
1015s icons-640/v1.v2.sig.1020.png
1015s icons/
1015s icons/com.politedroid.3.png
1015s icons/com.politedroid.4.png
1015s icons/com.politedroid.5.png
1015s icons/com.politedroid.6.png
1015s icons/duplicate.permisssions.9999999.png
1015s icons/icon.png
1015s icons/info.guardianproject.urzip.100.png
1015s icons/no.min.target.sdk.987.png
1015s icons/obb.main.oldversion.1444412523.png
1015s icons/obb.main.twoversions.1101613.png
1015s icons/obb.main.twoversions.1101615.png
1015s icons/obb.main.twoversions.1101617.png
1015s icons/obb.mainpatch.current.1619.png
1015s icons/souch.smsbypass.9.png
1015s icons/v1.v2.sig.1020.png
1015s info.guardianproject.checkey/
1015s info.guardianproject.checkey/en-US/
1015s info.guardianproject.checkey/en-US/phoneScreenshots/
1015s info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png
1015s info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png
1015s info.guardianproject.urzip/
1015s info.guardianproject.urzip/en-US/
1015s info.guardianproject.urzip/en-US/featureGraphic.png
1015s info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png
1015s 2024-03-26 05:46:30,112 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency
1015s 2024-03-26 05:46:30,113 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,118 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,119 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency, universal_newlines=True, shell=None, istream=None)
1015s info.guardianproject.urzip/en-US/icon.png
1015s info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png
1015s obb.mainpatch.current/
1015s obb.mainpatch.current/en-US/
1015s obb.mainpatch.current/en-US/featureGraphic.png
1015s obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png
1015s obb.mainpatch.current/en-US/icon.png
1015s obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png
1015s obb.mainpatch.current/en-US/phoneScreenshots/
1015s obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png
1015s obb.mainpatch.current/en-US/sevenInchScreenshots/
1015s obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
1015s org.videolan.vlc/
1015s org.videolan.vlc/en-US/
1015s org.videolan.vlc/en-US/icon.png
1015s org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png
1015s org.videolan.vlc/en-US/phoneScreenshots/
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png
1015s status/
1015s status/running.json
1015s status/update.json
1015s 
1015s sent 3,728,005 bytes  received 3,488 bytes  7,462,986.00 bytes/sec
1015s total size is 3,709,734  speedup is 0.99
1015s 2024-03-26 05:46:30,146 DEBUG: Fetch head lines do not match lines provided via progress information
1015s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
1015s Will ignore extra progress lines or fetch head lines.
1015s 2024-03-26 05:46:30,146 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' * [new branch]      master     -> local/master']"
1015s 2024-03-26 05:46:30,146 DEBUG: b'head info: ["c2932d9bf6b5e699d823a76e586c33d4b08b22dd\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency\\n"]'
1015s 2024-03-26 05:46:30,146 INFO: rsyncing repo to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.az6s/fdroid/
1015s building file list ... done
1015s created directory /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.az6s/fdroid
1015s repo/
1015s repo/categories.txt
1015s repo/com.example.test.helloworld_1.apk
1015s repo/com.politedroid_3.apk
1015s repo/com.politedroid_4.apk
1015s repo/com.politedroid_5.apk
1015s repo/com.politedroid_6.apk
1015s repo/duplicate.permisssions_9999999.apk
1015s repo/fake.ota.update_1234.zip
1015s repo/index.css
1015s repo/index.html
1015s repo/index.png
1015s repo/info.zwanenburg.caffeinetile_4.apk
1015s repo/main.1101613.obb.main.twoversions.obb
1015s repo/main.1101615.obb.main.twoversions.obb
1015s repo/main.1434483388.obb.main.oldversion.obb
1015s repo/main.1619.obb.mainpatch.current.obb
1015s repo/no.min.target.sdk_987.apk
1015s repo/obb.main.oldversion_1444412523.apk
1015s repo/obb.main.twoversions_1101613.apk
1015s repo/obb.main.twoversions_1101615.apk
1015s repo/obb.main.twoversions_1101617.apk
1015s repo/obb.main.twoversions_1101617_src.tar.gz
1015s repo/obb.mainpatch.current_1619.apk
1015s repo/obb.mainpatch.current_1619_another-release-key.apk
1015s repo/patch.1619.obb.mainpatch.current.obb
1015s repo/souch.smsbypass_9.apk
1015s repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
1015s repo/v1.v2.sig_1020.apk
1015s repo/icons-120/
1015s repo/icons-120/com.politedroid.3.png
1015s repo/icons-120/com.politedroid.4.png
1015s repo/icons-120/com.politedroid.5.png
1015s repo/icons-120/com.politedroid.6.png
1015s repo/icons-120/duplicate.permisssions.9999999.png
1015s repo/icons-120/info.guardianproject.urzip.100.png
1015s repo/icons-120/no.min.target.sdk.987.png
1015s repo/icons-120/obb.main.oldversion.1444412523.png
1015s repo/icons-120/obb.main.twoversions.1101613.png
1015s repo/icons-120/obb.main.twoversions.1101615.png
1015s repo/icons-120/obb.main.twoversions.1101617.png
1015s repo/icons-120/obb.mainpatch.current.1619.png
1015s repo/icons-120/souch.smsbypass.9.png
1015s repo/icons-120/v1.v2.sig.1020.png
1015s repo/icons-160/
1015s repo/icons-160/com.politedroid.3.png
1015s repo/icons-160/com.politedroid.4.png
1015s repo/icons-160/com.politedroid.5.png
1015s repo/icons-160/com.politedroid.6.png
1015s repo/icons-160/duplicate.permisssions.9999999.png
1015s repo/icons-160/info.guardianproject.urzip.100.png
1015s repo/icons-160/no.min.target.sdk.987.png
1015s repo/icons-160/obb.main.oldversion.1444412523.png
1015s repo/icons-160/obb.main.twoversions.1101613.png
1015s repo/icons-160/obb.main.twoversions.1101615.png
1015s repo/icons-160/obb.main.twoversions.1101617.png
1015s repo/icons-160/obb.mainpatch.current.1619.png
1015s repo/icons-160/souch.smsbypass.9.png
1015s repo/icons-160/v1.v2.sig.1020.png
1015s repo/icons-240/
1015s repo/icons-240/com.politedroid.3.png
1015s repo/icons-240/com.politedroid.4.png
1015s repo/icons-240/com.politedroid.5.png
1015s repo/icons-240/com.politedroid.6.png
1015s repo/icons-240/duplicate.permisssions.9999999.png
1015s repo/icons-240/info.guardianproject.urzip.100.png
1015s repo/icons-240/no.min.target.sdk.987.png
1015s repo/icons-240/obb.main.oldversion.1444412523.png
1015s repo/icons-240/obb.main.twoversions.1101613.png
1015s repo/icons-240/obb.main.twoversions.1101615.png
1015s repo/icons-240/obb.main.twoversions.1101617.png
1015s repo/icons-240/obb.mainpatch.current.1619.png
1015s repo/icons-240/souch.smsbypass.9.png
1015s repo/icons-240/v1.v2.sig.1020.png
1015s repo/icons-320/
1015s repo/icons-320/com.politedroid.3.png
1015s repo/icons-320/com.politedroid.4.png
1015s repo/icons-320/com.politedroid.5.png
1015s repo/icons-320/com.politedroid.6.png
1015s repo/icons-320/duplicate.permisssions.9999999.png
1015s repo/icons-320/info.guardianproject.urzip.100.png
1015s repo/icons-320/no.min.target.sdk.987.png
1015s repo/icons-320/obb.main.oldversion.1444412523.png
1015s repo/icons-320/obb.main.twoversions.1101613.png
1015s repo/icons-320/obb.main.twoversions.1101615.png
1015s repo/icons-320/obb.main.twoversions.1101617.png
1015s repo/icons-320/obb.mainpatch.current.1619.png
1015s repo/icons-320/souch.smsbypass.9.png
1015s repo/icons-320/v1.v2.sig.1020.png
1015s repo/icons-480/
1015s repo/icons-480/com.politedroid.3.png
1015s repo/icons-480/com.politedroid.4.png
1015s repo/icons-480/com.politedroid.5.png
1015s repo/icons-480/com.politedroid.6.png
1015s repo/icons-480/duplicate.permisssions.9999999.png
1015s repo/icons-480/info.guardianproject.urzip.100.png
1015s repo/icons-480/no.min.target.sdk.987.png
1015s repo/icons-480/obb.main.oldversion.1444412523.png
1015s repo/icons-480/obb.main.twoversions.1101613.png
1015s repo/icons-480/obb.main.twoversions.1101615.png
1015s repo/icons-480/obb.main.twoversions.1101617.png
1015s repo/icons-480/obb.mainpatch.current.1619.png
1015s repo/icons-480/souch.smsbypass.9.png
1015s repo/icons-480/v1.v2.sig.1020.png
1015s repo/icons-640/
1015s repo/icons-640/com.politedroid.3.png
1015s repo/icons-640/com.politedroid.4.png
1015s repo/icons-640/com.politedroid.5.png
1015s repo/icons-640/com.politedroid.6.png
1015s repo/icons-640/duplicate.permisssions.9999999.png
1015s repo/icons-640/info.guardianproject.urzip.100.png
1015s repo/icons-640/no.min.target.sdk.987.png
1015s repo/icons-640/obb.main.oldversion.1444412523.png
1015s repo/icons-640/obb.main.twoversions.1101613.png
1015s repo/icons-640/obb.main.twoversions.1101615.png
1015s repo/icons-640/obb.main.twoversions.1101617.png
1015s repo/icons-640/obb.mainpatch.current.1619.png
1015s repo/icons-640/souch.smsbypass.9.png
1015s repo/icons-640/v1.v2.sig.1020.png
1015s repo/icons/
1015s repo/icons/com.politedroid.3.png
1015s repo/icons/com.politedroid.4.png
1015s repo/icons/com.politedroid.5.png
1015s repo/icons/com.politedroid.6.png
1015s repo/icons/duplicate.permisssions.9999999.png
1015s repo/icons/icon.png
1015s repo/icons/info.guardianproject.urzip.100.png
1015s repo/icons/no.min.target.sdk.987.png
1015s repo/icons/obb.main.oldversion.1444412523.png
1015s repo/icons/obb.main.twoversions.1101613.png
1015s repo/icons/obb.main.twoversions.1101615.png
1015s repo/icons/obb.main.twoversions.1101617.png
1015s repo/icons/obb.mainpatch.current.1619.png
1015s repo/icons/souch.smsbypass.9.png
1015s repo/icons/v1.v2.sig.1020.png
1015s repo/info.guardianproject.checkey/
1015s repo/info.guardianproject.checkey/en-US/
1015s repo/info.guardianproject.checkey/en-US/phoneScreenshots/
1015s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png
1015s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png
1015s repo/info.guardianproject.urzip/
1015s repo/info.guardianproject.urzip/en-US/
1015s repo/info.guardianproject.urzip/en-US/featureGraphic.png
1015s repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png
1015s repo/info.guardianproject.urzip/en-US/icon.png
1015s repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png
1015s repo/obb.mainpatch.current/
1015s repo/obb.mainpatch.current/en-US/
1015s repo/obb.mainpatch.current/en-US/featureGraphic.png
1015s repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png
1015s repo/obb.mainpatch.current/en-US/icon.png
1015s repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png
1015s repo/obb.mainpatch.current/en-US/phoneScreenshots/
1015s repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png
1015s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/
1015s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
1015s repo/org.videolan.vlc/
1015s repo/org.videolan.vlc/en-US/
1015s repo/org.videolan.vlc/en-US/icon.png
1015s repo/org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png
1015s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png
1015s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png
1015s repo/status/
1015s repo/status/running.json
1015s repo/status/update.json
1015s 
1015s sent 3,629,212 bytes  received 3,347 bytes  7,265,118.00 bytes/sec
1015s total size is 3,611,566  speedup is 0.99
1015s building file list ... done
1015s repo/entry.jar
1015s repo/entry.json
1015s repo/index-v1.jar
1015s repo/index-v1.json
1015s repo/index-v2.json
1015s repo/index.jar
1015s repo/index.xml
1015s 
1015s sent 108,483 bytes  received 144 bytes  217,254.00 bytes/sec
1015s total size is 3,709,734  speedup is 34.15
1015s 2024-03-26 05:46:30,251 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo/ git-mirror/fdroid/repo/
1015s sending incremental file list
1015s ./
1015s categories.txt
1015s com.example.test.helloworld_1.apk
1015s com.politedroid_3.apk
1015s com.politedroid_4.apk
1015s com.politedroid_5.apk
1015s com.politedroid_6.apk
1015s duplicate.permisssions_9999999.apk
1015s entry.jar
1015s entry.json
1015s fake.ota.update_1234.zip
1015s index-v1.jar
1015s index-v1.json
1015s index-v2.json
1015s index.css
1015s index.html
1015s index.jar
1015s index.png
1015s index.xml
1015s info.zwanenburg.caffeinetile_4.apk
1015s main.1101613.obb.main.twoversions.obb
1015s main.1101615.obb.main.twoversions.obb
1015s main.1434483388.obb.main.oldversion.obb
1015s main.1619.obb.mainpatch.current.obb
1015s no.min.target.sdk_987.apk
1015s obb.main.oldversion_1444412523.apk
1015s obb.main.twoversions_1101613.apk
1015s obb.main.twoversions_1101615.apk
1015s obb.main.twoversions_1101617.apk
1015s obb.main.twoversions_1101617_src.tar.gz
1015s obb.mainpatch.current_1619.apk
1015s obb.mainpatch.current_1619_another-release-key.apk
1015s patch.1619.obb.mainpatch.current.obb
1015s souch.smsbypass_9.apk
1015s urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk
1015s v1.v2.sig_1020.apk
1015s icons-120/
1015s icons-120/com.politedroid.3.png
1015s icons-120/com.politedroid.4.png
1015s icons-120/com.politedroid.5.png
1015s icons-120/com.politedroid.6.png
1015s icons-120/duplicate.permisssions.9999999.png
1015s icons-120/info.guardianproject.urzip.100.png
1015s icons-120/no.min.target.sdk.987.png
1015s icons-120/obb.main.oldversion.1444412523.png
1015s icons-120/obb.main.twoversions.1101613.png
1015s icons-120/obb.main.twoversions.1101615.png
1015s icons-120/obb.main.twoversions.1101617.png
1015s icons-120/obb.mainpatch.current.1619.png
1015s icons-120/souch.smsbypass.9.png
1015s icons-120/v1.v2.sig.1020.png
1015s icons-160/
1015s icons-160/com.politedroid.3.png
1015s icons-160/com.politedroid.4.png
1015s icons-160/com.politedroid.5.png
1015s icons-160/com.politedroid.6.png
1015s icons-160/duplicate.permisssions.9999999.png
1015s icons-160/info.guardianproject.urzip.100.png
1015s icons-160/no.min.target.sdk.987.png
1015s icons-160/obb.main.oldversion.1444412523.png
1015s icons-160/obb.main.twoversions.1101613.png
1015s icons-160/obb.main.twoversions.1101615.png
1015s icons-160/obb.main.twoversions.1101617.png
1015s icons-160/obb.mainpatch.current.1619.png
1015s icons-160/souch.smsbypass.9.png
1015s icons-160/v1.v2.sig.1020.png
1015s icons-240/
1015s icons-240/com.politedroid.3.png
1015s icons-240/com.politedroid.4.png
1015s icons-240/com.politedroid.5.png
1015s icons-240/com.politedroid.6.png
1015s icons-240/duplicate.permisssions.9999999.png
1015s icons-240/info.guardianproject.urzip.100.png
1015s icons-240/no.min.target.sdk.987.png
1015s icons-240/obb.main.oldversion.1444412523.png
1015s icons-240/obb.main.twoversions.1101613.png
1015s icons-240/obb.main.twoversions.1101615.png
1015s icons-240/obb.main.twoversions.1101617.png
1015s icons-240/obb.mainpatch.current.1619.png
1015s icons-240/souch.smsbypass.9.png
1015s icons-240/v1.v2.sig.1020.png
1015s icons-320/
1015s icons-320/com.politedroid.3.png
1015s icons-320/com.politedroid.4.png
1015s icons-320/com.politedroid.5.png
1015s icons-320/com.politedroid.6.png
1015s icons-320/duplicate.permisssions.9999999.png
1015s icons-320/info.guardianproject.urzip.100.png
1015s icons-320/no.min.target.sdk.987.png
1015s icons-320/obb.main.oldversion.1444412523.png
1015s icons-320/obb.main.twoversions.1101613.png
1015s icons-320/obb.main.twoversions.1101615.png
1015s icons-320/obb.main.twoversions.1101617.png
1015s icons-320/obb.mainpatch.current.1619.png
1015s icons-320/souch.smsbypass.9.png
1015s icons-320/v1.v2.sig.1020.png
1015s icons-480/
1015s icons-480/com.politedroid.3.png
1015s icons-480/com.politedroid.4.png
1015s icons-480/com.politedroid.5.png
1015s icons-480/com.politedroid.6.png
1015s icons-480/duplicate.permisssions.9999999.png
1015s icons-480/info.guardianproject.urzip.100.png
1015s icons-480/no.min.target.sdk.987.png
1015s icons-480/obb.main.oldversion.1444412523.png
1015s icons-480/obb.main.twoversions.1101613.png
1015s icons-480/obb.main.twoversions.1101615.png
1015s icons-480/obb.main.twoversions.1101617.png
1015s icons-480/obb.mainpatch.current.1619.png
1015s icons-480/souch.smsbypass.9.png
1015s icons-480/v1.v2.sig.1020.png
1015s icons-640/
1015s icons-640/com.politedroid.3.png
1015s icons-640/com.politedroid.4.png
1015s icons-640/com.politedroid.5.png
1015s icons-640/com.politedroid.6.png
1015s icons-640/duplicate.permisssions.9999999.png
1015s icons-640/info.guardianproject.urzip.100.png
1015s icons-640/no.min.target.sdk.987.png
1015s icons-640/obb.main.oldversion.1444412523.png
1015s icons-640/obb.main.twoversions.1101613.png
1015s icons-640/obb.main.twoversions.1101615.png
1015s icons-640/obb.main.twoversions.1101617.png
1015s icons-640/obb.mainpatch.current.1619.png
1015s icons-640/souch.smsbypass.9.png
1015s icons-640/v1.v2.sig.1020.png
1015s icons/
1015s icons/com.politedroid.3.png
1015s icons/com.politedroid.4.png
1015s icons/com.politedroid.5.png
1015s icons/com.politedroid.6.png
1015s icons/duplicate.permisssions.9999999.png
1015s icons/icon.png
1015s icons/info.guardianproject.urzip.100.png
1015s icons/no.min.target.sdk.987.png
1015s icons/obb.main.oldversion.1444412523.png
1015s icons/obb.main.twoversions.1101613.png
1015s icons/obb.main.twoversions.1101615.png
1015s icons/obb.main.twoversions.1101617.png
1015s icons/obb.mainpatch.current.1619.png
1015s icons/souch.smsbypass.9.png
1015s icons/v1.v2.sig.1020.png
1015s info.guardianproject.checkey/
1015s info.guardianproject.checkey/en-US/
1015s info.guardianproject.checkey/en-US/phoneScreenshots/
1015s info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png
1015s info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png
1015s info.guardianproject.urzip/
1015s info.guardianproject.urzip/en-US/
1015s info.guardianproject.urzip/en-US/featureGraphic.png
1015s info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png
1015s info.guardianproject.urzip/en-US/icon.png
1015s info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png
1015s obb.mainpatch.current/
1015s obb.mainpatch.current/en-US/
1015s obb.mainpatch.current/en-US/featureGraphic.png
1015s obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png
1015s obb.mainpatch.current/en-US/icon.png
1015s obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png
1015s obb.mainpatch.current/en-US/phoneScreenshots/
1015s obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png
1015s obb.mainpatch.current/en-US/sevenInchScreenshots/
1015s obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
1015s org.videolan.vlc/
1015s org.videolan.vlc/en-US/
1015s org.videolan.vlc/en-US/icon.png
1015s org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png
1015s org.videolan.vlc/en-US/phoneScreenshots/
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png
1015s org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png
1015s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png
1015s status/
1015s status/running.json
1015s status/update.json
1015s 2024-03-26 05:46:30,311 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=False, shell=None, istream=None)
1015s 
1015s sent 3,728,005 bytes  received 3,453 bytes  7,462,916.00 bytes/sec
1015s total size is 3,709,734  speedup is 0.99
1015s 2024-03-26 05:46:30,315 DEBUG: Popen(['git', 'remote', 'add', '--', 'autopkgtest', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,317 INFO: Mirroring to: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1
1015s 2024-03-26 05:46:30,317 DEBUG: Adding all files to git mirror
1015s 2024-03-26 05:46:30,317 DEBUG: Popen(['git', 'add', '--all'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,437 DEBUG: Committing all files into git mirror
1015s 2024-03-26 05:46:30,443 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=False, shell=None, istream=<valid stream>)
1015s 2024-03-26 05:46:30,445 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=False, shell=None, istream=<valid stream>)
1015s 2024-03-26 05:46:30,451 DEBUG: Pushing to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1
1015s 2024-03-26 05:46:30,451 DEBUG: Popen(['git', 'version'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,453 DEBUG: Popen(['git', 'push', '--porcelain', '--force', '--set-upstream', '--progress', '--', 'autopkgtest', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/git-mirror, universal_newlines=True, shell=None, istream=None)
1015s 2024-03-26 05:46:30,703 DEBUG: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1: [new branch]
1015s 
1015s 2024-03-26 05:46:30,704 INFO: Syncing from local_copy_dir to this repo.
1015s 2024-03-26 05:46:30,704 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/unsigned/ unsigned/
1015s sending incremental file list
1015s created directory unsigned
1015s ./
1015s urzip-release-unsigned.apk
1015s 
1015s sent 8,617 bytes  received 69 bytes  17,372.00 bytes/sec
1015s total size is 8,471  speedup is 0.98
1015s 2024-03-26 05:46:30,749 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency
1015s 2024-03-26 05:46:30,750 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,753 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency, universal_newlines=True, shell=None, istream=None)
1015s 2024-03-26 05:46:30,766 DEBUG: Fetch head lines do not match lines provided via progress information
1015s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
1015s Will ignore extra progress lines or fetch head lines.
1015s 2024-03-26 05:46:30,766 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' = [up to date]      master     -> local/master']"
1015s 2024-03-26 05:46:30,766 DEBUG: b'head info: ["c2932d9bf6b5e699d823a76e586c33d4b08b22dd\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.G4a6/fdroid/binary_transparency\\n"]'
1015s 2024-03-26 05:46:30,766 INFO: rsyncing unsigned to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.az6s/fdroid/
1015s building file list ... done
1015s unsigned/
1015s unsigned/urzip-release-unsigned.apk
1015s 
1015s sent 8,658 bytes  received 37 bytes  17,390.00 bytes/sec
1015s total size is 8,471  speedup is 0.97
1015s building file list ... done
1015s 
1015s sent 137 bytes  received 11 bytes  296.00 bytes/sec
1015s total size is 8,471  speedup is 57.24
1015s 2024-03-26 05:46:30,858 INFO: Pushing binary transparency log to /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv
1015s 2024-03-26 05:46:30,858 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,862 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv, universal_newlines=False, shell=None, istream=None)
1015s 2024-03-26 05:46:30,864 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv, universal_newlines=True, shell=None, istream=None)
1015s 2024-03-26 05:46:30,898 DEBUG: Fetch head lines do not match lines provided via progress information
1015s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1
1015s Will ignore extra progress lines or fetch head lines.
1015s 2024-03-26 05:46:30,898 DEBUG: b"info lines: [' * branch            master     -> FETCH_HEAD', ' * [new branch]      master     -> local/master']"
1015s 2024-03-26 05:46:30,898 DEBUG: b'head info: ["c2932d9bf6b5e699d823a76e586c33d4b08b22dd\\t\\tbranch \'master\' of /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/binary_transparency\\n"]'
1015s 2024-03-26 05:46:30,899 DEBUG: skip deploying full build logs: not enabled in config
1015s 2024-03-26 05:46:30,899 DEBUG: skip deploying full build logs: not enabled in config
1015s 2024-03-26 05:46:30,899 DEBUG: skip deploying full build logs: not enabled in config
1016s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.zhd0/unsigned/urzip-release-unsigned.apk
1016s + test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.az6s/fdroid/unsigned/urzip-release-unsigned.apk
1016s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.qEDv
1016s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD
1016s + '[' 1 == 1 ']'
1016s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.hpw1
1016s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD
1016s + '[' 1 == 1 ']'
1016s + echo_header 'test extracting and publishing with developer signature'
1016s + use_apksigner
1016s + python3 -c '
1016s import sys
1016s sys.path.insert(0, '\''/tmp/autopkgtest.tyZAgp/build.nAO/src'\'')
1016s from fdroidserver import common
1016s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''}
1016s common.find_apksigner(c)
1016s exit(c.get('\''apksigner'\'') is None)
1016s '
1016s ==============================================================================
1016s test extracting and publishing with developer signature
1016s ++ create_test_dir
1016s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1016s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1016s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Rt0D
1016s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Rt0D
1016s + fdroid_init_with_prebuilt_keystore
1016s + '[' -z '' ']'
1016s + keystore=/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
1016s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks --repo-keyalias=sova
1016s 2024-03-26 05:46:31,732 WARNING: 
1016s Using existing keystore "/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks"
1016s Now set these in config.yml: keystorepass, keypass, keydname
1016s 
1016s 2024-03-26 05:46:31,732 INFO: 
1016s Built repo based in "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Rt0D" with this config:
1016s 
1016s   Android SDK:			/usr/lib/android-sdk
1016s   Keystore for signing key:	/tmp/autopkgtest.tyZAgp/build.nAO/src/tests/keystore.jks
1016s   Alias for key in store:	sova
1016s 
1016s To complete the setup, add your APKs to "/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Rt0D/repo"
1016s then run "fdroid update -c; fdroid update".  You might also want to edit
1016s "config.yml" to set the URL, repo name, and more.  You should also set up
1016s a signing key (a temporary one might have been automatically generated).
1016s 
1016s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo
1016s and https://f-droid.org/docs/Signing_Process
1016s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
1016s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI='
1016s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"'
1016s + test -d metadata
1016s + mkdir metadata
1016s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/metadata/com.politedroid.yml metadata/
1016s + test -d repo
1016s + test -d unsigned
1016s + mkdir unsigned
1016s + cp /tmp/autopkgtest.tyZAgp/build.nAO/src/tests/repo/com.politedroid_6.apk unsigned/
1016s + /usr/bin/fdroid signatures unsigned/com.politedroid_6.apk
1017s 2024-03-26 05:46:32,540 INFO: Fetched signatures for 'unsigned/com.politedroid_6.apk' -> 'metadata/com.politedroid/signatures/6'
1017s + test -d metadata/com.politedroid/signatures/6
1017s + test -f metadata/com.politedroid/signatures/6/MANIFEST.MF
1017s + test -f metadata/com.politedroid/signatures/6/RELEASE.RSA
1017s + test -f metadata/com.politedroid/signatures/6/RELEASE.SF
1017s + test -f repo/com.politedroid_6.apk
1017s + /usr/bin/fdroid publish
1018s 2024-03-26 05:46:32,995 INFO: Creating log directory
1018s 2024-03-26 05:46:33,000 INFO: 1 app, 1 key aliases
1018s 2024-03-26 05:46:33,000 INFO: Processing unsigned/com.politedroid_6.apk
1018s 2024-03-26 05:46:33,257 INFO: Key alias: 4e7da5b7
1019s 2024-03-26 05:46:34,266 INFO: Published com.politedroid_6.apk
1020s 2024-03-26 05:46:35,473 INFO: published list signing-key fingerprints
1020s + test -f repo/com.politedroid_6.apk
1020s + which apksigner
1020s /usr/bin/apksigner
1020s + apksigner verify repo/com.politedroid_6.apk
1020s + which jarsigner
1020s /usr/bin/jarsigner
1020s + jarsigner -verify repo/com.politedroid_6.apk
1021s 
1021s The jar will be treated as unsigned, because it is signed with a weak algorithm that is now disabled.
1021s 
1021s Re-run jarsigner with the -verbose option for more details.
1021s + echo_header 'test mirroring a repo'
1021s ==============================================================================
1021s test mirroring a repo
1021s + which wget
1021s /usr/bin/wget
1021s ++ create_test_dir
1021s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1021s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1021s + TESTROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Jkyk
1021s ++ create_test_dir
1021s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1021s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1021s + REPOROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Ffta
1021s + cp -r /tmp/autopkgtest.tyZAgp/build.nAO/src/tests /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Jkyk
1021s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Jkyk/tests
1021s + test -d archive
1021s + mkdir archive
1021s + cp repo/index-v1.json /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Ffta/
1021s + /usr/bin/fdroid update
1021s 2024-03-26 05:46:36,522 WARNING: config.py is deprecated, use config.yml
1021s 2024-03-26 05:46:36,525 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml".
1021s 2024-03-26 05:46:36,655 INFO: Starting analysis on AndroidManifest.xml
1021s 2024-03-26 05:46:36,663 INFO: APK file was successfully validated!
1021s 2024-03-26 05:46:36,938 INFO: Starting analysis on AndroidManifest.xml
1021s 2024-03-26 05:46:36,939 INFO: APK file was successfully validated!
1022s 2024-03-26 05:46:37,220 INFO: Starting analysis on AndroidManifest.xml
1022s 2024-03-26 05:46:37,221 INFO: APK file was successfully validated!
1022s 2024-03-26 05:46:37,491 INFO: Starting analysis on AndroidManifest.xml
1022s 2024-03-26 05:46:37,492 INFO: APK file was successfully validated!
1022s 2024-03-26 05:46:37,773 INFO: Starting analysis on AndroidManifest.xml
1022s 2024-03-26 05:46:37,774 INFO: APK file was successfully validated!
1023s 2024-03-26 05:46:38,055 INFO: Starting analysis on AndroidManifest.xml
1023s 2024-03-26 05:46:38,057 INFO: APK file was successfully validated!
1023s 2024-03-26 05:46:38,064 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true"
1023s 2024-03-26 05:46:38,353 INFO: Starting analysis on AndroidManifest.xml
1023s 2024-03-26 05:46:38,354 INFO: APK file was successfully validated!
1023s 2024-03-26 05:46:38,620 INFO: Starting analysis on AndroidManifest.xml
1023s 2024-03-26 05:46:38,621 INFO: APK file was successfully validated!
1023s 2024-03-26 05:46:38,630 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3).
1023s 2024-03-26 05:46:38,913 INFO: Starting analysis on AndroidManifest.xml
1023s 2024-03-26 05:46:38,915 INFO: APK file was successfully validated!
1024s 2024-03-26 05:46:39,268 INFO: Starting analysis on AndroidManifest.xml
1024s 2024-03-26 05:46:39,270 INFO: APK file was successfully validated!
1024s 2024-03-26 05:46:39,791 INFO: Starting analysis on AndroidManifest.xml
1024s 2024-03-26 05:46:39,793 INFO: APK file was successfully validated!
1025s 2024-03-26 05:46:40,106 INFO: Starting analysis on AndroidManifest.xml
1025s 2024-03-26 05:46:40,107 INFO: APK file was successfully validated!
1025s 2024-03-26 05:46:40,460 INFO: Starting analysis on AndroidManifest.xml
1025s 2024-03-26 05:46:40,462 INFO: APK file was successfully validated!
1025s 2024-03-26 05:46:40,742 INFO: Starting analysis on AndroidManifest.xml
1025s 2024-03-26 05:46:40,744 INFO: APK file was successfully validated!
1026s 2024-03-26 05:46:41,030 INFO: Starting analysis on AndroidManifest.xml
1026s 2024-03-26 05:46:41,031 INFO: APK file was successfully validated!
1026s 2024-03-26 05:46:41,388 INFO: Starting analysis on AndroidManifest.xml
1026s 2024-03-26 05:46:41,389 INFO: APK file was successfully validated!
1026s 2024-03-26 05:46:41,674 INFO: Starting analysis on AndroidManifest.xml
1026s 2024-03-26 05:46:41,675 INFO: APK file was successfully validated!
1027s 2024-03-26 05:46:41,983 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata!
1027s 	Use `fdroid update -c` to create it.
1027s 2024-03-26 05:46:41,983 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata!
1027s 	Use `fdroid update -c` to create it.
1027s 2024-03-26 05:46:42,492 INFO: Creating signed index with this key (SHA256):
1027s 2024-03-26 05:46:42,492 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
1028s 2024-03-26 05:46:43,396 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
1030s 2024-03-26 05:46:45,122 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"!
1030s 2024-03-26 05:46:45,122 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"!
1030s 2024-03-26 05:46:45,124 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,124 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,125 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,126 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,127 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,127 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"!
1030s 2024-03-26 05:46:45,639 INFO: Creating signed index with this key (SHA256):
1030s 2024-03-26 05:46:45,639 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6
1031s 2024-03-26 05:46:46,786 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder.
1031s 2024-03-26 05:46:46,796 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
1031s 2024-03-26 05:46:46,797 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
1032s 2024-03-26 05:46:47,614 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk
1032s 2024-03-26 05:46:47,615 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk
1033s 2024-03-26 05:46:48,542 INFO: Finished
1033s + /usr/bin/fdroid signindex
1034s 2024-03-26 05:46:49,170 WARNING: config.py is deprecated, use config.yml
1035s 2024-03-26 05:46:50,179 INFO: Signed repo/index-v1.json
1035s 2024-03-26 05:46:50,584 INFO: Signed repo/entry.json
1036s 2024-03-26 05:46:51,292 INFO: Signed archive/index-v1.json
1036s 2024-03-26 05:46:51,694 INFO: Signed archive/entry.json
1036s + mv /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Ffta/index-v1.json repo/index-v1.json
1036s + port=32162
1036s ++ printf 32162
1036s ++ wc -m
1036s + test 5 -le 3
1036s + http_server_pid=28064
1036s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Ffta
1036s + http_proxy=
1036s + HTTP_PROXY=
1036s + /usr/bin/fdroid mirror http://127.0.0.1:32162/
1036s + timeout 5m python3 -m http.server 32162 --bind 127.0.0.1
1037s 2024-03-26 05:46:52,164 WARNING: http://127.0.0.1:32162/ does not end with "fdroid", check the URL path!
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/com.politedroid_6.apk [16578/16578] -> "com.politedroid_6.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/com.politedroid_5.apk [18817/18817] -> "com.politedroid_5.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/com.politedroid_4.apk [18489/18489] -> "com.politedroid_4.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/com.politedroid_3.apk [17552/17552] -> "com.politedroid_3.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/duplicate.permisssions_9999999.apk [27446/27446] -> "duplicate.permisssions_9999999.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/fake.ota.update_1234.zip [233/233] -> "fake.ota.update_1234.zip" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/urzip-;%20%D0%A0%D0%B0%D1%85%D0%BC%D0%B0%CC%81,%20[r%C9%90x%CB%88man%CA%B2%C9%AAn%C9%99f]%20%D8%B3%D9%8A%D8%B1%D8%AC%D9%8A_%D8%B1%D8%AE%D9%85%D8%A7%D9%86%D9%8A%D9%86%D9%88%D9%81%20%E8%B0%A2%C2%B7.apk [11471/11471] -> "urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/info.zwanenburg.caffeinetile_4.apk [11740/11740] -> "info.zwanenburg.caffeinetile_4.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/no.min.target.sdk_987.apk [14102/14102] -> "no.min.target.sdk_987.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.main.oldversion_1444412523.apk [14323/14323] -> "obb.main.oldversion_1444412523.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.main.twoversions_1101617.apk [11481/11481] -> "obb.main.twoversions_1101617.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.main.twoversions_1101615.apk [11480/11480] -> "obb.main.twoversions_1101615.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.main.twoversions_1101613.apk [11477/11477] -> "obb.main.twoversions_1101613.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.mainpatch.current_1619.apk [11479/11479] -> "obb.mainpatch.current_1619.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.mainpatch.current_1619_another-release-key.apk [10541/10541] -> "obb.mainpatch.current_1619_another-release-key.apk" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/souch.smsbypass_9.apk [81295/81295] -> "souch.smsbypass_9.apk" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.01s
1037s Downloaded: 16 files, 282K in 0s (1.29 GB/s)
1037s http://127.0.0.1:32162/repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png [44990/44990] -> "screenshot-main.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.001s
1037s Downloaded: 1 files, 44K in 0s (2.20 GB/s)
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png [56049/56049] -> "screenshot-tablet-main.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.001s
1037s Downloaded: 1 files, 55K in 0s (1.19 GB/s)
1037s http://127.0.0.1:32162/repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s 2024-03-26 05:46:52,234 ERROR: no "icon" in info.zwanenburg.caffeinetile
1037s 2024-03-26 05:46:52,234 ERROR: no "icon" in fake.ota.update
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/souch.smsbypass.9.png [1558/1558] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/com.politedroid.6.png [559/559] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.006s
1037s Downloaded: 8 files, 9.9K in 0s (267 MB/s)
1037s http://127.0.0.1:32162/repo/icons-65534/souch.smsbypass.9.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/duplicate.permisssions.9999999.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/no.min.target.sdk.987.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/obb.main.oldversion.1444412523.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/obb.main.twoversions.1101617.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/obb.mainpatch.current.1619.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/com.politedroid.6.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s http://127.0.0.1:32162/repo/icons-65534/info.guardianproject.urzip.100.png:
1037s 2024-03-26 05:46:52 ERROR 404: File not found.
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/souch.smsbypass.9.png [5874/5874] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-640/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.006s
1037s Downloaded: 8 files, 15K in 0s (410 MB/s)
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/souch.smsbypass.9.png [5874/5874] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-480/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.006s
1037s Downloaded: 8 files, 15K in 0s (249 MB/s)
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/souch.smsbypass.9.png [3615/3615] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-320/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.006s
1037s Downloaded: 8 files, 13K in 0s (356 MB/s)
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/souch.smsbypass.9.png [2264/2264] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/com.politedroid.6.png [910/910] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-240/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.005s
1037s Downloaded: 8 files, 11K in 0s (278 MB/s)
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/souch.smsbypass.9.png [1558/1558] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/com.politedroid.6.png [559/559] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-160/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.005s
1037s Downloaded: 8 files, 9.9K in 0s (300 MB/s)
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/souch.smsbypass.9.png [1335/1335] -> "souch.smsbypass.9.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/com.politedroid.6.png [357/357] -> "com.politedroid.6.png" [1]
1037s 2024-03-26 05:46:52 URL:http://127.0.0.1:32162/repo/icons-120/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1]
1037s FINISHED --2024-03-26 05:46:52--
1037s Total wall clock time: 0.006s
1037s Downloaded: 8 files, 9.5K in 0s (266 MB/s)
1037s + test -e 127.0.0.1:32162/repo/souch.smsbypass_9.apk
1037s + test -e 127.0.0.1:32162/repo/icons-640/souch.smsbypass.9.png
1037s + test -e 127.0.0.1:32162/repo/index-v1.jar
1037s + http_proxy=
1037s + HTTP_PROXY=
1037s + /usr/bin/fdroid mirror 'http://127.0.0.1:32162/?fingerprint=asdfasdf'
1037s 2024-03-26 05:46:52,768 WARNING: http://127.0.0.1:32162/?fingerprint=asdfasdf does not end with "fdroid", check the URL path!
1038s 2024-03-26 05:46:53,358 CRITICAL: The repository's fingerprint does not match.
1038s + test -e 127.0.0.1:32162/repo/index-v1.jar
1038s + http_proxy=
1038s + HTTP_PROXY=
1038s + /usr/bin/fdroid mirror 'http://127.0.0.1:32162/?fingerprint=F49AF3F11EFDDF20DFFD70F5E3117B9976674167ADCA280E6B1932A0601B26F6'
1038s 2024-03-26 05:46:53,810 WARNING: http://127.0.0.1:32162/?fingerprint=F49AF3F11EFDDF20DFFD70F5E3117B9976674167ADCA280E6B1932A0601B26F6 does not end with "fdroid", check the URL path!
1039s 2024-03-26 05:46:54 URL:http://127.0.0.1:32162/repo/index-v1.jar [8356/8356] -> "index-v1.jar" [1]
1039s FINISHED --2024-03-26 05:46:54--
1039s Total wall clock time: 0.002s
1039s Downloaded: 1 files, 8.2K in 0s (906 MB/s)
1039s http://127.0.0.1:32162/repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s 2024-03-26 05:46:54,286 ERROR: no "icon" in info.zwanenburg.caffeinetile
1039s 2024-03-26 05:46:54,286 ERROR: no "icon" in fake.ota.update
1039s http://127.0.0.1:32162/repo/icons-65534/souch.smsbypass.9.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/duplicate.permisssions.9999999.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/no.min.target.sdk.987.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/obb.main.oldversion.1444412523.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/obb.main.twoversions.1101617.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/obb.mainpatch.current.1619.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/com.politedroid.6.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s http://127.0.0.1:32162/repo/icons-65534/info.guardianproject.urzip.100.png:
1039s 2024-03-26 05:46:54 ERROR 404: File not found.
1039s + test -e 127.0.0.1:32162/repo/index-v1.jar
1039s + kill -9 28064
1039s + rm -f 127.0.0.1:32162/repo/com.politedroid_3.apk 127.0.0.1:32162/repo/com.politedroid_4.apk 127.0.0.1:32162/repo/com.politedroid_5.apk 127.0.0.1:32162/repo/com.politedroid_6.apk 127.0.0.1:32162/repo/duplicate.permisssions_9999999.apk 127.0.0.1:32162/repo/info.zwanenburg.caffeinetile_4.apk 127.0.0.1:32162/repo/no.min.target.sdk_987.apk 127.0.0.1:32162/repo/obb.main.oldversion_1444412523.apk 127.0.0.1:32162/repo/obb.main.twoversions_1101613.apk 127.0.0.1:32162/repo/obb.main.twoversions_1101615.apk 127.0.0.1:32162/repo/obb.main.twoversions_1101617.apk 127.0.0.1:32162/repo/obb.mainpatch.current_1619.apk 127.0.0.1:32162/repo/obb.mainpatch.current_1619_another-release-key.apk 127.0.0.1:32162/repo/souch.smsbypass_9.apk '127.0.0.1:32162/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk' 127.0.0.1:32162/repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 127.0.0.1:32162/repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png
1039s ./tests/run-tests: line 1314: 28064 Killed                  timeout 5m python3 -m http.server $port --bind 127.0.0.1 > $REPOROOT/http.server.log 2>&1  (wd: /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.Jkyk/tests)
1039s + sleep 1
1040s + echo_header 'Test recovering from from broken git submodules'
1040s + export GIT_ALLOW_PROTOCOL=file
1040s + GIT_ALLOW_PROTOCOL=file
1040s ++ create_test_dir
1040s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1040s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1040s ==============================================================================
1040s Test recovering from from broken git submodules
1040s + ROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO
1040s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO
1040s + mkdir foo bar
1040s + cd foo
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1040s hint: Using 'master' as the name for the initial branch. This default branch name
1040s hint: is subject to change. To configure the initial branch name to use in all
1040s hint: of your new repositories, which will suppress this warning, call:
1040s hint: 
1040s hint: 	git config --global init.defaultBranch <name>
1040s hint: 
1040s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1040s hint: 'development'. The just-created branch can be renamed via this command:
1040s hint: 
1040s hint: 	git branch -m <name>
1040s + echo a
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add a
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m a
1040s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO/foo/.git/
1040s [master (root-commit) 8fee641] a
1040s  1 file changed, 1 insertion(+)
1040s  create mode 100644 a
1040s + cd ../bar
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1040s hint: Using 'master' as the name for the initial branch. This default branch name
1040s hint: is subject to change. To configure the initial branch name to use in all
1040s hint: of your new repositories, which will suppress this warning, call:
1040s hint: 
1040s hint: 	git config --global init.defaultBranch <name>
1040s hint: 
1040s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1040s hint: 'development'. The just-created branch can be renamed via this command:
1040s hint: 
1040s hint: 	git branch -m <name>
1040s ++ pwd
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO/bar/../foo baz
1040s Cloning into '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO/bar/baz'...
1040s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO/bar/.git/
1040s + rm .gitmodules
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am a
1040s [master (root-commit) a5b7f6b] a
1040s  1 file changed, 1 insertion(+)
1040s  create mode 160000 baz
1040s + rm -rf baz
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git checkout baz
1040s Updated 1 path from the index
1040s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 2
1040s + cd ..
1040s + mkdir repo
1040s + mkdir metadata
1040s + echo 'RepoType: git'
1040s ++ pwd
1040s + echo 'Repo: file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.LzrO/bar'
1040s + echo 'AutoUpdateMode: Version'
1040s + echo 'UpdateCheckMode: Tags'
1040s + echo 'UpdateCheckData: '\''|||'\'''
1040s + echo 'CurrentVersion: 1'
1040s + echo 'CurrentVersionCode: 1'
1040s + /usr/bin/fdroid checkupdates --allow-dirty
1040s 2024-03-26 05:46:55,954 INFO: Processing fake
1045s 2024-03-26 05:47:00,391 INFO: ...updating to version 2 (2)
1045s + grep 'CurrentVersionCode: 2' metadata/fake.yml
1045s + echo_header 'checkupdates ignore broken submodule'
1045s ++ create_test_dir
1045s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1045s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1045s + ROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU
1045s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU
1045s + mkdir foo bar
1045s + cd foo
1045s CurrentVersionCode: 2
1045s ==============================================================================
1045s checkupdates ignore broken submodule
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1045s hint: Using 'master' as the name for the initial branch. This default branch name
1045s hint: is subject to change. To configure the initial branch name to use in all
1045s hint: of your new repositories, which will suppress this warning, call:
1045s hint: 
1045s hint: 	git config --global init.defaultBranch <name>
1045s hint: 
1045s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1045s hint: 'development'. The just-created branch can be renamed via this command:
1045s hint: 
1045s hint: 	git branch -m <name>
1045s + echo a
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add a
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m a
1045s + cd ../bar
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1045s hint: Using 'master' as the name for the initial branch. This default branch name
1045s hint: is subject to change. To configure the initial branch name to use in all
1045s hint: of your new repositories, which will suppress this warning, call:
1045s hint: 
1045s hint: 	git config --global init.defaultBranch <name>
1045s hint: 
1045s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1045s hint: 'development'. The just-created branch can be renamed via this command:
1045s hint: 
1045s hint: 	git branch -m <name>
1045s ++ pwd
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU/bar/../foo baz
1045s Cloning into '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU/bar/baz'...
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am a
1045s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU/foo/.git/
1045s [master (root-commit) d5f89c3] a
1045s  1 file changed, 1 insertion(+)
1045s  create mode 100644 a
1045s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU/bar/.git/
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 2
1045s [master (root-commit) e723196] a
1045s  2 files changed, 4 insertions(+)
1045s  create mode 100644 .gitmodules
1045s  create mode 160000 baz
1045s + cd ../foo
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit --amend -m aa
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git reflog expire --expire=now --all
1045s [master c537f33] aa
1045s  Date: Tue Mar 26 05:47:00 2024 +0000
1045s  1 file changed, 1 insertion(+)
1045s  create mode 100644 a
1045s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git gc --aggressive --prune=now
1045s + cd ..
1045s + mkdir repo
1045s + mkdir metadata
1045s + echo 'RepoType: git'
1045s ++ pwd
1045s + echo 'Repo: file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.7TZU/bar'
1045s + echo Builds:
1045s + echo '   - versionName: 1'
1045s + echo '     versionCode: 1'
1045s + echo '     submodules: true'
1045s + echo 'AutoUpdateMode: Version'
1045s + echo 'UpdateCheckMode: Tags'
1045s + echo 'UpdateCheckData: '\''|||'\'''
1045s + echo 'CurrentVersion: 1'
1045s + echo 'CurrentVersionCode: 1'
1045s + /usr/bin/fdroid checkupdates --allow-dirty
1045s 2024-03-26 05:47:00,925 INFO: Processing fake
1047s 2024-03-26 05:47:02,133 INFO: submodule broken for fake
1049s 2024-03-26 05:47:04,659 INFO: submodule broken for fake
1051s 2024-03-26 05:47:06,476 INFO: ...updating to version 2 (2)
1051s CurrentVersionCode: 2
1051s ==============================================================================
1051s checkupdates check version in submodule
1051s + grep 'CurrentVersionCode: 2' metadata/fake.yml
1051s + echo_header 'checkupdates check version in submodule'
1051s ++ create_test_dir
1051s ++ test -e /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles
1051s ++ mktemp -d /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.XXXX
1051s + ROOT=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC
1051s + cd /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC
1051s + mkdir app sub
1051s + cd sub
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1051s hint: Using 'master' as the name for the initial branch. This default branch name
1051s hint: is subject to change. To configure the initial branch name to use in all
1051s hint: of your new repositories, which will suppress this warning, call:
1051s hint: 
1051s hint: 	git config --global init.defaultBranch <name>
1051s hint: 
1051s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1051s hint: 'development'. The just-created branch can be renamed via this command:
1051s hint: 
1051s hint: 	git branch -m <name>
1051s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/sub/.git/
1051s + echo 1
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add ver
1051s [master (root-commit) 750e85f] 1
1051s  1 file changed, 1 insertion(+)
1051s  create mode 100644 ver
1051s Initialized empty Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app/.git/
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m 1
1051s + cd ../app
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1051s hint: Using 'master' as the name for the initial branch. This default branch name
1051s hint: is subject to change. To configure the initial branch name to use in all
1051s hint: of your new repositories, which will suppress this warning, call:
1051s hint: 
1051s hint: 	git config --global init.defaultBranch <name>
1051s hint: 
1051s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and
1051s hint: 'development'. The just-created branch can be renamed via this command:
1051s hint: 
1051s hint: 	git branch -m <name>
1051s ++ pwd
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app/../sub
1051s Cloning into '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app/sub'...
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 1
1051s [master (root-commit) 37ebc10] 1
1051s  2 files changed, 4 insertions(+)
1051s  create mode 100644 .gitmodules
1051s  create mode 160000 sub
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 1
1051s + cd ../sub
1051s + echo 2
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 2
1051s [master 70470c2] 2
1051s  1 file changed, 1 insertion(+), 1 deletion(-)
1051s + cd ../app
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init
1051s Reinitialized existing Git repository in /tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app/.git/
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule update --remote
1051s From file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app/../sub
1051s    750e85f..70470c2  master     -> origin/master
1051s Submodule path 'sub': checked out '70470c2d9fea1140f6bdc320d04fbdc1b34d5997'
1051s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 2
1051s [master c4640b6] 2
1051s  1 file changed, 1 insertion(+), 1 deletion(-)
1051s + cd ..
1051s + mkdir repo
1051s + mkdir metadata
1051s + cat
1051s ++ pwd
1051s + /usr/bin/fdroid checkupdates --allow-dirty --auto -v
1052s 2024-03-26 05:47:07,070 DEBUG: ipfs_cid not found, skipping CIDv1 generation
1052s 2024-03-26 05:47:07,072 INFO: Processing fake
1052s 2024-03-26 05:47:07,072 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app build/fake
1052s Cloning into 'build/fake'...
1052s 2024-03-26 05:47:07,176 DEBUG: Directory: build/fake
1052s 2024-03-26 05:47:07,176 DEBUG: > git rev-parse --show-toplevel
1052s 2024-03-26 05:47:07,377 DEBUG: Directory: build/fake
1052s 2024-03-26 05:47:07,377 DEBUG: > git checkout -f origin/HEAD
1052s 2024-03-26 05:47:07,579 DEBUG: Directory: build/fake
1052s 2024-03-26 05:47:07,579 DEBUG: > git clean -dffx
1052s 2024-03-26 05:47:07,680 DEBUG: Directory: build/fake
1052s 2024-03-26 05:47:07,680 DEBUG: > git rev-parse --show-toplevel
1052s 2024-03-26 05:47:07,882 DEBUG: Directory: build/fake
1052s 2024-03-26 05:47:07,882 DEBUG: > git submodule sync
1053s 2024-03-26 05:47:07,983 DEBUG: Directory: build/fake
1053s 2024-03-26 05:47:07,983 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org submodule update --init --force --recursive
1053s Submodule 'sub' (file:///tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/app/../sub) registered for path 'sub'
1053s Cloning into '/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/build/fake/sub'...
1053s Submodule path 'sub': checked out '70470c2d9fea1140f6bdc320d04fbdc1b34d5997'
1053s 2024-03-26 05:47:08,184 DEBUG: Directory: build/fake
1053s 2024-03-26 05:47:08,184 DEBUG: > git rev-parse --show-toplevel
1053s 2024-03-26 05:47:08,388 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/build/fake, universal_newlines=False, shell=None, istream=<valid stream>)
1053s 2024-03-26 05:47:08,389 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/build/fake, universal_newlines=False, shell=None, istream=<valid stream>)
1053s 2024-03-26 05:47:08,390 DEBUG: All tags: 1
1053s 2024-03-26 05:47:08,391 DEBUG: Check tag: '1'
1053s 2024-03-26 05:47:08,391 DEBUG: Directory: build/fake
1053s 2024-03-26 05:47:08,391 DEBUG: > git rev-parse --show-toplevel
1053s 2024-03-26 05:47:08,592 DEBUG: Directory: build/fake
1053s 2024-03-26 05:47:08,592 DEBUG: > git submodule foreach --recursive git reset --hard
1053s 2024-03-26 05:47:08,793 DEBUG: Directory: build/fake
1053s 2024-03-26 05:47:08,793 DEBUG: > git reset --hard
1054s 2024-03-26 05:47:08,994 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:08,994 DEBUG: > git submodule foreach --recursive git clean -dffx
1054s 2024-03-26 05:47:09,196 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,196 DEBUG: > git clean -dffx
1054s 2024-03-26 05:47:09,199 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,200 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch origin
1054s 2024-03-26 05:47:09,301 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,301 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org remote prune origin
1054s 2024-03-26 05:47:09,402 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,402 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin
1054s 2024-03-26 05:47:09,503 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,503 DEBUG: > git remote set-head origin --auto
1054s 2024-03-26 05:47:09,705 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,705 DEBUG: > git checkout -f 1
1054s 2024-03-26 05:47:09,906 DEBUG: Directory: build/fake
1054s 2024-03-26 05:47:09,907 DEBUG: > git clean -dffx
1055s 2024-03-26 05:47:10,008 DEBUG: Directory: build/fake
1055s 2024-03-26 05:47:10,008 DEBUG: > git rev-parse --show-toplevel
1055s 2024-03-26 05:47:10,210 DEBUG: Directory: build/fake
1055s 2024-03-26 05:47:10,210 DEBUG: > git submodule sync
1055s 2024-03-26 05:47:10,411 DEBUG: Directory: build/fake
1055s 2024-03-26 05:47:10,412 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org submodule update --init --force --recursive
1055s Submodule path 'sub': checked out '750e85f1179d7c0794a5ad0683dac5cf64ca0476'
1055s 2024-03-26 05:47:10,613 DEBUG: UpdateCheckData found version 1 (1)
1055s 2024-03-26 05:47:10,613 DEBUG: Directory: build/fake
1055s 2024-03-26 05:47:10,613 DEBUG: > git rev-parse --show-toplevel
1055s 2024-03-26 05:47:10,816 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.tyZAgp/build.nAO/src/.testfiles/run-tests.9UyC/build/fake, universal_newlines=False, shell=None, istream=<valid stream>)
1055s 2024-03-26 05:47:10,817 DEBUG: ...updating - old vercode=0, new vercode=1
1055s 2024-03-26 05:47:10,817 DEBUG: Directory: build/fake
1055s 2024-03-26 05:47:10,818 DEBUG: > git rev-parse --show-toplevel
1056s 2024-03-26 05:47:11,019 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,019 DEBUG: > git submodule foreach --recursive git reset --hard
1056s 2024-03-26 05:47:11,220 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,221 DEBUG: > git reset --hard
1056s 2024-03-26 05:47:11,422 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,422 DEBUG: > git submodule foreach --recursive git clean -dffx
1056s 2024-03-26 05:47:11,623 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,623 DEBUG: > git clean -dffx
1056s 2024-03-26 05:47:11,625 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,625 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch origin
1056s 2024-03-26 05:47:11,726 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,726 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org remote prune origin
1056s 2024-03-26 05:47:11,827 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,827 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin
1056s 2024-03-26 05:47:11,929 DEBUG: Directory: build/fake
1056s 2024-03-26 05:47:11,929 DEBUG: > git remote set-head origin --auto
1057s 2024-03-26 05:47:12,130 DEBUG: Directory: build/fake
1057s 2024-03-26 05:47:12,130 DEBUG: > git checkout -f 37ebc1022aaff618495607fb77b7be33d4018246
1057s 2024-03-26 05:47:12,331 DEBUG: Directory: build/fake
1057s 2024-03-26 05:47:12,331 DEBUG: > git clean -dffx
1057s 2024-03-26 05:47:12,432 DEBUG: ...fetch auto name from build/fake
1057s 2024-03-26 05:47:12,433 DEBUG: ...couldn't get autoname
1057s 2024-03-26 05:47:12,433 INFO: ...updating to version 1 (1)
1057s 2024-03-26 05:47:12,433 INFO: ...auto-generating build for 1
1057s 2024-03-26 05:47:12,436 DEBUG: Outputting JSON
1057s 2024-03-26 05:47:12,437 DEBUG: skip deploying full build logs: not enabled in config
1057s 2024-03-26 05:47:12,437 DEBUG: skip deploying full build logs: not enabled in config
1057s 2024-03-26 05:47:12,437 DEBUG: skip deploying full build logs: not enabled in config
1057s + grep 'CurrentVersionCode: 1' metadata/fake.yml
1057s CurrentVersionCode: 1
1057s + unset GIT_ALLOW_PROTOCOL
1057s + echo SUCCESS
1057s + err_handler
1057s SUCCESS
1057s + set +x
1058s autopkgtest [05:47:13]: test command1: -----------------------]
1058s autopkgtest [05:47:13]: test command1:  - - - - - - - - - - results - - - - - - - - - -
1058s command1             PASS
1059s autopkgtest [05:47:14]: test locales: preparing testbed
1139s autopkgtest [05:48:34]: testbed dpkg architecture: arm64
1139s autopkgtest [05:48:34]: testbed apt version: 2.7.12
1139s autopkgtest [05:48:34]: @@@@@@@@@@@@@@@@@@@@ test bed setup
1140s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB]
1141s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [4000 kB]
1141s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [495 kB]
1141s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [56.0 kB]
1141s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [7592 B]
1141s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 Packages [713 kB]
1141s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 c-n-f Metadata [3144 B]
1141s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 Packages [43.0 kB]
1141s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 c-n-f Metadata [116 B]
1141s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 Packages [4305 kB]
1141s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 c-n-f Metadata [8528 B]
1141s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 Packages [70.5 kB]
1141s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 c-n-f Metadata [116 B]
1143s Fetched 9819 kB in 2s (4622 kB/s)
1143s Reading package lists...
1145s Reading package lists...
1146s Building dependency tree...
1146s Reading state information...
1147s Calculating upgrade...
1147s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1148s Reading package lists...
1148s Building dependency tree...
1148s Reading state information...
1149s 0 upgraded, 0 newly installed, 0 to remove and 240 not upgraded.
1150s sh: Attempting to set up Debian/Ubuntu apt sources automatically
1150s sh: Distribution appears to be Ubuntu
1150s Reading package lists...
1151s Building dependency tree...
1151s Reading state information...
1151s eatmydata is already the newest version (131-1).
1151s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1151s Reading package lists...
1152s Building dependency tree...
1152s Reading state information...
1152s dbus is already the newest version (1.14.10-4ubuntu1).
1152s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1152s Reading package lists...
1153s Building dependency tree...
1153s Reading state information...
1153s rng-tools-debian is already the newest version (2.4).
1153s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1153s Reading package lists...
1154s Building dependency tree...
1154s Reading state information...
1154s The following packages will be REMOVED:
1154s   cloud-init* python3-configobj* python3-debconf*
1155s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded.
1155s After this operation, 3256 kB disk space will be freed.
1155s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 74819 files and directories currently installed.)
1155s Removing cloud-init (24.1.2-0ubuntu1) ...
1155s Removing python3-configobj (5.0.8-3) ...
1155s Removing python3-debconf (1.5.86) ...
1155s Processing triggers for man-db (2.12.0-3) ...
1156s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 74430 files and directories currently installed.)
1156s Purging configuration files for cloud-init (24.1.2-0ubuntu1) ...
1156s dpkg: warning: while removing cloud-init, directory '/etc/cloud/cloud.cfg.d' not empty so not removed
1156s Processing triggers for rsyslog (8.2312.0-3ubuntu3) ...
1157s invoke-rc.d: policy-rc.d denied execution of try-restart.
1157s Reading package lists...
1157s Building dependency tree...
1157s Reading state information...
1158s linux-generic is already the newest version (6.8.0-11.11+1).
1158s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1158s Hit:1 http://ftpmaster.internal/ubuntu noble InRelease
1158s Hit:2 http://ftpmaster.internal/ubuntu noble-updates InRelease
1158s Hit:3 http://ftpmaster.internal/ubuntu noble-security InRelease
1160s Reading package lists...
1160s Reading package lists...
1160s Building dependency tree...
1160s Reading state information...
1161s Calculating upgrade...
1161s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1161s Reading package lists...
1161s Building dependency tree...
1161s Reading state information...
1162s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded.
1162s autopkgtest [05:48:57]: rebooting testbed after setup commands that affected boot
1193s Reading package lists...
1194s Building dependency tree...
1194s Reading state information...
1194s Starting pkgProblemResolver with broken count: 0
1194s Starting 2 pkgProblemResolver with broken count: 0
1194s Done
1195s The following additional packages will be installed:
1195s   adwaita-icon-theme androguard apksigner at-spi2-common blt
1195s   ca-certificates-java default-jdk-headless default-jre default-jre-headless
1195s   fdroidserver fontconfig fontconfig-config fonts-dejavu-core
1195s   fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache
1195s   hicolor-icon-theme humanity-icon-theme java-common libann0 libapksig-java
1195s   libasound2 libasound2-data libatk1.0-0 libavahi-client3 libavahi-common-data
1195s   libavahi-common3 libblas3 libcairo2 libcdt5 libcgraph6 libcups2 libdatrie1
1195s   libdeflate0 libdrm-amdgpu1 libdrm-nouveau2 libdrm-radeon1 liberror-perl
1195s   libfontconfig1 libgd3 libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common
1195s   libgfortran5 libgif7 libgl1 libgl1-mesa-dri libglapi-mesa libglvnd0
1195s   libglx-mesa0 libglx0 libgomp1 libgraphite2-3 libgtk2.0-0 libgtk2.0-common
1195s   libgts-0.7-5 libgvc6 libgvpr2 libharfbuzz0b libice6 libimagequant0 libjbig0
1195s   libjpeg-turbo8 libjpeg8 libjs-jquery libjs-jquery-ui liblab-gamut1
1195s   liblapack3 liblbfgsb0 liblcms2-2 liblerc4 libllvm17 libltdl7 libopenjp2-7
1195s   libpango-1.0-0 libpangocairo-1.0-0 libpangoft2-1.0-0 libpathplan4
1195s   libpcsclite1 libpixman-1-0 libpython3.11-minimal libpython3.11-stdlib
1195s   libqhull-r8.0 libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6
1195s   libthai-data libthai0 libtiff6 libtk8.6 libvulkan1 libwebp7 libwebpdemux2
1195s   libwebpmux3 libx11-xcb1 libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0
1195s   libxcb-present0 libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1
1195s   libxcb-xfixes0 libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2
1195s   libxi6 libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1
1195s   libxslt1.1 libxss1 libxt6 libxtst6 libxxf86vm1 openjdk-21-jdk-headless
1195s   openjdk-21-jre openjdk-21-jre-headless python-matplotlib-data
1195s   python3-appdirs python3-args python3-asn1crypto python3-asttokens
1195s   python3-bcrypt python3-brotli python3-click python3-clint python3-colorama
1195s   python3-contourpy python3-cycler python3-dateutil python3-decorator
1195s   python3-defusedxml python3-distutils python3-executing python3-fonttools
1195s   python3-fs python3-git python3-gitdb python3-ipython python3-jedi
1195s   python3-kiwisolver python3-lib2to3 python3-libcloud python3-lockfile
1195s   python3-lxml python3-lz4 python3-magic python3-matplotlib
1195s   python3-matplotlib-inline python3-mpmath python3-nacl python3-networkx
1195s   python3-numpy python3-oscrypto python3-packaging python3-paramiko
1195s   python3-parso python3-pathspec python3-pexpect python3-pil
1195s   python3-pil.imagetk python3-png python3-prompt-toolkit python3-ptyprocess
1195s   python3-pure-eval python3-pyasn1 python3-pyasn1-modules python3-pydot
1195s   python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy
1195s   python3-setuptools python3-simplejson python3-smmap python3-stack-data
1195s   python3-sympy python3-tk python3-traitlets python3-ufolib2
1195s   python3-unicodedata2 python3-wcwidth python3.11 python3.11-minimal
1195s   tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint
1195s Suggested packages:
1195s   blt-demo gradle ipfs-cid vagrant vagrant-cachier vagrant-libvirt qemu-kvm
1195s   git-daemon-run | git-daemon-sysvinit git-doc git-email git-gui gitk gitweb
1195s   git-cvs git-mediawiki git-svn gsfonts graphviz-doc libasound2-plugins
1195s   alsa-utils cups-common libgd-tools gvfs libjs-jquery-ui-docs liblcms2-utils
1195s   pcscd tcl8.6 tk8.6 openjdk-21-demo openjdk-21-source libnss-mdns
1195s   fonts-dejavu-extra fonts-ipafont-gothic fonts-ipafont-mincho
1195s   fonts-wqy-microhei | fonts-wqy-zenhei fonts-indic python-cycler-doc
1195s   python-git-doc python-ipython-doc python-lockfile-doc python-lxml-doc
1195s   cm-super-minimal dvipng ffmpeg fonts-staypuft ghostscript gir1.2-gtk-3.0
1195s   inkscape ipython3 librsvg2-common python3-cairocffi python3-gi-cairo
1195s   python3-gobject python3-pyqt5 python3-sip python3-tornado
1195s   texlive-extra-utils texlive-latex-extra python-mpmath-doc python3-gmpy2
1195s   python-nacl-doc python-networkx-doc python3-gdal python3-pygraphviz gcc
1195s   gfortran python3-dev python3-pytest python3-gssapi python3-invoke
1195s   python-pexpect-doc python-pil-doc python-scipy-doc python-setuptools-doc
1195s   texlive-fonts-extra python-sympy-doc tix python3-tk-dbg python3.11-venv
1195s   python3.11-doc binfmt-support
1195s Recommended packages:
1195s   librsvg2-common python3-pyperclip python3-pyqt5 android-sdk dexdump opensc
1195s   s3cmd fonts-liberation2 alsa-ucm-conf alsa-topology-conf
1195s   libgdk-pixbuf2.0-bin libgl1-amber-dri libgail-common libgtk2.0-bin
1195s   libgts-bin javascript-common mesa-vulkan-drivers | vulkan-icd
1195s   libatk-wrapper-java-jni fonts-dejavu-extra python3-bs4 python3-cssselect
1195s   python3-html5lib python3-olefile g++ | c++-compiler isympy-common
1195s The following NEW packages will be installed:
1195s   adwaita-icon-theme androguard apksigner at-spi2-common autopkgtest-satdep
1195s   blt ca-certificates-java default-jdk-headless default-jre
1195s   default-jre-headless fdroidserver fontconfig fontconfig-config
1195s   fonts-dejavu-core fonts-dejavu-mono fonts-lyx git git-man graphviz
1195s   gtk-update-icon-cache hicolor-icon-theme humanity-icon-theme java-common
1195s   libann0 libapksig-java libasound2 libasound2-data libatk1.0-0
1195s   libavahi-client3 libavahi-common-data libavahi-common3 libblas3 libcairo2
1195s   libcdt5 libcgraph6 libcups2 libdatrie1 libdeflate0 libdrm-amdgpu1
1195s   libdrm-nouveau2 libdrm-radeon1 liberror-perl libfontconfig1 libgd3
1195s   libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1
1195s   libgl1-mesa-dri libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1
1195s   libgraphite2-3 libgtk2.0-0 libgtk2.0-common libgts-0.7-5 libgvc6 libgvpr2
1195s   libharfbuzz0b libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8
1195s   libjs-jquery libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2
1195s   liblerc4 libllvm17 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0
1195s   libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0
1195s   libpython3.11-minimal libpython3.11-stdlib libqhull-r8.0 libraqm0
1195s   libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 libtiff6
1195s   libtk8.6 libvulkan1 libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 libxaw7
1195s   libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 libxcb-randr0
1195s   libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 libxcomposite1
1195s   libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 libxinerama1 libxmu6
1195s   libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 libxss1 libxt6
1195s   libxtst6 libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre
1195s   openjdk-21-jre-headless python-matplotlib-data python3-appdirs python3-args
1195s   python3-asn1crypto python3-asttokens python3-bcrypt python3-brotli
1195s   python3-click python3-clint python3-colorama python3-contourpy
1195s   python3-cycler python3-dateutil python3-decorator python3-defusedxml
1195s   python3-distutils python3-executing python3-fonttools python3-fs python3-git
1195s   python3-gitdb python3-ipython python3-jedi python3-kiwisolver
1195s   python3-lib2to3 python3-libcloud python3-lockfile python3-lxml python3-lz4
1195s   python3-magic python3-matplotlib python3-matplotlib-inline python3-mpmath
1195s   python3-nacl python3-networkx python3-numpy python3-oscrypto
1195s   python3-packaging python3-paramiko python3-parso python3-pathspec
1195s   python3-pexpect python3-pil python3-pil.imagetk python3-png
1195s   python3-prompt-toolkit python3-ptyprocess python3-pure-eval python3-pyasn1
1195s   python3-pyasn1-modules python3-pydot python3-qrcode python3-ruamel.yaml
1195s   python3-ruamel.yaml.clib python3-scipy python3-setuptools python3-simplejson
1195s   python3-smmap python3-stack-data python3-sympy python3-tk python3-traitlets
1195s   python3-ufolib2 python3-unicodedata2 python3-wcwidth python3.11
1195s   python3.11-minimal tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint
1195s 0 upgraded, 202 newly installed, 0 to remove and 0 not upgraded.
1195s Need to get 289 MB/289 MB of archives.
1195s After this operation, 991 MB of additional disk space will be used.
1195s Get:1 /tmp/autopkgtest.tyZAgp/2-autopkgtest-satdep.deb autopkgtest-satdep arm64 0 [704 B]
1195s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 libpython3.11-minimal arm64 3.11.8-1 [837 kB]
1196s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 python3.11-minimal arm64 3.11.8-1 [2150 kB]
1196s Get:4 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [7624 B]
1196s Get:5 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg-turbo8 arm64 2.1.5-2ubuntu1 [160 kB]
1196s Get:6 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg8 arm64 8c-2ubuntu11 [2148 B]
1196s Get:7 http://ftpmaster.internal/ubuntu noble/main arm64 libdeflate0 arm64 1.19-1 [43.4 kB]
1196s Get:8 http://ftpmaster.internal/ubuntu noble/main arm64 libjbig0 arm64 2.1-6.1ubuntu1 [28.9 kB]
1196s Get:9 http://ftpmaster.internal/ubuntu noble/main arm64 liblerc4 arm64 4.0.0+ds-4ubuntu1 [153 kB]
1196s Get:10 http://ftpmaster.internal/ubuntu noble/main arm64 libsharpyuv0 arm64 1.3.2-0.4 [14.4 kB]
1196s Get:11 http://ftpmaster.internal/ubuntu noble/main arm64 libwebp7 arm64 1.3.2-0.4 [191 kB]
1196s Get:12 http://ftpmaster.internal/ubuntu noble/main arm64 libtiff6 arm64 4.5.1+git230720-3ubuntu1 [226 kB]
1196s Get:13 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.10+dfsg-3 [144 kB]
1196s Get:14 http://ftpmaster.internal/ubuntu noble/main arm64 gtk-update-icon-cache arm64 3.24.40-2ubuntu1 [50.5 kB]
1196s Get:15 http://ftpmaster.internal/ubuntu noble/main arm64 hicolor-icon-theme all 0.17-2 [9976 B]
1196s Get:16 http://ftpmaster.internal/ubuntu noble/main arm64 humanity-icon-theme all 0.6.16 [1282 kB]
1196s Get:17 http://ftpmaster.internal/ubuntu noble/main arm64 ubuntu-mono all 24.04-0ubuntu1 [151 kB]
1196s Get:18 http://ftpmaster.internal/ubuntu noble/main arm64 adwaita-icon-theme all 46~rc-1 [723 kB]
1196s Get:19 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asn1crypto all 1.5.1-3 [79.7 kB]
1196s Get:20 http://ftpmaster.internal/ubuntu noble/main arm64 python3-colorama all 0.4.6-4 [32.1 kB]
1196s Get:21 http://ftpmaster.internal/ubuntu noble/main arm64 python3-click all 8.1.6-1 [79.0 kB]
1196s Get:22 http://ftpmaster.internal/ubuntu noble/main arm64 python3-decorator all 5.1.1-5 [10.1 kB]
1196s Get:23 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-parso all 0.8.3-1 [67.2 kB]
1196s Get:24 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-jedi all 0.18.2-1ubuntu1 [692 kB]
1196s Get:25 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-traitlets all 5.5.0-2 [85.0 kB]
1196s Get:26 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib-inline all 0.1.6-2 [8784 B]
1196s Get:27 http://ftpmaster.internal/ubuntu noble/main arm64 python3-ptyprocess all 0.7.0-5 [15.1 kB]
1196s Get:28 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pexpect all 4.9-2 [48.1 kB]
1196s Get:29 http://ftpmaster.internal/ubuntu noble/main arm64 python3-wcwidth all 0.2.5+dfsg1-1.1ubuntu1 [22.5 kB]
1196s Get:30 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-prompt-toolkit all 3.0.43-1 [256 kB]
1196s Get:31 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asttokens all 2.4.1-1 [20.9 kB]
1196s Get:32 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-executing all 2.0.1-0.1 [23.3 kB]
1196s Get:33 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pure-eval all 0.2.2-1 [11.3 kB]
1196s Get:34 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-stack-data all 0.6.3-1 [22.0 kB]
1196s Get:35 http://ftpmaster.internal/ubuntu noble/main arm64 python3-lib2to3 all 3.11.5-1 [79.0 kB]
1196s Get:36 http://ftpmaster.internal/ubuntu noble/main arm64 python3-distutils all 3.11.5-1 [131 kB]
1196s Get:37 http://ftpmaster.internal/ubuntu noble/main arm64 python3-setuptools all 68.1.2-2 [396 kB]
1196s Get:38 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ipython all 8.20.0-1 [561 kB]
1196s Get:39 http://ftpmaster.internal/ubuntu noble/main arm64 libxslt1.1 arm64 1.1.39-0exp1 [166 kB]
1196s Get:40 http://ftpmaster.internal/ubuntu noble/main arm64 python3-lxml arm64 5.1.0-1 [2042 kB]
1196s Get:41 http://ftpmaster.internal/ubuntu noble/main arm64 python3-magic all 2:0.4.27-2 [13.4 kB]
1196s Get:42 http://ftpmaster.internal/ubuntu noble/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [328 kB]
1196s Get:43 http://ftpmaster.internal/ubuntu noble/universe arm64 libjs-jquery-ui all 1.13.2+dfsg-1 [252 kB]
1196s Get:44 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-mono all 2.37-8 [502 kB]
1196s Get:45 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-core all 2.37-8 [835 kB]
1196s Get:46 http://ftpmaster.internal/ubuntu noble/universe arm64 fonts-lyx all 2.4.0~RC3-1 [170 kB]
1196s Get:47 http://ftpmaster.internal/ubuntu noble/universe arm64 python-matplotlib-data all 3.6.3-1ubuntu3 [2936 kB]
1196s Get:48 http://ftpmaster.internal/ubuntu noble/main arm64 python3-dateutil all 2.8.2-3 [79.2 kB]
1196s Get:49 http://ftpmaster.internal/ubuntu noble/main arm64 libgomp1 arm64 14-20240303-1ubuntu1 [144 kB]
1196s Get:50 http://ftpmaster.internal/ubuntu noble/main arm64 libimagequant0 arm64 2.18.0-1 [37.0 kB]
1196s Get:51 http://ftpmaster.internal/ubuntu noble/main arm64 liblcms2-2 arm64 2.14-2 [159 kB]
1196s Get:52 http://ftpmaster.internal/ubuntu noble/main arm64 libopenjp2-7 arm64 2.5.0-2 [170 kB]
1196s Get:53 http://ftpmaster.internal/ubuntu noble/main arm64 libgraphite2-3 arm64 1.3.14-2 [81.5 kB]
1196s Get:54 http://ftpmaster.internal/ubuntu noble/main arm64 libharfbuzz0b arm64 8.3.0-2 [463 kB]
1196s Get:55 http://ftpmaster.internal/ubuntu noble/main arm64 libraqm0 arm64 0.10.1-1 [14.4 kB]
1196s Get:56 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpdemux2 arm64 1.3.2-0.4 [12.3 kB]
1196s Get:57 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpmux3 arm64 1.3.2-0.4 [25.0 kB]
1196s Get:58 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pil arm64 10.2.0-1 [477 kB]
1197s Get:59 http://ftpmaster.internal/ubuntu noble/main arm64 libtcl8.6 arm64 8.6.13+dfsg-2 [980 kB]
1197s Get:60 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig-config arm64 2.15.0-1ubuntu1 [37.0 kB]
1197s Get:61 http://ftpmaster.internal/ubuntu noble/main arm64 libfontconfig1 arm64 2.15.0-1ubuntu1 [142 kB]
1197s Get:62 http://ftpmaster.internal/ubuntu noble/main arm64 libxrender1 arm64 1:0.9.10-1.1 [19.1 kB]
1197s Get:63 http://ftpmaster.internal/ubuntu noble/main arm64 libxft2 arm64 2.3.6-1 [43.3 kB]
1197s Get:64 http://ftpmaster.internal/ubuntu noble/main arm64 x11-common all 1:7.7+23ubuntu2 [23.4 kB]
1197s Get:65 http://ftpmaster.internal/ubuntu noble/main arm64 libxss1 arm64 1:1.2.3-1build2 [8252 B]
1197s Get:66 http://ftpmaster.internal/ubuntu noble/main arm64 libtk8.6 arm64 8.6.14-1 [767 kB]
1197s Get:67 http://ftpmaster.internal/ubuntu noble/main arm64 tk8.6-blt2.5 arm64 2.5.3+dfsg-7 [618 kB]
1197s Get:68 http://ftpmaster.internal/ubuntu noble/main arm64 blt arm64 2.5.3+dfsg-7 [4826 B]
1197s Get:69 http://ftpmaster.internal/ubuntu noble/main arm64 python3-tk arm64 3.11.5-1 [112 kB]
1197s Get:70 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pil.imagetk arm64 10.2.0-1 [9708 B]
1197s Get:71 http://ftpmaster.internal/ubuntu noble/main arm64 libpython3.11-stdlib arm64 3.11.8-1 [1913 kB]
1197s Get:72 http://ftpmaster.internal/ubuntu noble/main arm64 python3.11 arm64 3.11.8-1 [589 kB]
1197s Get:73 http://ftpmaster.internal/ubuntu noble/main arm64 libblas3 arm64 3.12.0-3 [143 kB]
1197s Get:74 http://ftpmaster.internal/ubuntu noble/main arm64 libgfortran5 arm64 14-20240303-1ubuntu1 [444 kB]
1197s Get:75 http://ftpmaster.internal/ubuntu noble/main arm64 liblapack3 arm64 3.12.0-3 [2241 kB]
1197s Get:76 http://ftpmaster.internal/ubuntu noble/main arm64 python3-numpy arm64 1:1.24.2-2 [4525 kB]
1197s Get:77 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-contourpy arm64 1.0.7-1build2 [244 kB]
1197s Get:78 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-cycler all 0.11.0-2 [8202 B]
1197s Get:79 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-brotli arm64 1.1.0-2 [345 kB]
1197s Get:80 http://ftpmaster.internal/ubuntu noble/universe arm64 liblbfgsb0 arm64 3.0+dfsg.4-1 [27.7 kB]
1197s Get:81 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-scipy arm64 1.11.4-6 [18.6 MB]
1197s Get:82 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ufolib2 all 0.16.0+dfsg1-1 [33.5 kB]
1197s Get:83 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-mpmath all 1.2.1-3 [421 kB]
1197s Get:84 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-sympy all 1.12-7 [3966 kB]
1197s Get:85 http://ftpmaster.internal/ubuntu noble/main arm64 python3-appdirs all 1.4.4-4 [10.9 kB]
1197s Get:86 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fs all 2.4.16-3 [91.1 kB]
1197s Get:87 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lz4 arm64 4.0.2+dfsg-1build2 [28.4 kB]
1197s Get:88 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-unicodedata2 arm64 15.1.0+ds-1 [362 kB]
1197s Get:89 http://ftpmaster.internal/ubuntu noble/universe arm64 unicode-data all 15.1.0-1 [8878 kB]
1198s Get:90 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fonttools arm64 4.46.0-1 [1625 kB]
1198s Get:91 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-kiwisolver arm64 1.4.4-2 [48.5 kB]
1198s Get:92 http://ftpmaster.internal/ubuntu noble/main arm64 python3-packaging all 23.2-1 [40.6 kB]
1198s Get:93 http://ftpmaster.internal/ubuntu noble/universe arm64 libqhull-r8.0 arm64 2020.2-6 [188 kB]
1198s Get:94 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib arm64 3.6.3-1ubuntu3 [7291 kB]
1198s Get:95 http://ftpmaster.internal/ubuntu noble/main arm64 python3-networkx all 2.8.8-1ubuntu1 [1468 kB]
1198s Get:96 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-oscrypto all 1.3.0-5 [168 kB]
1198s Get:97 http://ftpmaster.internal/ubuntu noble/universe arm64 libann0 arm64 1.1.2+doc-9 [25.1 kB]
1198s Get:98 http://ftpmaster.internal/ubuntu noble/universe arm64 libcdt5 arm64 2.42.2-8build1 [20.3 kB]
1198s Get:99 http://ftpmaster.internal/ubuntu noble/universe arm64 libcgraph6 arm64 2.42.2-8build1 [44.8 kB]
1198s Get:100 http://ftpmaster.internal/ubuntu noble/main arm64 libxpm4 arm64 1:3.5.17-1 [34.5 kB]
1198s Get:101 http://ftpmaster.internal/ubuntu noble/main arm64 libgd3 arm64 2.3.3-9ubuntu1 [119 kB]
1198s Get:102 http://ftpmaster.internal/ubuntu noble/universe arm64 libgts-0.7-5 arm64 0.7.6+darcs121130-5 [157 kB]
1198s Get:103 http://ftpmaster.internal/ubuntu noble/main arm64 libpixman-1-0 arm64 0.42.2-1 [193 kB]
1198s Get:104 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-render0 arm64 1.15-1 [16.1 kB]
1198s Get:105 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-shm0 arm64 1.15-1 [5780 B]
1198s Get:106 http://ftpmaster.internal/ubuntu noble/main arm64 libcairo2 arm64 1.18.0-1 [550 kB]
1198s Get:107 http://ftpmaster.internal/ubuntu noble/main arm64 libltdl7 arm64 2.4.7-7 [40.3 kB]
1198s Get:108 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig arm64 2.15.0-1ubuntu1 [190 kB]
1198s Get:109 http://ftpmaster.internal/ubuntu noble/main arm64 libthai-data all 0.1.29-2 [158 kB]
1198s Get:110 http://ftpmaster.internal/ubuntu noble/main arm64 libdatrie1 arm64 0.2.13-3 [21.7 kB]
1198s Get:111 http://ftpmaster.internal/ubuntu noble/main arm64 libthai0 arm64 0.1.29-2 [18.1 kB]
1198s Get:112 http://ftpmaster.internal/ubuntu noble/main arm64 libpango-1.0-0 arm64 1.51.0+ds-4 [226 kB]
1198s Get:113 http://ftpmaster.internal/ubuntu noble/main arm64 libpangoft2-1.0-0 arm64 1.51.0+ds-4 [41.2 kB]
1198s Get:114 http://ftpmaster.internal/ubuntu noble/main arm64 libpangocairo-1.0-0 arm64 1.51.0+ds-4 [27.6 kB]
1198s Get:115 http://ftpmaster.internal/ubuntu noble/universe arm64 libpathplan4 arm64 2.42.2-8build1 [22.6 kB]
1198s Get:116 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvc6 arm64 2.42.2-8build1 [692 kB]
1198s Get:117 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvpr2 arm64 2.42.2-8build1 [187 kB]
1199s Get:118 http://ftpmaster.internal/ubuntu noble/universe arm64 liblab-gamut1 arm64 2.42.2-8build1 [1860 kB]
1199s Get:119 http://ftpmaster.internal/ubuntu noble/main arm64 libice6 arm64 2:1.0.10-1build2 [41.7 kB]
1199s Get:120 http://ftpmaster.internal/ubuntu noble/main arm64 libsm6 arm64 2:1.2.3-1build2 [16.1 kB]
1199s Get:121 http://ftpmaster.internal/ubuntu noble/main arm64 libxt6 arm64 1:1.2.1-1.1 [167 kB]
1199s Get:122 http://ftpmaster.internal/ubuntu noble/main arm64 libxmu6 arm64 2:1.1.3-3 [48.9 kB]
1199s Get:123 http://ftpmaster.internal/ubuntu noble/main arm64 libxaw7 arm64 2:1.0.14-1 [184 kB]
1199s Get:124 http://ftpmaster.internal/ubuntu noble/universe arm64 graphviz arm64 2.42.2-8build1 [613 kB]
1199s Get:125 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pydot all 1.4.2-2 [24.4 kB]
1199s Get:126 http://ftpmaster.internal/ubuntu noble/universe arm64 androguard all 3.4.0~a1-10 [36.7 MB]
1200s Get:127 http://ftpmaster.internal/ubuntu noble/main arm64 ca-certificates-java all 20240118 [11.6 kB]
1200s Get:128 http://ftpmaster.internal/ubuntu noble/main arm64 java-common all 0.75+exp1 [6798 B]
1200s Get:129 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common-data arm64 0.8-13ubuntu2 [29.5 kB]
1200s Get:130 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common3 arm64 0.8-13ubuntu2 [23.2 kB]
1200s Get:131 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-client3 arm64 0.8-13ubuntu2 [27.3 kB]
1200s Get:132 http://ftpmaster.internal/ubuntu noble/main arm64 libcups2 arm64 2.4.6-0ubuntu3 [270 kB]
1200s Get:133 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2-data all 1.2.10-3build1 [20.7 kB]
1200s Get:134 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2 arm64 1.2.10-3build1 [386 kB]
1200s Get:135 http://ftpmaster.internal/ubuntu noble/main arm64 libpcsclite1 arm64 2.0.0-1 [21.2 kB]
1200s Get:136 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre-headless arm64 21.0.2+13-2 [45.8 MB]
1201s Get:137 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre-headless arm64 2:1.21-75+exp1 [3096 B]
1201s Get:138 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-common all 2.24.33-2ubuntu2 [125 kB]
1201s Get:139 http://ftpmaster.internal/ubuntu noble/main arm64 at-spi2-common all 2.50.0-1 [7864 B]
1201s Get:140 http://ftpmaster.internal/ubuntu noble/main arm64 libatk1.0-0 arm64 2.50.0-1 [53.8 kB]
1201s Get:141 http://ftpmaster.internal/ubuntu noble/main arm64 libxcomposite1 arm64 1:0.4.5-1build2 [7080 B]
1201s Get:142 http://ftpmaster.internal/ubuntu noble/main arm64 libxfixes3 arm64 1:6.0.0-2 [11.0 kB]
1201s Get:143 http://ftpmaster.internal/ubuntu noble/main arm64 libxcursor1 arm64 1:1.2.1-1 [21.3 kB]
1201s Get:144 http://ftpmaster.internal/ubuntu noble/main arm64 libxdamage1 arm64 1:1.1.6-1 [6032 B]
1201s Get:145 http://ftpmaster.internal/ubuntu noble/main arm64 libxi6 arm64 2:1.8.1-1 [31.9 kB]
1201s Get:146 http://ftpmaster.internal/ubuntu noble/main arm64 libxinerama1 arm64 2:1.1.4-3 [7056 B]
1201s Get:147 http://ftpmaster.internal/ubuntu noble/main arm64 libxrandr2 arm64 2:1.5.2-2 [19.6 kB]
1201s Get:148 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-0 arm64 2.24.33-2ubuntu2 [1981 kB]
1201s Get:149 http://ftpmaster.internal/ubuntu noble/main arm64 libglvnd0 arm64 1.7.0-1 [60.0 kB]
1201s Get:150 http://ftpmaster.internal/ubuntu noble/main arm64 libglapi-mesa arm64 24.0.1-1ubuntu1 [57.8 kB]
1201s Get:151 http://ftpmaster.internal/ubuntu noble/main arm64 libx11-xcb1 arm64 2:1.8.7-1 [7836 B]
1201s Get:152 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri2-0 arm64 1.15-1 [7244 B]
1201s Get:153 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri3-0 arm64 1.15-1 [7108 B]
1201s Get:154 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-glx0 arm64 1.15-1 [25.2 kB]
1201s Get:155 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-present0 arm64 1.15-1 [5732 B]
1201s Get:156 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-randr0 arm64 1.15-1 [18.2 kB]
1201s Get:157 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-sync1 arm64 1.15-1 [9412 B]
1201s Get:158 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-xfixes0 arm64 1.15-1 [10.3 kB]
1201s Get:159 http://ftpmaster.internal/ubuntu noble/main arm64 libxshmfence1 arm64 1.3-1build4 [5444 B]
1201s Get:160 http://ftpmaster.internal/ubuntu noble/main arm64 libxxf86vm1 arm64 1:1.1.4-1build3 [10.3 kB]
1201s Get:161 http://ftpmaster.internal/ubuntu noble/main arm64 libvulkan1 arm64 1.3.275.0-1 [150 kB]
1201s Get:162 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-amdgpu1 arm64 2.4.120-2 [20.4 kB]
1201s Get:163 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-nouveau2 arm64 2.4.120-2 [17.8 kB]
1201s Get:164 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-radeon1 arm64 2.4.120-2 [20.9 kB]
1201s Get:165 http://ftpmaster.internal/ubuntu noble/main arm64 libllvm17 arm64 1:17.0.6-5build1 [25.0 MB]
1202s Get:166 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1-mesa-dri arm64 24.0.1-1ubuntu1 [8226 kB]
1202s Get:167 http://ftpmaster.internal/ubuntu noble/main arm64 libglx-mesa0 arm64 24.0.1-1ubuntu1 [166 kB]
1202s Get:168 http://ftpmaster.internal/ubuntu noble/main arm64 libglx0 arm64 1.7.0-1 [32.4 kB]
1202s Get:169 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1 arm64 1.7.0-1 [107 kB]
1202s Get:170 http://ftpmaster.internal/ubuntu noble/main arm64 libgif7 arm64 5.2.1-2.5 [34.2 kB]
1202s Get:171 http://ftpmaster.internal/ubuntu noble/main arm64 libxtst6 arm64 2:1.2.3-1.1 [13.7 kB]
1202s Get:172 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre arm64 21.0.2+13-2 [226 kB]
1202s Get:173 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre arm64 2:1.21-75+exp1 [922 B]
1202s Get:174 http://ftpmaster.internal/ubuntu noble/universe arm64 libapksig-java all 31.0.2-1ubuntu1 [406 kB]
1202s Get:175 http://ftpmaster.internal/ubuntu noble/universe arm64 apksigner all 31.0.2-1ubuntu1 [444 kB]
1202s Get:176 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jdk-headless arm64 21.0.2+13-2 [81.6 MB]
1204s Get:177 http://ftpmaster.internal/ubuntu noble/main arm64 default-jdk-headless arm64 2:1.21-75+exp1 [960 B]
1204s Get:178 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-args all 0.1.0-5 [6082 B]
1204s Get:179 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-clint all 0.5.1-4 [27.8 kB]
1204s Get:180 http://ftpmaster.internal/ubuntu noble/main arm64 python3-defusedxml all 0.7.1-2 [42.0 kB]
1204s Get:181 http://ftpmaster.internal/ubuntu noble/main arm64 liberror-perl all 0.17029-2 [25.6 kB]
1204s Get:182 http://ftpmaster.internal/ubuntu noble/main arm64 git-man all 1:2.43.0-1ubuntu1 [1100 kB]
1204s Get:183 http://ftpmaster.internal/ubuntu noble/main arm64 git arm64 1:2.43.0-1ubuntu1 [3786 kB]
1204s Get:184 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-smmap all 6.0.0-1 [20.5 kB]
1204s Get:185 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-gitdb all 4.0.11-1 [46.2 kB]
1204s Get:186 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-git all 3.1.37-3 [138 kB]
1205s Get:187 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lockfile all 1:0.12.2-3 [13.7 kB]
1205s Get:188 http://ftpmaster.internal/ubuntu noble/main arm64 python3-simplejson arm64 3.19.2-1build1 [61.4 kB]
1205s Get:189 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-libcloud all 3.4.1-5 [751 kB]
1205s Get:190 http://ftpmaster.internal/ubuntu noble/main arm64 python3-bcrypt arm64 3.2.2-1 [28.8 kB]
1205s Get:191 http://ftpmaster.internal/ubuntu noble/main arm64 libsodium23 arm64 1.0.18-1build2 [123 kB]
1205s Get:192 http://ftpmaster.internal/ubuntu noble/main arm64 python3-nacl arm64 1.5.0-4 [55.5 kB]
1205s Get:193 http://ftpmaster.internal/ubuntu noble/main arm64 python3-paramiko all 2.12.0-2ubuntu4 [137 kB]
1205s Get:194 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1 all 0.4.8-4 [51.2 kB]
1205s Get:195 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1-modules all 0.2.8-1 [68.0 kB]
1205s Get:196 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-png all 0.20231004.0-2 [30.2 kB]
1205s Get:197 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-qrcode all 7.4.2-4 [40.1 kB]
1205s Get:198 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml.clib arm64 0.2.8-1 [187 kB]
1205s Get:199 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml all 0.17.21-1 [86.6 kB]
1205s Get:200 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pathspec all 0.12.1-1 [24.5 kB]
1205s Get:201 http://ftpmaster.internal/ubuntu noble/universe arm64 yamllint all 1.33.0-1 [47.2 kB]
1205s Get:202 http://ftpmaster.internal/ubuntu noble/universe arm64 fdroidserver all 2.2.1-2 [362 kB]
1206s Fetched 289 MB in 10s (30.3 MB/s)
1206s Selecting previously unselected package libpython3.11-minimal:arm64.
1206s (Reading database ... 
(Reading database ... 5%
(Reading database ... 10%
(Reading database ... 15%
(Reading database ... 20%
(Reading database ... 25%
(Reading database ... 30%
(Reading database ... 35%
(Reading database ... 40%
(Reading database ... 45%
(Reading database ... 50%
(Reading database ... 55%
(Reading database ... 60%
(Reading database ... 65%
(Reading database ... 70%
(Reading database ... 75%
(Reading database ... 80%
(Reading database ... 85%
(Reading database ... 90%
(Reading database ... 95%
(Reading database ... 100%
(Reading database ... 74375 files and directories currently installed.)
1206s Preparing to unpack .../000-libpython3.11-minimal_3.11.8-1_arm64.deb ...
1206s Unpacking libpython3.11-minimal:arm64 (3.11.8-1) ...
1206s Selecting previously unselected package python3.11-minimal.
1206s Preparing to unpack .../001-python3.11-minimal_3.11.8-1_arm64.deb ...
1206s Unpacking python3.11-minimal (3.11.8-1) ...
1206s Selecting previously unselected package libgdk-pixbuf2.0-common.
1206s Preparing to unpack .../002-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ...
1206s Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ...
1206s Selecting previously unselected package libjpeg-turbo8:arm64.
1206s Preparing to unpack .../003-libjpeg-turbo8_2.1.5-2ubuntu1_arm64.deb ...
1206s Unpacking libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ...
1206s Selecting previously unselected package libjpeg8:arm64.
1206s Preparing to unpack .../004-libjpeg8_8c-2ubuntu11_arm64.deb ...
1206s Unpacking libjpeg8:arm64 (8c-2ubuntu11) ...
1206s Selecting previously unselected package libdeflate0:arm64.
1206s Preparing to unpack .../005-libdeflate0_1.19-1_arm64.deb ...
1206s Unpacking libdeflate0:arm64 (1.19-1) ...
1206s Selecting previously unselected package libjbig0:arm64.
1206s Preparing to unpack .../006-libjbig0_2.1-6.1ubuntu1_arm64.deb ...
1206s Unpacking libjbig0:arm64 (2.1-6.1ubuntu1) ...
1206s Selecting previously unselected package liblerc4:arm64.
1206s Preparing to unpack .../007-liblerc4_4.0.0+ds-4ubuntu1_arm64.deb ...
1206s Unpacking liblerc4:arm64 (4.0.0+ds-4ubuntu1) ...
1207s Selecting previously unselected package libsharpyuv0:arm64.
1207s Preparing to unpack .../008-libsharpyuv0_1.3.2-0.4_arm64.deb ...
1207s Unpacking libsharpyuv0:arm64 (1.3.2-0.4) ...
1207s Selecting previously unselected package libwebp7:arm64.
1207s Preparing to unpack .../009-libwebp7_1.3.2-0.4_arm64.deb ...
1207s Unpacking libwebp7:arm64 (1.3.2-0.4) ...
1207s Selecting previously unselected package libtiff6:arm64.
1207s Preparing to unpack .../010-libtiff6_4.5.1+git230720-3ubuntu1_arm64.deb ...
1207s Unpacking libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ...
1207s Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64.
1207s Preparing to unpack .../011-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3_arm64.deb ...
1207s Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ...
1207s Selecting previously unselected package gtk-update-icon-cache.
1207s Preparing to unpack .../012-gtk-update-icon-cache_3.24.40-2ubuntu1_arm64.deb ...
1207s Unpacking gtk-update-icon-cache (3.24.40-2ubuntu1) ...
1207s Selecting previously unselected package hicolor-icon-theme.
1207s Preparing to unpack .../013-hicolor-icon-theme_0.17-2_all.deb ...
1207s Unpacking hicolor-icon-theme (0.17-2) ...
1207s Selecting previously unselected package humanity-icon-theme.
1207s Preparing to unpack .../014-humanity-icon-theme_0.6.16_all.deb ...
1207s Unpacking humanity-icon-theme (0.6.16) ...
1207s Selecting previously unselected package ubuntu-mono.
1207s Preparing to unpack .../015-ubuntu-mono_24.04-0ubuntu1_all.deb ...
1207s Unpacking ubuntu-mono (24.04-0ubuntu1) ...
1208s Selecting previously unselected package adwaita-icon-theme.
1208s Preparing to unpack .../016-adwaita-icon-theme_46~rc-1_all.deb ...
1208s Unpacking adwaita-icon-theme (46~rc-1) ...
1208s Selecting previously unselected package python3-asn1crypto.
1208s Preparing to unpack .../017-python3-asn1crypto_1.5.1-3_all.deb ...
1208s Unpacking python3-asn1crypto (1.5.1-3) ...
1208s Selecting previously unselected package python3-colorama.
1208s Preparing to unpack .../018-python3-colorama_0.4.6-4_all.deb ...
1208s Unpacking python3-colorama (0.4.6-4) ...
1208s Selecting previously unselected package python3-click.
1208s Preparing to unpack .../019-python3-click_8.1.6-1_all.deb ...
1208s Unpacking python3-click (8.1.6-1) ...
1208s Selecting previously unselected package python3-decorator.
1208s Preparing to unpack .../020-python3-decorator_5.1.1-5_all.deb ...
1208s Unpacking python3-decorator (5.1.1-5) ...
1208s Selecting previously unselected package python3-parso.
1208s Preparing to unpack .../021-python3-parso_0.8.3-1_all.deb ...
1208s Unpacking python3-parso (0.8.3-1) ...
1208s Selecting previously unselected package python3-jedi.
1208s Preparing to unpack .../022-python3-jedi_0.18.2-1ubuntu1_all.deb ...
1208s Unpacking python3-jedi (0.18.2-1ubuntu1) ...
1208s Selecting previously unselected package python3-traitlets.
1208s Preparing to unpack .../023-python3-traitlets_5.5.0-2_all.deb ...
1208s Unpacking python3-traitlets (5.5.0-2) ...
1208s Selecting previously unselected package python3-matplotlib-inline.
1208s Preparing to unpack .../024-python3-matplotlib-inline_0.1.6-2_all.deb ...
1208s Unpacking python3-matplotlib-inline (0.1.6-2) ...
1208s Selecting previously unselected package python3-ptyprocess.
1208s Preparing to unpack .../025-python3-ptyprocess_0.7.0-5_all.deb ...
1208s Unpacking python3-ptyprocess (0.7.0-5) ...
1208s Selecting previously unselected package python3-pexpect.
1208s Preparing to unpack .../026-python3-pexpect_4.9-2_all.deb ...
1208s Unpacking python3-pexpect (4.9-2) ...
1209s Selecting previously unselected package python3-wcwidth.
1209s Preparing to unpack .../027-python3-wcwidth_0.2.5+dfsg1-1.1ubuntu1_all.deb ...
1209s Unpacking python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ...
1209s Selecting previously unselected package python3-prompt-toolkit.
1209s Preparing to unpack .../028-python3-prompt-toolkit_3.0.43-1_all.deb ...
1209s Unpacking python3-prompt-toolkit (3.0.43-1) ...
1209s Selecting previously unselected package python3-asttokens.
1209s Preparing to unpack .../029-python3-asttokens_2.4.1-1_all.deb ...
1209s Unpacking python3-asttokens (2.4.1-1) ...
1209s Selecting previously unselected package python3-executing.
1209s Preparing to unpack .../030-python3-executing_2.0.1-0.1_all.deb ...
1209s Unpacking python3-executing (2.0.1-0.1) ...
1209s Selecting previously unselected package python3-pure-eval.
1209s Preparing to unpack .../031-python3-pure-eval_0.2.2-1_all.deb ...
1209s Unpacking python3-pure-eval (0.2.2-1) ...
1209s Selecting previously unselected package python3-stack-data.
1209s Preparing to unpack .../032-python3-stack-data_0.6.3-1_all.deb ...
1209s Unpacking python3-stack-data (0.6.3-1) ...
1209s Selecting previously unselected package python3-lib2to3.
1209s Preparing to unpack .../033-python3-lib2to3_3.11.5-1_all.deb ...
1209s Unpacking python3-lib2to3 (3.11.5-1) ...
1209s Selecting previously unselected package python3-distutils.
1209s Preparing to unpack .../034-python3-distutils_3.11.5-1_all.deb ...
1209s Unpacking python3-distutils (3.11.5-1) ...
1209s Selecting previously unselected package python3-setuptools.
1209s Preparing to unpack .../035-python3-setuptools_68.1.2-2_all.deb ...
1209s Unpacking python3-setuptools (68.1.2-2) ...
1209s Selecting previously unselected package python3-ipython.
1209s Preparing to unpack .../036-python3-ipython_8.20.0-1_all.deb ...
1209s Unpacking python3-ipython (8.20.0-1) ...
1209s Selecting previously unselected package libxslt1.1:arm64.
1209s Preparing to unpack .../037-libxslt1.1_1.1.39-0exp1_arm64.deb ...
1209s Unpacking libxslt1.1:arm64 (1.1.39-0exp1) ...
1209s Selecting previously unselected package python3-lxml:arm64.
1209s Preparing to unpack .../038-python3-lxml_5.1.0-1_arm64.deb ...
1209s Unpacking python3-lxml:arm64 (5.1.0-1) ...
1209s Selecting previously unselected package python3-magic.
1209s Preparing to unpack .../039-python3-magic_2%3a0.4.27-2_all.deb ...
1209s Unpacking python3-magic (2:0.4.27-2) ...
1209s Selecting previously unselected package libjs-jquery.
1209s Preparing to unpack .../040-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ...
1209s Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
1209s Selecting previously unselected package libjs-jquery-ui.
1209s Preparing to unpack .../041-libjs-jquery-ui_1.13.2+dfsg-1_all.deb ...
1209s Unpacking libjs-jquery-ui (1.13.2+dfsg-1) ...
1209s Selecting previously unselected package fonts-dejavu-mono.
1209s Preparing to unpack .../042-fonts-dejavu-mono_2.37-8_all.deb ...
1209s Unpacking fonts-dejavu-mono (2.37-8) ...
1209s Selecting previously unselected package fonts-dejavu-core.
1209s Preparing to unpack .../043-fonts-dejavu-core_2.37-8_all.deb ...
1209s Unpacking fonts-dejavu-core (2.37-8) ...
1209s Selecting previously unselected package fonts-lyx.
1209s Preparing to unpack .../044-fonts-lyx_2.4.0~RC3-1_all.deb ...
1209s Unpacking fonts-lyx (2.4.0~RC3-1) ...
1209s Selecting previously unselected package python-matplotlib-data.
1209s Preparing to unpack .../045-python-matplotlib-data_3.6.3-1ubuntu3_all.deb ...
1209s Unpacking python-matplotlib-data (3.6.3-1ubuntu3) ...
1209s Selecting previously unselected package python3-dateutil.
1209s Preparing to unpack .../046-python3-dateutil_2.8.2-3_all.deb ...
1209s Unpacking python3-dateutil (2.8.2-3) ...
1209s Selecting previously unselected package libgomp1:arm64.
1209s Preparing to unpack .../047-libgomp1_14-20240303-1ubuntu1_arm64.deb ...
1209s Unpacking libgomp1:arm64 (14-20240303-1ubuntu1) ...
1209s Selecting previously unselected package libimagequant0:arm64.
1210s Preparing to unpack .../048-libimagequant0_2.18.0-1_arm64.deb ...
1210s Unpacking libimagequant0:arm64 (2.18.0-1) ...
1210s Selecting previously unselected package liblcms2-2:arm64.
1210s Preparing to unpack .../049-liblcms2-2_2.14-2_arm64.deb ...
1210s Unpacking liblcms2-2:arm64 (2.14-2) ...
1210s Selecting previously unselected package libopenjp2-7:arm64.
1210s Preparing to unpack .../050-libopenjp2-7_2.5.0-2_arm64.deb ...
1210s Unpacking libopenjp2-7:arm64 (2.5.0-2) ...
1210s Selecting previously unselected package libgraphite2-3:arm64.
1210s Preparing to unpack .../051-libgraphite2-3_1.3.14-2_arm64.deb ...
1210s Unpacking libgraphite2-3:arm64 (1.3.14-2) ...
1210s Selecting previously unselected package libharfbuzz0b:arm64.
1210s Preparing to unpack .../052-libharfbuzz0b_8.3.0-2_arm64.deb ...
1210s Unpacking libharfbuzz0b:arm64 (8.3.0-2) ...
1210s Selecting previously unselected package libraqm0:arm64.
1210s Preparing to unpack .../053-libraqm0_0.10.1-1_arm64.deb ...
1210s Unpacking libraqm0:arm64 (0.10.1-1) ...
1210s Selecting previously unselected package libwebpdemux2:arm64.
1210s Preparing to unpack .../054-libwebpdemux2_1.3.2-0.4_arm64.deb ...
1210s Unpacking libwebpdemux2:arm64 (1.3.2-0.4) ...
1210s Selecting previously unselected package libwebpmux3:arm64.
1210s Preparing to unpack .../055-libwebpmux3_1.3.2-0.4_arm64.deb ...
1210s Unpacking libwebpmux3:arm64 (1.3.2-0.4) ...
1210s Selecting previously unselected package python3-pil:arm64.
1210s Preparing to unpack .../056-python3-pil_10.2.0-1_arm64.deb ...
1210s Unpacking python3-pil:arm64 (10.2.0-1) ...
1210s Selecting previously unselected package libtcl8.6:arm64.
1210s Preparing to unpack .../057-libtcl8.6_8.6.13+dfsg-2_arm64.deb ...
1210s Unpacking libtcl8.6:arm64 (8.6.13+dfsg-2) ...
1210s Selecting previously unselected package fontconfig-config.
1210s Preparing to unpack .../058-fontconfig-config_2.15.0-1ubuntu1_arm64.deb ...
1210s Unpacking fontconfig-config (2.15.0-1ubuntu1) ...
1210s Selecting previously unselected package libfontconfig1:arm64.
1210s Preparing to unpack .../059-libfontconfig1_2.15.0-1ubuntu1_arm64.deb ...
1210s Unpacking libfontconfig1:arm64 (2.15.0-1ubuntu1) ...
1210s Selecting previously unselected package libxrender1:arm64.
1210s Preparing to unpack .../060-libxrender1_1%3a0.9.10-1.1_arm64.deb ...
1210s Unpacking libxrender1:arm64 (1:0.9.10-1.1) ...
1210s Selecting previously unselected package libxft2:arm64.
1210s Preparing to unpack .../061-libxft2_2.3.6-1_arm64.deb ...
1210s Unpacking libxft2:arm64 (2.3.6-1) ...
1210s Selecting previously unselected package x11-common.
1210s Preparing to unpack .../062-x11-common_1%3a7.7+23ubuntu2_all.deb ...
1210s Unpacking x11-common (1:7.7+23ubuntu2) ...
1210s Selecting previously unselected package libxss1:arm64.
1210s Preparing to unpack .../063-libxss1_1%3a1.2.3-1build2_arm64.deb ...
1210s Unpacking libxss1:arm64 (1:1.2.3-1build2) ...
1210s Selecting previously unselected package libtk8.6:arm64.
1210s Preparing to unpack .../064-libtk8.6_8.6.14-1_arm64.deb ...
1210s Unpacking libtk8.6:arm64 (8.6.14-1) ...
1210s Selecting previously unselected package tk8.6-blt2.5.
1210s Preparing to unpack .../065-tk8.6-blt2.5_2.5.3+dfsg-7_arm64.deb ...
1210s Unpacking tk8.6-blt2.5 (2.5.3+dfsg-7) ...
1210s Selecting previously unselected package blt.
1210s Preparing to unpack .../066-blt_2.5.3+dfsg-7_arm64.deb ...
1210s Unpacking blt (2.5.3+dfsg-7) ...
1210s Selecting previously unselected package python3-tk:arm64.
1210s Preparing to unpack .../067-python3-tk_3.11.5-1_arm64.deb ...
1210s Unpacking python3-tk:arm64 (3.11.5-1) ...
1210s Selecting previously unselected package python3-pil.imagetk:arm64.
1210s Preparing to unpack .../068-python3-pil.imagetk_10.2.0-1_arm64.deb ...
1210s Unpacking python3-pil.imagetk:arm64 (10.2.0-1) ...
1210s Selecting previously unselected package libpython3.11-stdlib:arm64.
1210s Preparing to unpack .../069-libpython3.11-stdlib_3.11.8-1_arm64.deb ...
1210s Unpacking libpython3.11-stdlib:arm64 (3.11.8-1) ...
1210s Selecting previously unselected package python3.11.
1211s Preparing to unpack .../070-python3.11_3.11.8-1_arm64.deb ...
1211s Unpacking python3.11 (3.11.8-1) ...
1211s Selecting previously unselected package libblas3:arm64.
1211s Preparing to unpack .../071-libblas3_3.12.0-3_arm64.deb ...
1211s Unpacking libblas3:arm64 (3.12.0-3) ...
1211s Selecting previously unselected package libgfortran5:arm64.
1211s Preparing to unpack .../072-libgfortran5_14-20240303-1ubuntu1_arm64.deb ...
1211s Unpacking libgfortran5:arm64 (14-20240303-1ubuntu1) ...
1211s Selecting previously unselected package liblapack3:arm64.
1211s Preparing to unpack .../073-liblapack3_3.12.0-3_arm64.deb ...
1211s Unpacking liblapack3:arm64 (3.12.0-3) ...
1211s Selecting previously unselected package python3-numpy.
1211s Preparing to unpack .../074-python3-numpy_1%3a1.24.2-2_arm64.deb ...
1211s Unpacking python3-numpy (1:1.24.2-2) ...
1211s Selecting previously unselected package python3-contourpy.
1211s Preparing to unpack .../075-python3-contourpy_1.0.7-1build2_arm64.deb ...
1211s Unpacking python3-contourpy (1.0.7-1build2) ...
1211s Selecting previously unselected package python3-cycler.
1211s Preparing to unpack .../076-python3-cycler_0.11.0-2_all.deb ...
1211s Unpacking python3-cycler (0.11.0-2) ...
1211s Selecting previously unselected package python3-brotli.
1211s Preparing to unpack .../077-python3-brotli_1.1.0-2_arm64.deb ...
1211s Unpacking python3-brotli (1.1.0-2) ...
1211s Selecting previously unselected package liblbfgsb0:arm64.
1211s Preparing to unpack .../078-liblbfgsb0_3.0+dfsg.4-1_arm64.deb ...
1211s Unpacking liblbfgsb0:arm64 (3.0+dfsg.4-1) ...
1211s Selecting previously unselected package python3-scipy.
1211s Preparing to unpack .../079-python3-scipy_1.11.4-6_arm64.deb ...
1211s Unpacking python3-scipy (1.11.4-6) ...
1212s Selecting previously unselected package python3-ufolib2.
1212s Preparing to unpack .../080-python3-ufolib2_0.16.0+dfsg1-1_all.deb ...
1212s Unpacking python3-ufolib2 (0.16.0+dfsg1-1) ...
1212s Selecting previously unselected package python3-mpmath.
1212s Preparing to unpack .../081-python3-mpmath_1.2.1-3_all.deb ...
1212s Unpacking python3-mpmath (1.2.1-3) ...
1212s Selecting previously unselected package python3-sympy.
1212s Preparing to unpack .../082-python3-sympy_1.12-7_all.deb ...
1212s Unpacking python3-sympy (1.12-7) ...
1212s Selecting previously unselected package python3-appdirs.
1212s Preparing to unpack .../083-python3-appdirs_1.4.4-4_all.deb ...
1212s Unpacking python3-appdirs (1.4.4-4) ...
1212s Selecting previously unselected package python3-fs.
1212s Preparing to unpack .../084-python3-fs_2.4.16-3_all.deb ...
1212s Unpacking python3-fs (2.4.16-3) ...
1212s Selecting previously unselected package python3-lz4.
1212s Preparing to unpack .../085-python3-lz4_4.0.2+dfsg-1build2_arm64.deb ...
1212s Unpacking python3-lz4 (4.0.2+dfsg-1build2) ...
1212s Selecting previously unselected package python3-unicodedata2.
1212s Preparing to unpack .../086-python3-unicodedata2_15.1.0+ds-1_arm64.deb ...
1212s Unpacking python3-unicodedata2 (15.1.0+ds-1) ...
1212s Selecting previously unselected package unicode-data.
1212s Preparing to unpack .../087-unicode-data_15.1.0-1_all.deb ...
1212s Unpacking unicode-data (15.1.0-1) ...
1212s Selecting previously unselected package python3-fonttools.
1212s Preparing to unpack .../088-python3-fonttools_4.46.0-1_arm64.deb ...
1212s Unpacking python3-fonttools (4.46.0-1) ...
1212s Selecting previously unselected package python3-kiwisolver.
1213s Preparing to unpack .../089-python3-kiwisolver_1.4.4-2_arm64.deb ...
1213s Unpacking python3-kiwisolver (1.4.4-2) ...
1213s Selecting previously unselected package python3-packaging.
1213s Preparing to unpack .../090-python3-packaging_23.2-1_all.deb ...
1213s Unpacking python3-packaging (23.2-1) ...
1213s Selecting previously unselected package libqhull-r8.0:arm64.
1213s Preparing to unpack .../091-libqhull-r8.0_2020.2-6_arm64.deb ...
1213s Unpacking libqhull-r8.0:arm64 (2020.2-6) ...
1213s Selecting previously unselected package python3-matplotlib.
1213s Preparing to unpack .../092-python3-matplotlib_3.6.3-1ubuntu3_arm64.deb ...
1213s Unpacking python3-matplotlib (3.6.3-1ubuntu3) ...
1213s Selecting previously unselected package python3-networkx.
1213s Preparing to unpack .../093-python3-networkx_2.8.8-1ubuntu1_all.deb ...
1213s Unpacking python3-networkx (2.8.8-1ubuntu1) ...
1213s Selecting previously unselected package python3-oscrypto.
1213s Preparing to unpack .../094-python3-oscrypto_1.3.0-5_all.deb ...
1213s Unpacking python3-oscrypto (1.3.0-5) ...
1213s Selecting previously unselected package libann0.
1213s Preparing to unpack .../095-libann0_1.1.2+doc-9_arm64.deb ...
1213s Unpacking libann0 (1.1.2+doc-9) ...
1213s Selecting previously unselected package libcdt5:arm64.
1213s Preparing to unpack .../096-libcdt5_2.42.2-8build1_arm64.deb ...
1213s Unpacking libcdt5:arm64 (2.42.2-8build1) ...
1213s Selecting previously unselected package libcgraph6:arm64.
1213s Preparing to unpack .../097-libcgraph6_2.42.2-8build1_arm64.deb ...
1213s Unpacking libcgraph6:arm64 (2.42.2-8build1) ...
1213s Selecting previously unselected package libxpm4:arm64.
1213s Preparing to unpack .../098-libxpm4_1%3a3.5.17-1_arm64.deb ...
1213s Unpacking libxpm4:arm64 (1:3.5.17-1) ...
1213s Selecting previously unselected package libgd3:arm64.
1213s Preparing to unpack .../099-libgd3_2.3.3-9ubuntu1_arm64.deb ...
1213s Unpacking libgd3:arm64 (2.3.3-9ubuntu1) ...
1213s Selecting previously unselected package libgts-0.7-5:arm64.
1213s Preparing to unpack .../100-libgts-0.7-5_0.7.6+darcs121130-5_arm64.deb ...
1213s Unpacking libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ...
1213s Selecting previously unselected package libpixman-1-0:arm64.
1213s Preparing to unpack .../101-libpixman-1-0_0.42.2-1_arm64.deb ...
1213s Unpacking libpixman-1-0:arm64 (0.42.2-1) ...
1213s Selecting previously unselected package libxcb-render0:arm64.
1213s Preparing to unpack .../102-libxcb-render0_1.15-1_arm64.deb ...
1213s Unpacking libxcb-render0:arm64 (1.15-1) ...
1213s Selecting previously unselected package libxcb-shm0:arm64.
1213s Preparing to unpack .../103-libxcb-shm0_1.15-1_arm64.deb ...
1213s Unpacking libxcb-shm0:arm64 (1.15-1) ...
1213s Selecting previously unselected package libcairo2:arm64.
1214s Preparing to unpack .../104-libcairo2_1.18.0-1_arm64.deb ...
1214s Unpacking libcairo2:arm64 (1.18.0-1) ...
1214s Selecting previously unselected package libltdl7:arm64.
1214s Preparing to unpack .../105-libltdl7_2.4.7-7_arm64.deb ...
1214s Unpacking libltdl7:arm64 (2.4.7-7) ...
1214s Selecting previously unselected package fontconfig.
1214s Preparing to unpack .../106-fontconfig_2.15.0-1ubuntu1_arm64.deb ...
1214s Unpacking fontconfig (2.15.0-1ubuntu1) ...
1214s Selecting previously unselected package libthai-data.
1214s Preparing to unpack .../107-libthai-data_0.1.29-2_all.deb ...
1214s Unpacking libthai-data (0.1.29-2) ...
1214s Selecting previously unselected package libdatrie1:arm64.
1214s Preparing to unpack .../108-libdatrie1_0.2.13-3_arm64.deb ...
1214s Unpacking libdatrie1:arm64 (0.2.13-3) ...
1214s Selecting previously unselected package libthai0:arm64.
1214s Preparing to unpack .../109-libthai0_0.1.29-2_arm64.deb ...
1214s Unpacking libthai0:arm64 (0.1.29-2) ...
1214s Selecting previously unselected package libpango-1.0-0:arm64.
1214s Preparing to unpack .../110-libpango-1.0-0_1.51.0+ds-4_arm64.deb ...
1214s Unpacking libpango-1.0-0:arm64 (1.51.0+ds-4) ...
1214s Selecting previously unselected package libpangoft2-1.0-0:arm64.
1214s Preparing to unpack .../111-libpangoft2-1.0-0_1.51.0+ds-4_arm64.deb ...
1214s Unpacking libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ...
1214s Selecting previously unselected package libpangocairo-1.0-0:arm64.
1214s Preparing to unpack .../112-libpangocairo-1.0-0_1.51.0+ds-4_arm64.deb ...
1214s Unpacking libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ...
1214s Selecting previously unselected package libpathplan4:arm64.
1214s Preparing to unpack .../113-libpathplan4_2.42.2-8build1_arm64.deb ...
1214s Unpacking libpathplan4:arm64 (2.42.2-8build1) ...
1214s Selecting previously unselected package libgvc6.
1214s Preparing to unpack .../114-libgvc6_2.42.2-8build1_arm64.deb ...
1214s Unpacking libgvc6 (2.42.2-8build1) ...
1214s Selecting previously unselected package libgvpr2:arm64.
1214s Preparing to unpack .../115-libgvpr2_2.42.2-8build1_arm64.deb ...
1214s Unpacking libgvpr2:arm64 (2.42.2-8build1) ...
1214s Selecting previously unselected package liblab-gamut1:arm64.
1214s Preparing to unpack .../116-liblab-gamut1_2.42.2-8build1_arm64.deb ...
1214s Unpacking liblab-gamut1:arm64 (2.42.2-8build1) ...
1214s Selecting previously unselected package libice6:arm64.
1214s Preparing to unpack .../117-libice6_2%3a1.0.10-1build2_arm64.deb ...
1214s Unpacking libice6:arm64 (2:1.0.10-1build2) ...
1214s Selecting previously unselected package libsm6:arm64.
1214s Preparing to unpack .../118-libsm6_2%3a1.2.3-1build2_arm64.deb ...
1214s Unpacking libsm6:arm64 (2:1.2.3-1build2) ...
1214s Selecting previously unselected package libxt6:arm64.
1214s Preparing to unpack .../119-libxt6_1%3a1.2.1-1.1_arm64.deb ...
1214s Unpacking libxt6:arm64 (1:1.2.1-1.1) ...
1214s Selecting previously unselected package libxmu6:arm64.
1214s Preparing to unpack .../120-libxmu6_2%3a1.1.3-3_arm64.deb ...
1214s Unpacking libxmu6:arm64 (2:1.1.3-3) ...
1214s Selecting previously unselected package libxaw7:arm64.
1214s Preparing to unpack .../121-libxaw7_2%3a1.0.14-1_arm64.deb ...
1214s Unpacking libxaw7:arm64 (2:1.0.14-1) ...
1214s Selecting previously unselected package graphviz.
1214s Preparing to unpack .../122-graphviz_2.42.2-8build1_arm64.deb ...
1214s Unpacking graphviz (2.42.2-8build1) ...
1214s Selecting previously unselected package python3-pydot.
1214s Preparing to unpack .../123-python3-pydot_1.4.2-2_all.deb ...
1214s Unpacking python3-pydot (1.4.2-2) ...
1214s Selecting previously unselected package androguard.
1214s Preparing to unpack .../124-androguard_3.4.0~a1-10_all.deb ...
1214s Unpacking androguard (3.4.0~a1-10) ...
1215s Selecting previously unselected package ca-certificates-java.
1215s Preparing to unpack .../125-ca-certificates-java_20240118_all.deb ...
1215s Unpacking ca-certificates-java (20240118) ...
1215s Selecting previously unselected package java-common.
1215s Preparing to unpack .../126-java-common_0.75+exp1_all.deb ...
1215s Unpacking java-common (0.75+exp1) ...
1215s Selecting previously unselected package libavahi-common-data:arm64.
1215s Preparing to unpack .../127-libavahi-common-data_0.8-13ubuntu2_arm64.deb ...
1215s Unpacking libavahi-common-data:arm64 (0.8-13ubuntu2) ...
1215s Selecting previously unselected package libavahi-common3:arm64.
1215s Preparing to unpack .../128-libavahi-common3_0.8-13ubuntu2_arm64.deb ...
1215s Unpacking libavahi-common3:arm64 (0.8-13ubuntu2) ...
1215s Selecting previously unselected package libavahi-client3:arm64.
1215s Preparing to unpack .../129-libavahi-client3_0.8-13ubuntu2_arm64.deb ...
1215s Unpacking libavahi-client3:arm64 (0.8-13ubuntu2) ...
1215s Selecting previously unselected package libcups2:arm64.
1215s Preparing to unpack .../130-libcups2_2.4.6-0ubuntu3_arm64.deb ...
1215s Unpacking libcups2:arm64 (2.4.6-0ubuntu3) ...
1215s Selecting previously unselected package libasound2-data.
1215s Preparing to unpack .../131-libasound2-data_1.2.10-3build1_all.deb ...
1215s Unpacking libasound2-data (1.2.10-3build1) ...
1215s Selecting previously unselected package libasound2:arm64.
1215s Preparing to unpack .../132-libasound2_1.2.10-3build1_arm64.deb ...
1215s Unpacking libasound2:arm64 (1.2.10-3build1) ...
1215s Selecting previously unselected package libpcsclite1:arm64.
1215s Preparing to unpack .../133-libpcsclite1_2.0.0-1_arm64.deb ...
1215s Unpacking libpcsclite1:arm64 (2.0.0-1) ...
1215s Selecting previously unselected package openjdk-21-jre-headless:arm64.
1215s Preparing to unpack .../134-openjdk-21-jre-headless_21.0.2+13-2_arm64.deb ...
1215s Unpacking openjdk-21-jre-headless:arm64 (21.0.2+13-2) ...
1216s Selecting previously unselected package default-jre-headless.
1216s Preparing to unpack .../135-default-jre-headless_2%3a1.21-75+exp1_arm64.deb ...
1216s Unpacking default-jre-headless (2:1.21-75+exp1) ...
1216s Selecting previously unselected package libgtk2.0-common.
1217s Preparing to unpack .../136-libgtk2.0-common_2.24.33-2ubuntu2_all.deb ...
1217s Unpacking libgtk2.0-common (2.24.33-2ubuntu2) ...
1217s Selecting previously unselected package at-spi2-common.
1217s Preparing to unpack .../137-at-spi2-common_2.50.0-1_all.deb ...
1217s Unpacking at-spi2-common (2.50.0-1) ...
1217s Selecting previously unselected package libatk1.0-0:arm64.
1217s Preparing to unpack .../138-libatk1.0-0_2.50.0-1_arm64.deb ...
1217s Unpacking libatk1.0-0:arm64 (2.50.0-1) ...
1217s Selecting previously unselected package libxcomposite1:arm64.
1217s Preparing to unpack .../139-libxcomposite1_1%3a0.4.5-1build2_arm64.deb ...
1217s Unpacking libxcomposite1:arm64 (1:0.4.5-1build2) ...
1217s Selecting previously unselected package libxfixes3:arm64.
1217s Preparing to unpack .../140-libxfixes3_1%3a6.0.0-2_arm64.deb ...
1217s Unpacking libxfixes3:arm64 (1:6.0.0-2) ...
1217s Selecting previously unselected package libxcursor1:arm64.
1217s Preparing to unpack .../141-libxcursor1_1%3a1.2.1-1_arm64.deb ...
1217s Unpacking libxcursor1:arm64 (1:1.2.1-1) ...
1217s Selecting previously unselected package libxdamage1:arm64.
1217s Preparing to unpack .../142-libxdamage1_1%3a1.1.6-1_arm64.deb ...
1217s Unpacking libxdamage1:arm64 (1:1.1.6-1) ...
1217s Selecting previously unselected package libxi6:arm64.
1217s Preparing to unpack .../143-libxi6_2%3a1.8.1-1_arm64.deb ...
1217s Unpacking libxi6:arm64 (2:1.8.1-1) ...
1217s Selecting previously unselected package libxinerama1:arm64.
1217s Preparing to unpack .../144-libxinerama1_2%3a1.1.4-3_arm64.deb ...
1217s Unpacking libxinerama1:arm64 (2:1.1.4-3) ...
1217s Selecting previously unselected package libxrandr2:arm64.
1217s Preparing to unpack .../145-libxrandr2_2%3a1.5.2-2_arm64.deb ...
1217s Unpacking libxrandr2:arm64 (2:1.5.2-2) ...
1217s Selecting previously unselected package libgtk2.0-0:arm64.
1217s Preparing to unpack .../146-libgtk2.0-0_2.24.33-2ubuntu2_arm64.deb ...
1217s Unpacking libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ...
1217s Selecting previously unselected package libglvnd0:arm64.
1217s Preparing to unpack .../147-libglvnd0_1.7.0-1_arm64.deb ...
1217s Unpacking libglvnd0:arm64 (1.7.0-1) ...
1217s Selecting previously unselected package libglapi-mesa:arm64.
1217s Preparing to unpack .../148-libglapi-mesa_24.0.1-1ubuntu1_arm64.deb ...
1217s Unpacking libglapi-mesa:arm64 (24.0.1-1ubuntu1) ...
1217s Selecting previously unselected package libx11-xcb1:arm64.
1217s Preparing to unpack .../149-libx11-xcb1_2%3a1.8.7-1_arm64.deb ...
1217s Unpacking libx11-xcb1:arm64 (2:1.8.7-1) ...
1217s Selecting previously unselected package libxcb-dri2-0:arm64.
1217s Preparing to unpack .../150-libxcb-dri2-0_1.15-1_arm64.deb ...
1217s Unpacking libxcb-dri2-0:arm64 (1.15-1) ...
1217s Selecting previously unselected package libxcb-dri3-0:arm64.
1217s Preparing to unpack .../151-libxcb-dri3-0_1.15-1_arm64.deb ...
1217s Unpacking libxcb-dri3-0:arm64 (1.15-1) ...
1217s Selecting previously unselected package libxcb-glx0:arm64.
1217s Preparing to unpack .../152-libxcb-glx0_1.15-1_arm64.deb ...
1217s Unpacking libxcb-glx0:arm64 (1.15-1) ...
1217s Selecting previously unselected package libxcb-present0:arm64.
1217s Preparing to unpack .../153-libxcb-present0_1.15-1_arm64.deb ...
1217s Unpacking libxcb-present0:arm64 (1.15-1) ...
1217s Selecting previously unselected package libxcb-randr0:arm64.
1217s Preparing to unpack .../154-libxcb-randr0_1.15-1_arm64.deb ...
1217s Unpacking libxcb-randr0:arm64 (1.15-1) ...
1218s Selecting previously unselected package libxcb-sync1:arm64.
1218s Preparing to unpack .../155-libxcb-sync1_1.15-1_arm64.deb ...
1218s Unpacking libxcb-sync1:arm64 (1.15-1) ...
1218s Selecting previously unselected package libxcb-xfixes0:arm64.
1218s Preparing to unpack .../156-libxcb-xfixes0_1.15-1_arm64.deb ...
1218s Unpacking libxcb-xfixes0:arm64 (1.15-1) ...
1218s Selecting previously unselected package libxshmfence1:arm64.
1218s Preparing to unpack .../157-libxshmfence1_1.3-1build4_arm64.deb ...
1218s Unpacking libxshmfence1:arm64 (1.3-1build4) ...
1218s Selecting previously unselected package libxxf86vm1:arm64.
1218s Preparing to unpack .../158-libxxf86vm1_1%3a1.1.4-1build3_arm64.deb ...
1218s Unpacking libxxf86vm1:arm64 (1:1.1.4-1build3) ...
1218s Selecting previously unselected package libvulkan1:arm64.
1218s Preparing to unpack .../159-libvulkan1_1.3.275.0-1_arm64.deb ...
1218s Unpacking libvulkan1:arm64 (1.3.275.0-1) ...
1218s Selecting previously unselected package libdrm-amdgpu1:arm64.
1218s Preparing to unpack .../160-libdrm-amdgpu1_2.4.120-2_arm64.deb ...
1218s Unpacking libdrm-amdgpu1:arm64 (2.4.120-2) ...
1218s Selecting previously unselected package libdrm-nouveau2:arm64.
1218s Preparing to unpack .../161-libdrm-nouveau2_2.4.120-2_arm64.deb ...
1218s Unpacking libdrm-nouveau2:arm64 (2.4.120-2) ...
1218s Selecting previously unselected package libdrm-radeon1:arm64.
1218s Preparing to unpack .../162-libdrm-radeon1_2.4.120-2_arm64.deb ...
1218s Unpacking libdrm-radeon1:arm64 (2.4.120-2) ...
1218s Selecting previously unselected package libllvm17:arm64.
1218s Preparing to unpack .../163-libllvm17_1%3a17.0.6-5build1_arm64.deb ...
1218s Unpacking libllvm17:arm64 (1:17.0.6-5build1) ...
1218s Selecting previously unselected package libgl1-mesa-dri:arm64.
1218s Preparing to unpack .../164-libgl1-mesa-dri_24.0.1-1ubuntu1_arm64.deb ...
1218s Unpacking libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ...
1219s Selecting previously unselected package libglx-mesa0:arm64.
1219s Preparing to unpack .../165-libglx-mesa0_24.0.1-1ubuntu1_arm64.deb ...
1219s Unpacking libglx-mesa0:arm64 (24.0.1-1ubuntu1) ...
1219s Selecting previously unselected package libglx0:arm64.
1219s Preparing to unpack .../166-libglx0_1.7.0-1_arm64.deb ...
1219s Unpacking libglx0:arm64 (1.7.0-1) ...
1219s Selecting previously unselected package libgl1:arm64.
1219s Preparing to unpack .../167-libgl1_1.7.0-1_arm64.deb ...
1219s Unpacking libgl1:arm64 (1.7.0-1) ...
1219s Selecting previously unselected package libgif7:arm64.
1219s Preparing to unpack .../168-libgif7_5.2.1-2.5_arm64.deb ...
1219s Unpacking libgif7:arm64 (5.2.1-2.5) ...
1219s Selecting previously unselected package libxtst6:arm64.
1219s Preparing to unpack .../169-libxtst6_2%3a1.2.3-1.1_arm64.deb ...
1219s Unpacking libxtst6:arm64 (2:1.2.3-1.1) ...
1219s Selecting previously unselected package openjdk-21-jre:arm64.
1219s Preparing to unpack .../170-openjdk-21-jre_21.0.2+13-2_arm64.deb ...
1219s Unpacking openjdk-21-jre:arm64 (21.0.2+13-2) ...
1219s Selecting previously unselected package default-jre.
1219s Preparing to unpack .../171-default-jre_2%3a1.21-75+exp1_arm64.deb ...
1219s Unpacking default-jre (2:1.21-75+exp1) ...
1219s Selecting previously unselected package libapksig-java.
1219s Preparing to unpack .../172-libapksig-java_31.0.2-1ubuntu1_all.deb ...
1219s Unpacking libapksig-java (31.0.2-1ubuntu1) ...
1219s Selecting previously unselected package apksigner.
1219s Preparing to unpack .../173-apksigner_31.0.2-1ubuntu1_all.deb ...
1219s Unpacking apksigner (31.0.2-1ubuntu1) ...
1219s Selecting previously unselected package openjdk-21-jdk-headless:arm64.
1219s Preparing to unpack .../174-openjdk-21-jdk-headless_21.0.2+13-2_arm64.deb ...
1219s Unpacking openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ...
1219s Selecting previously unselected package default-jdk-headless.
1219s Preparing to unpack .../175-default-jdk-headless_2%3a1.21-75+exp1_arm64.deb ...
1219s Unpacking default-jdk-headless (2:1.21-75+exp1) ...
1219s Selecting previously unselected package python3-args.
1219s Preparing to unpack .../176-python3-args_0.1.0-5_all.deb ...
1219s Unpacking python3-args (0.1.0-5) ...
1220s Selecting previously unselected package python3-clint.
1220s Preparing to unpack .../177-python3-clint_0.5.1-4_all.deb ...
1220s Unpacking python3-clint (0.5.1-4) ...
1220s Selecting previously unselected package python3-defusedxml.
1220s Preparing to unpack .../178-python3-defusedxml_0.7.1-2_all.deb ...
1220s Unpacking python3-defusedxml (0.7.1-2) ...
1220s Selecting previously unselected package liberror-perl.
1220s Preparing to unpack .../179-liberror-perl_0.17029-2_all.deb ...
1220s Unpacking liberror-perl (0.17029-2) ...
1220s Selecting previously unselected package git-man.
1220s Preparing to unpack .../180-git-man_1%3a2.43.0-1ubuntu1_all.deb ...
1220s Unpacking git-man (1:2.43.0-1ubuntu1) ...
1220s Selecting previously unselected package git.
1220s Preparing to unpack .../181-git_1%3a2.43.0-1ubuntu1_arm64.deb ...
1220s Unpacking git (1:2.43.0-1ubuntu1) ...
1220s Selecting previously unselected package python3-smmap.
1220s Preparing to unpack .../182-python3-smmap_6.0.0-1_all.deb ...
1220s Unpacking python3-smmap (6.0.0-1) ...
1220s Selecting previously unselected package python3-gitdb.
1220s Preparing to unpack .../183-python3-gitdb_4.0.11-1_all.deb ...
1220s Unpacking python3-gitdb (4.0.11-1) ...
1220s Selecting previously unselected package python3-git.
1220s Preparing to unpack .../184-python3-git_3.1.37-3_all.deb ...
1220s Unpacking python3-git (3.1.37-3) ...
1220s Selecting previously unselected package python3-lockfile.
1220s Preparing to unpack .../185-python3-lockfile_1%3a0.12.2-3_all.deb ...
1220s Unpacking python3-lockfile (1:0.12.2-3) ...
1220s Selecting previously unselected package python3-simplejson.
1220s Preparing to unpack .../186-python3-simplejson_3.19.2-1build1_arm64.deb ...
1220s Unpacking python3-simplejson (3.19.2-1build1) ...
1220s Selecting previously unselected package python3-libcloud.
1220s Preparing to unpack .../187-python3-libcloud_3.4.1-5_all.deb ...
1220s Unpacking python3-libcloud (3.4.1-5) ...
1220s Selecting previously unselected package python3-bcrypt.
1220s Preparing to unpack .../188-python3-bcrypt_3.2.2-1_arm64.deb ...
1220s Unpacking python3-bcrypt (3.2.2-1) ...
1220s Selecting previously unselected package libsodium23:arm64.
1220s Preparing to unpack .../189-libsodium23_1.0.18-1build2_arm64.deb ...
1220s Unpacking libsodium23:arm64 (1.0.18-1build2) ...
1220s Selecting previously unselected package python3-nacl.
1220s Preparing to unpack .../190-python3-nacl_1.5.0-4_arm64.deb ...
1220s Unpacking python3-nacl (1.5.0-4) ...
1220s Selecting previously unselected package python3-paramiko.
1220s Preparing to unpack .../191-python3-paramiko_2.12.0-2ubuntu4_all.deb ...
1220s Unpacking python3-paramiko (2.12.0-2ubuntu4) ...
1220s Selecting previously unselected package python3-pyasn1.
1220s Preparing to unpack .../192-python3-pyasn1_0.4.8-4_all.deb ...
1220s Unpacking python3-pyasn1 (0.4.8-4) ...
1220s Selecting previously unselected package python3-pyasn1-modules.
1220s Preparing to unpack .../193-python3-pyasn1-modules_0.2.8-1_all.deb ...
1220s Unpacking python3-pyasn1-modules (0.2.8-1) ...
1220s Selecting previously unselected package python3-png.
1220s Preparing to unpack .../194-python3-png_0.20231004.0-2_all.deb ...
1220s Unpacking python3-png (0.20231004.0-2) ...
1220s Selecting previously unselected package python3-qrcode.
1220s Preparing to unpack .../195-python3-qrcode_7.4.2-4_all.deb ...
1220s Unpacking python3-qrcode (7.4.2-4) ...
1220s Selecting previously unselected package python3-ruamel.yaml.clib:arm64.
1220s Preparing to unpack .../196-python3-ruamel.yaml.clib_0.2.8-1_arm64.deb ...
1220s Unpacking python3-ruamel.yaml.clib:arm64 (0.2.8-1) ...
1221s Selecting previously unselected package python3-ruamel.yaml.
1221s Preparing to unpack .../197-python3-ruamel.yaml_0.17.21-1_all.deb ...
1221s Unpacking python3-ruamel.yaml (0.17.21-1) ...
1221s Selecting previously unselected package python3-pathspec.
1221s Preparing to unpack .../198-python3-pathspec_0.12.1-1_all.deb ...
1221s Unpacking python3-pathspec (0.12.1-1) ...
1221s Selecting previously unselected package yamllint.
1221s Preparing to unpack .../199-yamllint_1.33.0-1_all.deb ...
1221s Unpacking yamllint (1.33.0-1) ...
1221s Selecting previously unselected package fdroidserver.
1221s Preparing to unpack .../200-fdroidserver_2.2.1-2_all.deb ...
1221s Unpacking fdroidserver (2.2.1-2) ...
1221s Selecting previously unselected package autopkgtest-satdep.
1221s Preparing to unpack .../201-2-autopkgtest-satdep.deb ...
1221s Unpacking autopkgtest-satdep (0) ...
1221s Setting up libgraphite2-3:arm64 (1.3.14-2) ...
1221s Setting up libxcb-dri3-0:arm64 (1.15-1) ...
1221s Setting up liblcms2-2:arm64 (2.14-2) ...
1221s Setting up libpixman-1-0:arm64 (0.42.2-1) ...
1221s Setting up python3-lockfile (1:0.12.2-3) ...
1221s Setting up libsharpyuv0:arm64 (1.3.2-0.4) ...
1221s Setting up libx11-xcb1:arm64 (2:1.8.7-1) ...
1221s Setting up python3-pure-eval (0.2.2-1) ...
1221s Setting up libdrm-nouveau2:arm64 (2.4.120-2) ...
1221s Setting up libsodium23:arm64 (1.0.18-1build2) ...
1221s Setting up libxdamage1:arm64 (1:1.1.6-1) ...
1221s Setting up libxcb-xfixes0:arm64 (1.15-1) ...
1221s Setting up liblerc4:arm64 (4.0.0+ds-4ubuntu1) ...
1221s Setting up libxpm4:arm64 (1:3.5.17-1) ...
1221s Setting up hicolor-icon-theme (0.17-2) ...
1221s Setting up libxi6:arm64 (2:1.8.1-1) ...
1221s Setting up java-common (0.75+exp1) ...
1221s Setting up libxrender1:arm64 (1:0.9.10-1.1) ...
1221s Setting up libdatrie1:arm64 (0.2.13-3) ...
1221s Setting up python3-parso (0.8.3-1) ...
1221s Setting up python3-colorama (0.4.6-4) ...
1221s Setting up python3-lz4 (4.0.2+dfsg-1build2) ...
1221s Setting up libxcb-render0:arm64 (1.15-1) ...
1221s Setting up python3-defusedxml (0.7.1-2) ...
1222s Setting up python3-asttokens (2.4.1-1) ...
1222s Setting up libdrm-radeon1:arm64 (2.4.120-2) ...
1222s Setting up libglvnd0:arm64 (1.7.0-1) ...
1222s Setting up python3-unicodedata2 (15.1.0+ds-1) ...
1222s Setting up fonts-lyx (2.4.0~RC3-1) ...
1222s Setting up libxcb-glx0:arm64 (1.15-1) ...
1222s Setting up python3-bcrypt (3.2.2-1) ...
1222s Setting up liblab-gamut1:arm64 (2.42.2-8build1) ...
1222s Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ...
1222s Setting up python3-ruamel.yaml.clib:arm64 (0.2.8-1) ...
1222s Setting up x11-common (1:7.7+23ubuntu2) ...
1222s Setting up libdeflate0:arm64 (1.19-1) ...
1222s Setting up libqhull-r8.0:arm64 (2020.2-6) ...
1222s Setting up libxcb-shm0:arm64 (1.15-1) ...
1222s Setting up libgomp1:arm64 (14-20240303-1ubuntu1) ...
1222s Setting up python3-click (8.1.6-1) ...
1222s Setting up python3-networkx (2.8.8-1ubuntu1) ...
1223s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:556: SyntaxWarning: invalid octal escape sequence '\420'
1223s   "graph [edge [ source u'u\4200' target u'u\4200' ] "
1223s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:557: SyntaxWarning: invalid octal escape sequence '\420'
1223s   + "node [ id u'u\4200' label b ] ]"
1223s Setting up libjbig0:arm64 (2.1-6.1ubuntu1) ...
1223s Setting up libxxf86vm1:arm64 (1:1.1.4-1build3) ...
1223s Setting up python3-png (0.20231004.0-2) ...
1223s Setting up libxcb-present0:arm64 (1.15-1) ...
1223s Setting up liberror-perl (0.17029-2) ...
1223s Setting up unicode-data (15.1.0-1) ...
1223s Setting up libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ...
1223s Setting up python3-simplejson (3.19.2-1build1) ...
1224s Setting up libasound2-data (1.2.10-3build1) ...
1224s Setting up python3-decorator (5.1.1-5) ...
1224s Setting up libblas3:arm64 (3.12.0-3) ...
1224s update-alternatives: using /usr/lib/aarch64-linux-gnu/blas/libblas.so.3 to provide /usr/lib/aarch64-linux-gnu/libblas.so.3 (libblas.so.3-aarch64-linux-gnu) in auto mode
1224s Setting up python3-packaging (23.2-1) ...
1224s Setting up python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ...
1224s Setting up python3-args (0.1.0-5) ...
1224s Setting up libxfixes3:arm64 (1:6.0.0-2) ...
1224s Setting up libxcb-sync1:arm64 (1.15-1) ...
1224s Setting up python3-executing (2.0.1-0.1) ...
1224s Setting up libpathplan4:arm64 (2.42.2-8build1) ...
1224s Setting up python3-brotli (1.1.0-2) ...
1224s Setting up libavahi-common-data:arm64 (0.8-13ubuntu2) ...
1224s Setting up libann0 (1.1.2+doc-9) ...
1224s Setting up python3-cycler (0.11.0-2) ...
1225s Setting up libxinerama1:arm64 (2:1.1.4-3) ...
1225s Setting up libimagequant0:arm64 (2.18.0-1) ...
1225s Setting up fonts-dejavu-mono (2.37-8) ...
1225s Setting up python3-kiwisolver (1.4.4-2) ...
1225s Setting up libxrandr2:arm64 (2:1.5.2-2) ...
1225s Setting up libtcl8.6:arm64 (8.6.13+dfsg-2) ...
1225s Setting up fonts-dejavu-core (2.37-8) ...
1225s Setting up libpcsclite1:arm64 (2.0.0-1) ...
1225s Setting up libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ...
1225s Setting up libltdl7:arm64 (2.4.7-7) ...
1225s Setting up libglapi-mesa:arm64 (24.0.1-1ubuntu1) ...
1225s Setting up libgfortran5:arm64 (14-20240303-1ubuntu1) ...
1225s Setting up libvulkan1:arm64 (1.3.275.0-1) ...
1225s Setting up libwebp7:arm64 (1.3.2-0.4) ...
1225s Setting up libxcb-dri2-0:arm64 (1.15-1) ...
1225s Setting up python3-ruamel.yaml (0.17.21-1) ...
1225s Setting up libgif7:arm64 (5.2.1-2.5) ...
1225s Setting up libxshmfence1:arm64 (1.3-1build4) ...
1225s Setting up at-spi2-common (2.50.0-1) ...
1225s Setting up libxcb-randr0:arm64 (1.15-1) ...
1225s Setting up python3-traitlets (5.5.0-2) ...
1225s Setting up libasound2:arm64 (1.2.10-3build1) ...
1225s Setting up libxslt1.1:arm64 (1.1.39-0exp1) ...
1225s Setting up python3-pyasn1 (0.4.8-4) ...
1225s Setting up libopenjp2-7:arm64 (2.5.0-2) ...
1225s Setting up git-man (1:2.43.0-1ubuntu1) ...
1225s Setting up libharfbuzz0b:arm64 (8.3.0-2) ...
1225s Setting up libthai-data (0.1.29-2) ...
1225s Setting up python3-dateutil (2.8.2-3) ...
1225s Setting up libgtk2.0-common (2.24.33-2ubuntu2) ...
1225s Setting up libcdt5:arm64 (2.42.2-8build1) ...
1225s Setting up libatk1.0-0:arm64 (2.50.0-1) ...
1225s Setting up libcgraph6:arm64 (2.42.2-8build1) ...
1225s Setting up libpython3.11-minimal:arm64 (3.11.8-1) ...
1225s Setting up libxss1:arm64 (1:1.2.3-1build2) ...
1225s Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ...
1225s Setting up ca-certificates-java (20240118) ...
1225s No JRE found. Skipping Java certificates setup.
1225s Setting up python3-mpmath (1.2.1-3) ...
1226s Setting up python3-magic (2:0.4.27-2) ...
1226s Setting up python-matplotlib-data (3.6.3-1ubuntu3) ...
1226s Setting up libwebpmux3:arm64 (1.3.2-0.4) ...
1226s Setting up python3-pathspec (0.12.1-1) ...
1226s Setting up python3-lib2to3 (3.11.5-1) ...
1226s Setting up libllvm17:arm64 (1:17.0.6-5build1) ...
1226s Setting up python3-appdirs (1.4.4-4) ...
1226s Setting up python3-smmap (6.0.0-1) ...
1227s Setting up libxcomposite1:arm64 (1:0.4.5-1build2) ...
1227s Setting up python3-stack-data (0.6.3-1) ...
1227s Setting up python3-asn1crypto (1.5.1-3) ...
1227s Setting up python3-nacl (1.5.0-4) ...
1227s Setting up libapksig-java (31.0.2-1ubuntu1) ...
1227s Setting up python3-ptyprocess (0.7.0-5) ...
1227s Setting up libdrm-amdgpu1:arm64 (2.4.120-2) ...
1227s Setting up libjpeg8:arm64 (8c-2ubuntu11) ...
1227s Setting up python3-prompt-toolkit (3.0.43-1) ...
1227s Setting up python3-distutils (3.11.5-1) ...
1228s python3.12: can't get files for byte-compilation
1228s Setting up python3.11-minimal (3.11.8-1) ...
1228s Setting up python3-sympy (1.12-7) ...
1233s Setting up libice6:arm64 (2:1.0.10-1build2) ...
1233s Setting up liblapack3:arm64 (3.12.0-3) ...
1233s update-alternatives: using /usr/lib/aarch64-linux-gnu/lapack/liblapack.so.3 to provide /usr/lib/aarch64-linux-gnu/liblapack.so.3 (liblapack.so.3-aarch64-linux-gnu) in auto mode
1233s Setting up python3-clint (0.5.1-4) ...
1233s /usr/lib/python3/dist-packages/clint/packages/appdirs.py:82: SyntaxWarning: invalid escape sequence '\D'
1233s   """Return full path to the user-shared data dir for this application.
1233s /usr/lib/python3/dist-packages/clint/packages/colorama/ansitowin32.py:43: SyntaxWarning: invalid escape sequence '\['
1233s   ANSI_RE = re.compile('\033\[((?:\d|;)*)([a-zA-Z])')
1233s /usr/lib/python3/dist-packages/clint/textui/colored.py:118: SyntaxWarning: invalid escape sequence '\$'
1233s   strip = re.compile("([^-_a-zA-Z0-9!@#%&=,/'\";:~`\$\^\*\(\)\+\[\]\.\{\}\|\?\<\>\\]+|[^\s]+)")
1233s Setting up python3-setuptools (68.1.2-2) ...
1234s Setting up python3-jedi (0.18.2-1ubuntu1) ...
1234s Setting up fontconfig-config (2.15.0-1ubuntu1) ...
1234s Setting up libxtst6:arm64 (2:1.2.3-1.1) ...
1234s Setting up libwebpdemux2:arm64 (1.3.2-0.4) ...
1234s Setting up libpython3.11-stdlib:arm64 (3.11.8-1) ...
1234s Setting up libxcursor1:arm64 (1:1.2.1-1) ...
1234s Setting up libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ...
1234s Setting up libavahi-common3:arm64 (0.8-13ubuntu2) ...
1234s Setting up python3-libcloud (3.4.1-5) ...
1235s Setting up python3-gitdb (4.0.11-1) ...
1235s Setting up python3-matplotlib-inline (0.1.6-2) ...
1235s Setting up python3-fs (2.4.16-3) ...
1235s Setting up libthai0:arm64 (0.1.29-2) ...
1235s Setting up yamllint (1.33.0-1) ...
1235s Setting up python3-oscrypto (1.3.0-5) ...
1236s Setting up libjs-jquery-ui (1.13.2+dfsg-1) ...
1236s Setting up python3-pexpect (4.9-2) ...
1236s Setting up python3-pyasn1-modules (0.2.8-1) ...
1236s Setting up libraqm0:arm64 (0.10.1-1) ...
1236s Setting up git (1:2.43.0-1ubuntu1) ...
1236s Setting up libgvpr2:arm64 (2.42.2-8build1) ...
1236s Setting up python3-lxml:arm64 (5.1.0-1) ...
1236s Setting up libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ...
1236s Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ...
1236s Setting up libfontconfig1:arm64 (2.15.0-1ubuntu1) ...
1236s Setting up python3-paramiko (2.12.0-2ubuntu4) ...
1236s Setting up libsm6:arm64 (2:1.2.3-1build2) ...
1236s Setting up libavahi-client3:arm64 (0.8-13ubuntu2) ...
1236s Setting up liblbfgsb0:arm64 (3.0+dfsg.4-1) ...
1236s Setting up gtk-update-icon-cache (3.24.40-2ubuntu1) ...
1236s Setting up python3.11 (3.11.8-1) ...
1237s Setting up fontconfig (2.15.0-1ubuntu1) ...
1239s Regenerating fonts cache... done.
1239s Setting up libxft2:arm64 (2.3.6-1) ...
1239s Setting up libglx-mesa0:arm64 (24.0.1-1ubuntu1) ...
1239s Setting up libglx0:arm64 (1.7.0-1) ...
1239s Setting up libtk8.6:arm64 (8.6.14-1) ...
1239s Setting up libpango-1.0-0:arm64 (1.51.0+ds-4) ...
1239s Setting up libcairo2:arm64 (1.18.0-1) ...
1239s Setting up python3-pil:arm64 (10.2.0-1) ...
1240s Setting up libgl1:arm64 (1.7.0-1) ...
1240s Setting up python3-ipython (8.20.0-1) ...
1240s Setting up python3-git (3.1.37-3) ...
1240s Setting up libgd3:arm64 (2.3.3-9ubuntu1) ...
1240s Setting up libxt6:arm64 (1:1.2.1-1.1) ...
1240s Setting up python3-numpy (1:1.24.2-2) ...
1242s Setting up libcups2:arm64 (2.4.6-0ubuntu3) ...
1242s Setting up python3-contourpy (1.0.7-1build2) ...
1242s Setting up python3-qrcode (7.4.2-4) ...
1242s update-alternatives: using /usr/bin/python3-qr to provide /usr/bin/qr (qr) in auto mode
1242s Setting up libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ...
1242s Setting up libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ...
1242s Setting up tk8.6-blt2.5 (2.5.3+dfsg-7) ...
1242s Setting up libxmu6:arm64 (2:1.1.3-3) ...
1242s Setting up python3-scipy (1.11.4-6) ...
1245s Setting up openjdk-21-jre-headless:arm64 (21.0.2+13-2) ...
1245s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode
1245s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode
1245s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode
1245s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode
1245s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode
1245s Setting up blt (2.5.3+dfsg-7) ...
1245s Setting up python3-tk:arm64 (3.11.5-1) ...
1245s Setting up libxaw7:arm64 (2:1.0.14-1) ...
1245s Setting up python3-pil.imagetk:arm64 (10.2.0-1) ...
1245s Setting up libgvc6 (2.42.2-8build1) ...
1246s Setting up graphviz (2.42.2-8build1) ...
1246s Setting up python3-pydot (1.4.2-2) ...
1246s Setting up python3-fonttools (4.46.0-1) ...
1246s Setting up adwaita-icon-theme (46~rc-1) ...
1246s update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode
1247s Setting up python3-ufolib2 (0.16.0+dfsg1-1) ...
1247s Setting up python3-matplotlib (3.6.3-1ubuntu3) ...
1248s Setting up libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ...
1248s Setting up androguard (3.4.0~a1-10) ...
1248s /usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:1027: SyntaxWarning: invalid escape sequence '\>'
1248s   """
1248s Setting up humanity-icon-theme (0.6.16) ...
1248s Setting up ubuntu-mono (24.04-0ubuntu1) ...
1248s Processing triggers for systemd (255.2-3ubuntu2) ...
1248s Processing triggers for man-db (2.12.0-3) ...
1249s Processing triggers for libc-bin (2.39-0ubuntu6) ...
1249s Processing triggers for ca-certificates-java (20240118) ...
1250s Adding debian:ACCVRAIZ1.pem
1250s Adding debian:AC_RAIZ_FNMT-RCM.pem
1250s Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem
1250s Adding debian:ANF_Secure_Server_Root_CA.pem
1250s Adding debian:Actalis_Authentication_Root_CA.pem
1250s Adding debian:AffirmTrust_Commercial.pem
1250s Adding debian:AffirmTrust_Networking.pem
1250s Adding debian:AffirmTrust_Premium.pem
1250s Adding debian:AffirmTrust_Premium_ECC.pem
1250s Adding debian:Amazon_Root_CA_1.pem
1250s Adding debian:Amazon_Root_CA_2.pem
1250s Adding debian:Amazon_Root_CA_3.pem
1250s Adding debian:Amazon_Root_CA_4.pem
1250s Adding debian:Atos_TrustedRoot_2011.pem
1250s Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem
1250s Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem
1250s Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem
1250s Adding debian:BJCA_Global_Root_CA1.pem
1250s Adding debian:BJCA_Global_Root_CA2.pem
1250s Adding debian:Baltimore_CyberTrust_Root.pem
1250s Adding debian:Buypass_Class_2_Root_CA.pem
1250s Adding debian:Buypass_Class_3_Root_CA.pem
1250s Adding debian:CA_Disig_Root_R2.pem
1250s Adding debian:CFCA_EV_ROOT.pem
1250s Adding debian:COMODO_Certification_Authority.pem
1250s Adding debian:COMODO_ECC_Certification_Authority.pem
1250s Adding debian:COMODO_RSA_Certification_Authority.pem
1250s Adding debian:Certainly_Root_E1.pem
1250s Adding debian:Certainly_Root_R1.pem
1250s Adding debian:Certigna.pem
1250s Adding debian:Certigna_Root_CA.pem
1250s Adding debian:Certum_EC-384_CA.pem
1250s Adding debian:Certum_Trusted_Network_CA.pem
1250s Adding debian:Certum_Trusted_Network_CA_2.pem
1250s Adding debian:Certum_Trusted_Root_CA.pem
1250s Adding debian:CommScope_Public_Trust_ECC_Root-01.pem
1250s Adding debian:CommScope_Public_Trust_ECC_Root-02.pem
1250s Adding debian:CommScope_Public_Trust_RSA_Root-01.pem
1250s Adding debian:CommScope_Public_Trust_RSA_Root-02.pem
1250s Adding debian:Comodo_AAA_Services_root.pem
1250s Adding debian:D-TRUST_BR_Root_CA_1_2020.pem
1250s Adding debian:D-TRUST_EV_Root_CA_1_2020.pem
1250s Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem
1250s Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem
1250s Adding debian:DigiCert_Assured_ID_Root_CA.pem
1250s Adding debian:DigiCert_Assured_ID_Root_G2.pem
1250s Adding debian:DigiCert_Assured_ID_Root_G3.pem
1250s Adding debian:DigiCert_Global_Root_CA.pem
1250s Adding debian:DigiCert_Global_Root_G2.pem
1250s Adding debian:DigiCert_Global_Root_G3.pem
1250s Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem
1250s Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem
1250s Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem
1250s Adding debian:DigiCert_Trusted_Root_G4.pem
1250s Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem
1250s Adding debian:Entrust_Root_Certification_Authority.pem
1250s Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem
1250s Adding debian:Entrust_Root_Certification_Authority_-_G2.pem
1250s Adding debian:Entrust_Root_Certification_Authority_-_G4.pem
1250s Adding debian:GDCA_TrustAUTH_R5_ROOT.pem
1250s Adding debian:GLOBALTRUST_2020.pem
1250s Adding debian:GTS_Root_R1.pem
1250s Adding debian:GTS_Root_R2.pem
1250s Adding debian:GTS_Root_R3.pem
1250s Adding debian:GTS_Root_R4.pem
1250s Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem
1250s Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem
1250s Adding debian:GlobalSign_Root_CA.pem
1250s Adding debian:GlobalSign_Root_CA_-_R3.pem
1250s Adding debian:GlobalSign_Root_CA_-_R6.pem
1250s Adding debian:GlobalSign_Root_E46.pem
1250s Adding debian:GlobalSign_Root_R46.pem
1250s Adding debian:Go_Daddy_Class_2_CA.pem
1250s Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem
1250s Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem
1250s Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem
1250s Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem
1250s Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem
1250s Adding debian:HiPKI_Root_CA_-_G1.pem
1250s Adding debian:Hongkong_Post_Root_CA_3.pem
1250s Adding debian:ISRG_Root_X1.pem
1250s Adding debian:ISRG_Root_X2.pem
1250s Adding debian:IdenTrust_Commercial_Root_CA_1.pem
1250s Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem
1250s Adding debian:Izenpe.com.pem
1250s Adding debian:Microsec_e-Szigno_Root_CA_2009.pem
1250s Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem
1250s Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem
1250s Adding debian:NAVER_Global_Root_Certification_Authority.pem
1250s Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem
1250s Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem
1250s Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem
1250s Adding debian:QuoVadis_Root_CA_1_G3.pem
1250s Adding debian:QuoVadis_Root_CA_2.pem
1250s Adding debian:QuoVadis_Root_CA_2_G3.pem
1250s Adding debian:QuoVadis_Root_CA_3.pem
1250s Adding debian:QuoVadis_Root_CA_3_G3.pem
1250s Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem
1250s Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem
1250s Adding debian:SSL.com_Root_Certification_Authority_ECC.pem
1250s Adding debian:SSL.com_Root_Certification_Authority_RSA.pem
1250s Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem
1250s Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem
1250s Adding debian:SZAFIR_ROOT_CA2.pem
1250s Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem
1250s Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem
1250s Adding debian:SecureSign_RootCA11.pem
1250s Adding debian:SecureTrust_CA.pem
1250s Adding debian:Secure_Global_CA.pem
1250s Adding debian:Security_Communication_ECC_RootCA1.pem
1250s Adding debian:Security_Communication_RootCA2.pem
1250s Adding debian:Security_Communication_RootCA3.pem
1250s Adding debian:Security_Communication_Root_CA.pem
1250s Adding debian:Starfield_Class_2_CA.pem
1250s Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem
1250s Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem
1250s Adding debian:SwissSign_Gold_CA_-_G2.pem
1250s Adding debian:SwissSign_Silver_CA_-_G2.pem
1250s Adding debian:T-TeleSec_GlobalRoot_Class_2.pem
1250s Adding debian:T-TeleSec_GlobalRoot_Class_3.pem
1250s Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem
1250s Adding debian:TWCA_Global_Root_CA.pem
1250s Adding debian:TWCA_Root_Certification_Authority.pem
1250s Adding debian:TeliaSonera_Root_CA_v1.pem
1250s Adding debian:Telia_Root_CA_v2.pem
1250s Adding debian:TrustAsia_Global_Root_CA_G3.pem
1250s Adding debian:TrustAsia_Global_Root_CA_G4.pem
1250s Adding debian:Trustwave_Global_Certification_Authority.pem
1250s Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem
1250s Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem
1250s Adding debian:TunTrust_Root_CA.pem
1250s Adding debian:UCA_Extended_Validation_Root.pem
1251s Adding debian:UCA_Global_G2_Root.pem
1251s Adding debian:USERTrust_ECC_Certification_Authority.pem
1251s Adding debian:USERTrust_RSA_Certification_Authority.pem
1251s Adding debian:XRamp_Global_CA_Root.pem
1251s Adding debian:certSIGN_ROOT_CA.pem
1251s Adding debian:certSIGN_Root_CA_G2.pem
1251s Adding debian:e-Szigno_Root_CA_2017.pem
1251s Adding debian:ePKI_Root_Certification_Authority.pem
1251s Adding debian:emSign_ECC_Root_CA_-_C3.pem
1251s Adding debian:emSign_ECC_Root_CA_-_G3.pem
1251s Adding debian:emSign_Root_CA_-_C1.pem
1251s Adding debian:emSign_Root_CA_-_G1.pem
1251s Adding debian:vTrus_ECC_Root_CA.pem
1251s Adding debian:vTrus_Root_CA.pem
1251s done.
1251s Setting up openjdk-21-jre:arm64 (21.0.2+13-2) ...
1251s Setting up openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ...
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode
1251s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode
1251s Setting up default-jre-headless (2:1.21-75+exp1) ...
1251s Setting up apksigner (31.0.2-1ubuntu1) ...
1251s Setting up fdroidserver (2.2.1-2) ...
1251s Setting up default-jre (2:1.21-75+exp1) ...
1251s Setting up default-jdk-headless (2:1.21-75+exp1) ...
1251s Setting up autopkgtest-satdep (0) ...
1258s (Reading database ... 103084 files and directories currently installed.)
1258s Removing autopkgtest-satdep (0) ...
1260s autopkgtest [05:50:35]: test locales: [-----------------------
1261s + LC_ALL=bo fdroid update --help
1261s + grep པ
1261s + LC_ALL=de fdroid update --help
1261s + grep gewöhnlich
1262s + + grep show this help
1262s LC_ALL=en fdroid update --help
1262s + LC_ALL=es fdroid update --help
1262s + grep información
1263s + LC_ALL=fr fdroid update --help
1263s + grep métadonnées
1263s + LC_ALL=hu fdroid update --help
1263s + grep Metaadatfájl
1263s + LC_ALL=ko fdroid update --help
1263s + grep 명
1264s + LC_ALL=ru fdroid update --help
1264s + grep неподписанны
1264s + LC_ALL=uk fdroid update --help
1264s + grep репозитор
1265s + + grep 签
1265s LC_ALL=zh_Hans fdroid update --help
1265s + + LC_ALL=zh_Hant fdroid update --help
1265s grep 簽
1266s autopkgtest [05:50:41]: test locales: -----------------------]
1267s autopkgtest [05:50:42]: test locales:  - - - - - - - - - - results - - - - - - - - - -
1267s locales              PASS
1267s autopkgtest [05:50:42]: @@@@@@@@@@@@@@@@@@@@ summary
1267s command1             PASS
1267s locales              PASS
1278s Creating nova instance adt-noble-arm64-fdroidserver-20240326-052935-juju-7f2275-prod-proposed-migration-environment-3 from image adt/ubuntu-noble-arm64-server-20240326.img (UUID 2d366976-4689-4c6f-acab-b55163b07c34)...