0s autopkgtest [19:52:07]: starting date: 2024-03-07 0s autopkgtest [19:52:07]: git checkout: d9c0295 adt_testbed.py: supress warnings from apt using a shell pipeline 0s autopkgtest [19:52:07]: host juju-7f2275-prod-proposed-migration-environment-2; command line: /home/ubuntu/autopkgtest/runner/autopkgtest --output-dir /tmp/autopkgtest-work.r01d30ih/out --timeout-copy=6000 --setup-commands /home/ubuntu/autopkgtest-cloud/worker-config-production/setup-canonical.sh --setup-commands /home/ubuntu/autopkgtest/setup-commands/setup-testbed --apt-pocket=proposed=src:rsync,src:openssl --apt-upgrade fdroidserver --timeout-short=300 --timeout-copy=20000 --timeout-build=20000 '--env=ADT_TEST_TRIGGERS=rsync/3.2.7-1build1 openssl/3.0.10-1ubuntu5' -- ssh -s /home/ubuntu/autopkgtest/ssh-setup/nova -- --flavor autopkgtest --security-groups autopkgtest-juju-7f2275-prod-proposed-migration-environment-2@bos01-arm64-8.secgroup --name adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-proposed-migration-environment-2 --image adt/ubuntu-noble-arm64-server --keyname testbed-juju-7f2275-prod-proposed-migration-environment-2 --net-id=net_prod-proposed-migration -e TERM=linux -e ''"'"'http_proxy=http://squid.internal:3128'"'"'' -e ''"'"'https_proxy=http://squid.internal:3128'"'"'' -e ''"'"'no_proxy=127.0.0.1,127.0.1.1,login.ubuntu.com,localhost,localdomain,novalocal,internal,archive.ubuntu.com,ports.ubuntu.com,security.ubuntu.com,ddebs.ubuntu.com,changelogs.ubuntu.com,launchpadlibrarian.net,launchpadcontent.net,launchpad.net,10.24.0.0/24,keystone.ps5.canonical.com,objectstorage.prodstack5.canonical.com'"'"'' --mirror=http://us.ports.ubuntu.com/ubuntu-ports/ 104s autopkgtest [19:53:51]: @@@@@@@@@@@@@@@@@@@@ test bed setup 104s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 105s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [1833 kB] 105s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [23.8 kB] 105s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [321 kB] 105s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [3976 B] 105s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 Packages [444 kB] 105s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 c-n-f Metadata [3144 B] 105s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 Packages [20.3 kB] 105s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 c-n-f Metadata [116 B] 105s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 Packages [2165 kB] 105s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 c-n-f Metadata [8528 B] 105s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 Packages [21.5 kB] 105s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 c-n-f Metadata [116 B] 107s Fetched 4961 kB in 1s (4061 kB/s) 107s Reading package lists... 112s Reading package lists... 112s Building dependency tree... 112s Reading state information... 112s Calculating upgrade... 113s The following packages will be REMOVED: 113s libefiboot1 libefivar1 libssl3 113s The following NEW packages will be installed: 113s libefiboot1t64 libefivar1t64 libssl3t64 113s The following packages will be upgraded: 113s dmsetup grub-common grub2-common libdevmapper1.02.1 openssl pci.ids rsync 113s 7 upgraded, 3 newly installed, 3 to remove and 0 not upgraded. 113s Need to get 6589 kB of archives. 113s After this operation, 35.8 kB of additional disk space will be used. 113s Get:1 http://ftpmaster.internal/ubuntu noble/main arm64 libdevmapper1.02.1 arm64 2:1.02.185-3ubuntu1 [128 kB] 113s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 grub2-common arm64 2.12-1ubuntu4 [671 kB] 113s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 grub-common arm64 2.12-1ubuntu4 [2174 kB] 113s Get:4 http://ftpmaster.internal/ubuntu noble/main arm64 libefivar1t64 arm64 38-3.1 [55.1 kB] 113s Get:5 http://ftpmaster.internal/ubuntu noble/main arm64 libefiboot1t64 arm64 38-3.1 [40.5 kB] 113s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 openssl arm64 3.0.10-1ubuntu5 [982 kB] 113s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 rsync arm64 3.2.7-1build1 [427 kB] 113s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 libssl3t64 arm64 3.0.10-1ubuntu5 [1763 kB] 113s Get:9 http://ftpmaster.internal/ubuntu noble/main arm64 dmsetup arm64 2:1.02.185-3ubuntu1 [74.5 kB] 113s Get:10 http://ftpmaster.internal/ubuntu noble/main arm64 pci.ids all 0.0~2024.02.02-1 [273 kB] 114s Preconfiguring packages ... 114s Fetched 6589 kB in 1s (7930 kB/s) 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75860 files and directories currently installed.) 114s Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.185-3ubuntu1_arm64.deb ... 114s Unpacking libdevmapper1.02.1:arm64 (2:1.02.185-3ubuntu1) over (2:1.02.185-2ubuntu1) ... 114s Preparing to unpack .../grub2-common_2.12-1ubuntu4_arm64.deb ... 114s Unpacking grub2-common (2.12-1ubuntu4) over (2.12-1ubuntu3) ... 114s Preparing to unpack .../grub-common_2.12-1ubuntu4_arm64.deb ... 114s Unpacking grub-common (2.12-1ubuntu4) over (2.12-1ubuntu3) ... 114s dpkg: libefivar1:arm64: dependency problems, but removing anyway as you requested: 114s mokutil depends on libefivar1 (>= 37). 114s libefiboot1:arm64 depends on libefivar1 (>= 38). 114s efibootmgr depends on libefivar1 (>= 38). 114s 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75860 files and directories currently installed.) 114s Removing libefivar1:arm64 (38-3) ... 114s Selecting previously unselected package libefivar1t64:arm64. 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75855 files and directories currently installed.) 114s Preparing to unpack .../libefivar1t64_38-3.1_arm64.deb ... 114s Unpacking libefivar1t64:arm64 (38-3.1) ... 114s dpkg: libefiboot1:arm64: dependency problems, but removing anyway as you requested: 114s efibootmgr depends on libefiboot1 (>= 38). 114s 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75861 files and directories currently installed.) 114s Removing libefiboot1:arm64 (38-3) ... 114s Selecting previously unselected package libefiboot1t64:arm64. 114s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75856 files and directories currently installed.) 114s Preparing to unpack .../libefiboot1t64_38-3.1_arm64.deb ... 114s Unpacking libefiboot1t64:arm64 (38-3.1) ... 114s Preparing to unpack .../openssl_3.0.10-1ubuntu5_arm64.deb ... 114s Unpacking openssl (3.0.10-1ubuntu5) over (3.0.10-1ubuntu4) ... 114s Preparing to unpack .../rsync_3.2.7-1build1_arm64.deb ... 114s Unpacking rsync (3.2.7-1build1) over (3.2.7-1) ... 115s dpkg: libssl3:arm64: dependency problems, but removing anyway as you requested: 115s wget depends on libssl3 (>= 3.0.0). 115s u-boot-tools depends on libssl3 (>= 3.0.0). 115s tnftp depends on libssl3 (>= 3.0.0). 115s tcpdump depends on libssl3 (>= 3.0.0). 115s systemd-resolved depends on libssl3 (>= 3.0.0). 115s systemd depends on libssl3 (>= 3.0.0). 115s sudo depends on libssl3 (>= 3.0.0). 115s sbsigntool depends on libssl3 (>= 3.0.0). 115s python3-cryptography depends on libssl3 (>= 3.0.0). 115s openssh-server depends on libssl3 (>= 3.0.10). 115s openssh-client depends on libssl3 (>= 3.0.10). 115s mtd-utils depends on libssl3 (>= 3.0.0). 115s mokutil depends on libssl3 (>= 3.0.0). 115s linux-headers-6.8.0-11-generic depends on libssl3 (>= 3.0.0). 115s libsystemd-shared:arm64 depends on libssl3 (>= 3.0.0). 115s libssh-4:arm64 depends on libssl3 (>= 3.0.0). 115s libsasl2-modules:arm64 depends on libssl3 (>= 3.0.0). 115s libsasl2-2:arm64 depends on libssl3 (>= 3.0.0). 115s libpython3.12-minimal:arm64 depends on libssl3 (>= 3.0.0). 115s libpython3.11-minimal:arm64 depends on libssl3 (>= 3.0.0). 115s libnvme1 depends on libssl3 (>= 3.0.0). 115s libkrb5-3:arm64 depends on libssl3 (>= 3.0.0). 115s libkmod2:arm64 depends on libssl3 (>= 3.0.0). 115s libfido2-1:arm64 depends on libssl3 (>= 3.0.0). 115s libcurl4:arm64 depends on libssl3 (>= 3.0.0). 115s libcryptsetup12:arm64 depends on libssl3 (>= 3.0.0). 115s kmod depends on libssl3 (>= 3.0.0). 115s dhcpcd-base depends on libssl3 (>= 3.0.0). 115s bind9-libs:arm64 depends on libssl3 (>= 3.0.0). 115s 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75862 files and directories currently installed.) 115s Removing libssl3:arm64 (3.0.10-1ubuntu4) ... 115s Selecting previously unselected package libssl3t64:arm64. 115s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75851 files and directories currently installed.) 115s Preparing to unpack .../libssl3t64_3.0.10-1ubuntu5_arm64.deb ... 115s Unpacking libssl3t64:arm64 (3.0.10-1ubuntu5) ... 115s Preparing to unpack .../dmsetup_2%3a1.02.185-3ubuntu1_arm64.deb ... 115s Unpacking dmsetup (2:1.02.185-3ubuntu1) over (2:1.02.185-2ubuntu1) ... 115s Preparing to unpack .../pci.ids_0.0~2024.02.02-1_all.deb ... 115s Unpacking pci.ids (0.0~2024.02.02-1) over (0.0~2023.11.11-1) ... 115s Setting up pci.ids (0.0~2024.02.02-1) ... 115s Setting up libssl3t64:arm64 (3.0.10-1ubuntu5) ... 115s Setting up libefivar1t64:arm64 (38-3.1) ... 115s Setting up libdevmapper1.02.1:arm64 (2:1.02.185-3ubuntu1) ... 115s Setting up dmsetup (2:1.02.185-3ubuntu1) ... 115s Setting up libefiboot1t64:arm64 (38-3.1) ... 115s Setting up openssl (3.0.10-1ubuntu5) ... 115s Setting up rsync (3.2.7-1build1) ... 116s rsync.service is a disabled or a static unit not running, not starting it. 116s Setting up grub-common (2.12-1ubuntu4) ... 116s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 116s Setting up grub2-common (2.12-1ubuntu4) ... 116s Processing triggers for man-db (2.12.0-3) ... 117s Processing triggers for install-info (7.1-3) ... 117s Processing triggers for initramfs-tools (0.142ubuntu19) ... 117s update-initramfs: Generating /boot/initrd.img-6.8.0-11-generic 117s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 126s System running in EFI mode, skipping. 126s Processing triggers for libc-bin (2.39-0ubuntu2) ... 126s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 126s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 126s Reading package lists... 127s Building dependency tree... 127s Reading state information... 127s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 128s sh: Attempting to set up Debian/Ubuntu apt sources automatically 128s sh: Distribution appears to be Ubuntu 130s Reading package lists... 131s Building dependency tree... 131s Reading state information... 131s eatmydata is already the newest version (131-1). 131s dbus is already the newest version (1.14.10-4ubuntu1). 131s dbus set to manually installed. 131s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 131s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 131s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 131s Reading package lists... 132s Building dependency tree... 132s Reading state information... 132s rng-tools-debian is already the newest version (2.4). 132s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 132s Reading package lists... 133s Building dependency tree... 133s Reading state information... 133s haveged is already the newest version (1.9.14-1ubuntu1). 133s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 133s Reading package lists... 133s Building dependency tree... 133s Reading state information... 134s The following packages will be REMOVED: 134s cloud-init* python3-configobj* python3-debconf* 134s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded. 134s After this operation, 3248 kB disk space will be freed. 134s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75864 files and directories currently installed.) 134s Removing cloud-init (24.1-0ubuntu1) ... 135s Removing python3-configobj (5.0.8-3) ... 135s Removing python3-debconf (1.5.86) ... 135s Processing triggers for man-db (2.12.0-3) ... 135s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75475 files and directories currently installed.) 135s Purging configuration files for cloud-init (24.1-0ubuntu1) ... 136s dpkg: warning: while removing cloud-init, directory '/etc/cloud/cloud.cfg.d' not empty so not removed 136s Processing triggers for rsyslog (8.2312.0-3ubuntu3) ... 136s Reading package lists... 136s Building dependency tree... 136s Reading state information... 137s linux-generic is already the newest version (6.8.0-11.11+1). 137s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 137s Hit:1 http://ftpmaster.internal/ubuntu noble InRelease 137s Hit:2 http://ftpmaster.internal/ubuntu noble-updates InRelease 138s Hit:3 http://ftpmaster.internal/ubuntu noble-security InRelease 138s Hit:4 http://ftpmaster.internal/ubuntu noble-proposed InRelease 138s Hit:5 http://ftpmaster.internal/ubuntu noble-backports InRelease 141s Reading package lists... 141s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 141s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 141s Reading package lists... 141s Building dependency tree... 141s Reading state information... 141s Calculating upgrade... 142s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 142s Reading package lists... 142s Building dependency tree... 142s Reading state information... 143s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 143s autopkgtest [19:54:30]: rebooting testbed after setup commands that affected boot 179s autopkgtest [19:55:06]: testbed running kernel: Linux 6.8.0-11-generic #11-Ubuntu SMP PREEMPT_DYNAMIC Wed Feb 14 02:53:31 UTC 2024 179s autopkgtest [19:55:06]: testbed dpkg architecture: arm64 181s autopkgtest [19:55:08]: @@@@@@@@@@@@@@@@@@@@ apt-source fdroidserver 181s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 181s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 181s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 182s Get:1 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (dsc) [2534 B] 182s Get:2 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (tar) [4993 kB] 182s Get:3 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (asc) [488 B] 182s Get:4 http://ftpmaster.internal/ubuntu noble/universe fdroidserver 2.2.1-2 (diff) [20.9 kB] 182s gpgv: Signature made Fri Jan 26 08:13:42 2024 UTC 182s gpgv: using RSA key 73B299CBD4EEADDCC017E87A5BFFDCC258E69433 182s gpgv: Can't check signature: No public key 182s dpkg-source: warning: cannot verify inline signature for ./fdroidserver_2.2.1-2.dsc: no acceptable signature found 183s autopkgtest [19:55:10]: testing package fdroidserver version 2.2.1-2 183s autopkgtest [19:55:10]: build not needed 184s autopkgtest [19:55:11]: test command1: preparing testbed 185s Reading package lists... 186s Building dependency tree... 186s Reading state information... 186s Correcting dependencies...Starting pkgProblemResolver with broken count: 0 186s Starting 2 pkgProblemResolver with broken count: 0 186s Done 186s Done 187s Starting pkgProblemResolver with broken count: 0 187s Starting 2 pkgProblemResolver with broken count: 0 187s Done 187s The following additional packages will be installed: 187s adwaita-icon-theme androguard android-libart android-libbacktrace 187s android-libbase android-liblog android-libnativebridge 187s android-libnativeloader android-libziparchive apksigner at-spi2-common blt 187s ca-certificates-java default-jdk-headless default-jre default-jre-headless 187s dexdump fdroidserver fontconfig fontconfig-config fonts-dejavu-core 187s fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache 187s hicolor-icon-theme humanity-icon-theme java-common libann0 libapksig-java 187s libasound2 libasound2-data libatk1.0-0 libatomic1 libavahi-client3 187s libavahi-common-data libavahi-common3 libblas3 libcairo2 libcdt5 libcgraph6 187s libcups2 libdatrie1 libdeflate0 libdrm-amdgpu1 libdrm-nouveau2 187s libdrm-radeon1 liberror-perl libfontconfig1 libgd3 libgdk-pixbuf-2.0-0 187s libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1 libgl1-mesa-dri 187s libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 libgraphite2-3 187s libgtk2.0-0 libgtk2.0-common libgts-0.7-5 libgvc6 libgvpr2 libharfbuzz0b 187s libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 libjs-jquery 187s libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 liblerc4 187s libllvm17 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0 187s libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0 libqhull-r8.0 187s libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 187s libtiff6 libtk8.6 libvulkan1 libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 187s libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 187s libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 187s libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 187s libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 187s libxss1 libxt6 libxtst6 libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre 187s openjdk-21-jre-headless python-matplotlib-data python3-appdirs python3-args 187s python3-asn1crypto python3-asttokens python3-bcrypt python3-brotli 187s python3-click python3-clint python3-colorama python3-contourpy 187s python3-cycler python3-dateutil python3-decorator python3-defusedxml 187s python3-executing python3-fonttools python3-fs python3-git python3-gitdb 187s python3-ipython python3-jedi python3-kiwisolver python3-libcloud 187s python3-lockfile python3-lxml python3-lz4 python3-magic python3-matplotlib 187s python3-matplotlib-inline python3-mpmath python3-nacl python3-networkx 187s python3-numpy python3-oscrypto python3-packaging python3-paramiko 187s python3-parso python3-pathspec python3-pexpect python3-pil 187s python3-pil.imagetk python3-png python3-prompt-toolkit python3-ptyprocess 187s python3-pure-eval python3-pyasn1 python3-pyasn1-modules python3-pydot 187s python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy 187s python3-simplejson python3-smmap python3-stack-data python3-sympy python3-tk 187s python3-traitlets python3-ufolib2 python3-unicodedata2 python3-wcwidth 187s tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint 187s Suggested packages: 187s blt-demo gradle ipfs-cid vagrant vagrant-cachier vagrant-libvirt qemu-kvm 187s git-daemon-run | git-daemon-sysvinit git-doc git-email git-gui gitk gitweb 187s git-cvs git-mediawiki git-svn gsfonts graphviz-doc libasound2-plugins 187s alsa-utils cups-common libgd-tools gvfs libjs-jquery-ui-docs liblcms2-utils 187s pcscd tcl8.6 tk8.6 openjdk-21-demo openjdk-21-source libnss-mdns 187s fonts-dejavu-extra fonts-ipafont-gothic fonts-ipafont-mincho 187s fonts-wqy-microhei | fonts-wqy-zenhei fonts-indic python-cycler-doc 187s python-git-doc python-ipython-doc python-lockfile-doc python-lxml-doc 187s cm-super-minimal dvipng ffmpeg fonts-staypuft ghostscript gir1.2-gtk-3.0 187s inkscape ipython3 librsvg2-common python3-cairocffi python3-gi-cairo 187s python3-gobject python3-pyqt5 python3-sip python3-tornado 187s texlive-extra-utils texlive-latex-extra python-mpmath-doc python3-gmpy2 187s python-nacl-doc python-networkx-doc python3-gdal python3-pygraphviz gcc 187s gfortran python3-dev python3-pytest python3-gssapi python3-invoke 187s python-pexpect-doc python-pil-doc python-scipy-doc texlive-fonts-extra 187s python-sympy-doc tix python3-tk-dbg 187s Recommended packages: 187s librsvg2-common python3-pyperclip python3-pyqt5 android-sdk opensc s3cmd 187s fonts-liberation2 alsa-ucm-conf alsa-topology-conf libgdk-pixbuf2.0-bin 187s libgl1-amber-dri libgail-common libgtk2.0-bin libgts-bin javascript-common 187s mesa-vulkan-drivers | vulkan-icd libatk-wrapper-java-jni fonts-dejavu-extra 187s python3-bs4 python3-cssselect python3-html5lib python3-olefile g++ 187s | c++-compiler isympy-common 187s The following NEW packages will be installed: 187s adwaita-icon-theme androguard android-libart android-libbacktrace 187s android-libbase android-liblog android-libnativebridge 187s android-libnativeloader android-libziparchive apksigner at-spi2-common blt 187s ca-certificates-java default-jdk-headless default-jre default-jre-headless 187s dexdump fdroidserver fontconfig fontconfig-config fonts-dejavu-core 187s fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache 187s hicolor-icon-theme humanity-icon-theme java-common libann0 libapksig-java 187s libasound2 libasound2-data libatk1.0-0 libatomic1 libavahi-client3 187s libavahi-common-data libavahi-common3 libblas3 libcairo2 libcdt5 libcgraph6 187s libcups2 libdatrie1 libdeflate0 libdrm-amdgpu1 libdrm-nouveau2 187s libdrm-radeon1 liberror-perl libfontconfig1 libgd3 libgdk-pixbuf-2.0-0 187s libgdk-pixbuf2.0-common libgfortran5 libgif7 libgl1 libgl1-mesa-dri 187s libglapi-mesa libglvnd0 libglx-mesa0 libglx0 libgomp1 libgraphite2-3 187s libgtk2.0-0 libgtk2.0-common libgts-0.7-5 libgvc6 libgvpr2 libharfbuzz0b 187s libice6 libimagequant0 libjbig0 libjpeg-turbo8 libjpeg8 libjs-jquery 187s libjs-jquery-ui liblab-gamut1 liblapack3 liblbfgsb0 liblcms2-2 liblerc4 187s libllvm17 libltdl7 libopenjp2-7 libpango-1.0-0 libpangocairo-1.0-0 187s libpangoft2-1.0-0 libpathplan4 libpcsclite1 libpixman-1-0 libqhull-r8.0 187s libraqm0 libsharpyuv0 libsm6 libsodium23 libtcl8.6 libthai-data libthai0 187s libtiff6 libtk8.6 libvulkan1 libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 187s libxaw7 libxcb-dri2-0 libxcb-dri3-0 libxcb-glx0 libxcb-present0 187s libxcb-randr0 libxcb-render0 libxcb-shm0 libxcb-sync1 libxcb-xfixes0 187s libxcomposite1 libxcursor1 libxdamage1 libxfixes3 libxft2 libxi6 187s libxinerama1 libxmu6 libxpm4 libxrandr2 libxrender1 libxshmfence1 libxslt1.1 187s libxss1 libxt6 libxtst6 libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre 187s openjdk-21-jre-headless python-matplotlib-data python3-appdirs python3-args 187s python3-asn1crypto python3-asttokens python3-bcrypt python3-brotli 187s python3-click python3-clint python3-colorama python3-contourpy 187s python3-cycler python3-dateutil python3-decorator python3-defusedxml 187s python3-executing python3-fonttools python3-fs python3-git python3-gitdb 187s python3-ipython python3-jedi python3-kiwisolver python3-libcloud 187s python3-lockfile python3-lxml python3-lz4 python3-magic python3-matplotlib 187s python3-matplotlib-inline python3-mpmath python3-nacl python3-networkx 187s python3-numpy python3-oscrypto python3-packaging python3-paramiko 187s python3-parso python3-pathspec python3-pexpect python3-pil 187s python3-pil.imagetk python3-png python3-prompt-toolkit python3-ptyprocess 187s python3-pure-eval python3-pyasn1 python3-pyasn1-modules python3-pydot 187s python3-qrcode python3-ruamel.yaml python3-ruamel.yaml.clib python3-scipy 187s python3-simplejson python3-smmap python3-stack-data python3-sympy python3-tk 187s python3-traitlets python3-ufolib2 python3-unicodedata2 python3-wcwidth 187s tk8.6-blt2.5 ubuntu-mono unicode-data x11-common yamllint 188s 0 upgraded, 203 newly installed, 0 to remove and 0 not upgraded. 188s 1 not fully installed or removed. 188s Need to get 286 MB of archives. 188s After this operation, 975 MB of additional disk space will be used. 188s Get:1 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asn1crypto all 1.5.1-3 [79.7 kB] 188s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 python3-colorama all 0.4.6-4 [32.1 kB] 188s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 python3-click all 8.1.6-1 [79.0 kB] 188s Get:4 http://ftpmaster.internal/ubuntu noble/main arm64 python3-decorator all 5.1.1-5 [10.1 kB] 188s Get:5 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-parso all 0.8.3-1 [67.2 kB] 188s Get:6 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-jedi all 0.18.2-1ubuntu1 [692 kB] 188s Get:7 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-traitlets all 5.5.0-2 [85.0 kB] 188s Get:8 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib-inline all 0.1.6-2 [8784 B] 188s Get:9 http://ftpmaster.internal/ubuntu noble/main arm64 python3-ptyprocess all 0.7.0-5 [15.1 kB] 188s Get:10 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pexpect all 4.9-2 [48.1 kB] 188s Get:11 http://ftpmaster.internal/ubuntu noble/main arm64 python3-wcwidth all 0.2.5+dfsg1-1.1ubuntu1 [22.5 kB] 188s Get:12 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-prompt-toolkit all 3.0.43-1 [256 kB] 188s Get:13 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asttokens all 2.4.1-1 [20.9 kB] 188s Get:14 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-executing all 2.0.1-0.1 [23.3 kB] 188s Get:15 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pure-eval all 0.2.2-1 [11.3 kB] 188s Get:16 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-stack-data all 0.6.3-1 [22.0 kB] 188s Get:17 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ipython all 8.20.0-1 [561 kB] 188s Get:18 http://ftpmaster.internal/ubuntu noble/main arm64 libxslt1.1 arm64 1.1.35-1 [161 kB] 188s Get:19 http://ftpmaster.internal/ubuntu noble/main arm64 python3-lxml arm64 5.1.0-1 [2042 kB] 188s Get:20 http://ftpmaster.internal/ubuntu noble/main arm64 python3-magic all 2:0.4.27-2 [13.4 kB] 188s Get:21 http://ftpmaster.internal/ubuntu noble/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [328 kB] 188s Get:22 http://ftpmaster.internal/ubuntu noble/universe arm64 libjs-jquery-ui all 1.13.2+dfsg-1 [252 kB] 188s Get:23 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-mono all 2.37-8 [502 kB] 188s Get:24 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-core all 2.37-8 [835 kB] 188s Get:25 http://ftpmaster.internal/ubuntu noble/universe arm64 fonts-lyx all 2.4.0~RC3-1 [170 kB] 188s Get:26 http://ftpmaster.internal/ubuntu noble/universe arm64 python-matplotlib-data all 3.6.3-1ubuntu3 [2936 kB] 188s Get:27 http://ftpmaster.internal/ubuntu noble/main arm64 python3-dateutil all 2.8.2-3 [79.2 kB] 188s Get:28 http://ftpmaster.internal/ubuntu noble/main arm64 libgomp1 arm64 14-20240303-1ubuntu1 [144 kB] 188s Get:29 http://ftpmaster.internal/ubuntu noble/main arm64 libimagequant0 arm64 2.18.0-1 [37.0 kB] 188s Get:30 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg-turbo8 arm64 2.1.5-2ubuntu1 [160 kB] 188s Get:31 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg8 arm64 8c-2ubuntu11 [2148 B] 188s Get:32 http://ftpmaster.internal/ubuntu noble/main arm64 liblcms2-2 arm64 2.14-2 [159 kB] 188s Get:33 http://ftpmaster.internal/ubuntu noble/main arm64 libopenjp2-7 arm64 2.5.0-2 [170 kB] 188s Get:34 http://ftpmaster.internal/ubuntu noble/main arm64 libgraphite2-3 arm64 1.3.14-2 [81.5 kB] 188s Get:35 http://ftpmaster.internal/ubuntu noble/main arm64 libharfbuzz0b arm64 8.3.0-2 [463 kB] 188s Get:36 http://ftpmaster.internal/ubuntu noble/main arm64 libraqm0 arm64 0.10.1-1 [14.4 kB] 188s Get:37 http://ftpmaster.internal/ubuntu noble/main arm64 libdeflate0 arm64 1.19-1 [43.4 kB] 189s Get:38 http://ftpmaster.internal/ubuntu noble/main arm64 libjbig0 arm64 2.1-6.1ubuntu1 [28.9 kB] 189s Get:39 http://ftpmaster.internal/ubuntu noble/main arm64 liblerc4 arm64 4.0.0+ds-4ubuntu1 [153 kB] 189s Get:40 http://ftpmaster.internal/ubuntu noble/main arm64 libsharpyuv0 arm64 1.3.2-0.4 [14.4 kB] 189s Get:41 http://ftpmaster.internal/ubuntu noble/main arm64 libwebp7 arm64 1.3.2-0.4 [191 kB] 189s Get:42 http://ftpmaster.internal/ubuntu noble/main arm64 libtiff6 arm64 4.5.1+git230720-3ubuntu1 [226 kB] 189s Get:43 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpdemux2 arm64 1.3.2-0.4 [12.3 kB] 189s Get:44 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpmux3 arm64 1.3.2-0.4 [25.0 kB] 189s Get:45 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pil arm64 10.2.0-1 [477 kB] 189s Get:46 http://ftpmaster.internal/ubuntu noble/main arm64 libtcl8.6 arm64 8.6.13+dfsg-2 [980 kB] 189s Get:47 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig-config arm64 2.15.0-1ubuntu1 [37.0 kB] 189s Get:48 http://ftpmaster.internal/ubuntu noble/main arm64 libfontconfig1 arm64 2.15.0-1ubuntu1 [142 kB] 189s Get:49 http://ftpmaster.internal/ubuntu noble/main arm64 libxrender1 arm64 1:0.9.10-1.1 [19.1 kB] 189s Get:50 http://ftpmaster.internal/ubuntu noble/main arm64 libxft2 arm64 2.3.6-1 [43.3 kB] 189s Get:51 http://ftpmaster.internal/ubuntu noble/main arm64 x11-common all 1:7.7+23ubuntu2 [23.4 kB] 189s Get:52 http://ftpmaster.internal/ubuntu noble/main arm64 libxss1 arm64 1:1.2.3-1build2 [8252 B] 189s Get:53 http://ftpmaster.internal/ubuntu noble/main arm64 libtk8.6 arm64 8.6.13-2 [760 kB] 189s Get:54 http://ftpmaster.internal/ubuntu noble/main arm64 tk8.6-blt2.5 arm64 2.5.3+dfsg-7 [618 kB] 189s Get:55 http://ftpmaster.internal/ubuntu noble/main arm64 blt arm64 2.5.3+dfsg-7 [4826 B] 189s Get:56 http://ftpmaster.internal/ubuntu noble/main arm64 python3-tk arm64 3.11.5-1 [112 kB] 189s Get:57 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pil.imagetk arm64 10.2.0-1 [9708 B] 189s Get:58 http://ftpmaster.internal/ubuntu noble/main arm64 libblas3 arm64 3.12.0-3 [143 kB] 189s Get:59 http://ftpmaster.internal/ubuntu noble/main arm64 libgfortran5 arm64 14-20240303-1ubuntu1 [444 kB] 189s Get:60 http://ftpmaster.internal/ubuntu noble/main arm64 liblapack3 arm64 3.12.0-3 [2241 kB] 189s Get:61 http://ftpmaster.internal/ubuntu noble/main arm64 python3-numpy arm64 1:1.24.2-2 [4525 kB] 189s Get:62 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-contourpy arm64 1.0.7-1build2 [244 kB] 189s Get:63 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-cycler all 0.11.0-2 [8202 B] 189s Get:64 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-brotli arm64 1.1.0-2 [345 kB] 189s Get:65 http://ftpmaster.internal/ubuntu noble/universe arm64 liblbfgsb0 arm64 3.0+dfsg.4-1 [27.7 kB] 189s Get:66 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-scipy arm64 1.11.4-6 [18.6 MB] 190s Get:67 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ufolib2 all 0.16.0+dfsg1-1 [33.5 kB] 190s Get:68 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-mpmath all 1.2.1-3 [421 kB] 190s Get:69 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-sympy all 1.12-7 [3966 kB] 190s Get:70 http://ftpmaster.internal/ubuntu noble/main arm64 python3-appdirs all 1.4.4-4 [10.9 kB] 190s Get:71 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fs all 2.4.16-3 [91.1 kB] 190s Get:72 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lz4 arm64 4.0.2+dfsg-1build2 [28.4 kB] 190s Get:73 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-unicodedata2 arm64 15.1.0+ds-1 [362 kB] 190s Get:74 http://ftpmaster.internal/ubuntu noble/universe arm64 unicode-data all 15.1.0-1 [8878 kB] 190s Get:75 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fonttools arm64 4.46.0-1 [1625 kB] 190s Get:76 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-kiwisolver arm64 1.4.4-1build2 [65.4 kB] 190s Get:77 http://ftpmaster.internal/ubuntu noble/main arm64 python3-packaging all 23.2-1 [40.6 kB] 190s Get:78 http://ftpmaster.internal/ubuntu noble/universe arm64 libqhull-r8.0 arm64 2020.2-6 [188 kB] 190s Get:79 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib arm64 3.6.3-1ubuntu3 [7291 kB] 191s Get:80 http://ftpmaster.internal/ubuntu noble/main arm64 python3-networkx all 2.8.8-1ubuntu1 [1468 kB] 191s Get:81 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-oscrypto all 1.3.0-5 [168 kB] 191s Get:82 http://ftpmaster.internal/ubuntu noble/universe arm64 libann0 arm64 1.1.2+doc-9 [25.1 kB] 191s Get:83 http://ftpmaster.internal/ubuntu noble/universe arm64 libcdt5 arm64 2.42.2-8build1 [20.3 kB] 191s Get:84 http://ftpmaster.internal/ubuntu noble/universe arm64 libcgraph6 arm64 2.42.2-8build1 [44.8 kB] 191s Get:85 http://ftpmaster.internal/ubuntu noble/main arm64 libxpm4 arm64 1:3.5.17-1 [34.5 kB] 191s Get:86 http://ftpmaster.internal/ubuntu noble/main arm64 libgd3 arm64 2.3.3-9ubuntu1 [119 kB] 191s Get:87 http://ftpmaster.internal/ubuntu noble/universe arm64 libgts-0.7-5 arm64 0.7.6+darcs121130-5 [157 kB] 191s Get:88 http://ftpmaster.internal/ubuntu noble/main arm64 libpixman-1-0 arm64 0.42.2-1 [193 kB] 191s Get:89 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-render0 arm64 1.15-1 [16.1 kB] 191s Get:90 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-shm0 arm64 1.15-1 [5780 B] 191s Get:91 http://ftpmaster.internal/ubuntu noble/main arm64 libcairo2 arm64 1.18.0-1 [550 kB] 191s Get:92 http://ftpmaster.internal/ubuntu noble/main arm64 libltdl7 arm64 2.4.7-7 [40.3 kB] 191s Get:93 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig arm64 2.15.0-1ubuntu1 [190 kB] 191s Get:94 http://ftpmaster.internal/ubuntu noble/main arm64 libthai-data all 0.1.29-2 [158 kB] 191s Get:95 http://ftpmaster.internal/ubuntu noble/main arm64 libdatrie1 arm64 0.2.13-3 [21.7 kB] 191s Get:96 http://ftpmaster.internal/ubuntu noble/main arm64 libthai0 arm64 0.1.29-2 [18.1 kB] 191s Get:97 http://ftpmaster.internal/ubuntu noble/main arm64 libpango-1.0-0 arm64 1.51.0+ds-4 [226 kB] 191s Get:98 http://ftpmaster.internal/ubuntu noble/main arm64 libpangoft2-1.0-0 arm64 1.51.0+ds-4 [41.2 kB] 191s Get:99 http://ftpmaster.internal/ubuntu noble/main arm64 libpangocairo-1.0-0 arm64 1.51.0+ds-4 [27.6 kB] 191s Get:100 http://ftpmaster.internal/ubuntu noble/universe arm64 libpathplan4 arm64 2.42.2-8build1 [22.6 kB] 191s Get:101 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvc6 arm64 2.42.2-8build1 [692 kB] 191s Get:102 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvpr2 arm64 2.42.2-8build1 [187 kB] 191s Get:103 http://ftpmaster.internal/ubuntu noble/universe arm64 liblab-gamut1 arm64 2.42.2-8build1 [1860 kB] 192s Get:104 http://ftpmaster.internal/ubuntu noble/main arm64 libice6 arm64 2:1.0.10-1build2 [41.7 kB] 192s Get:105 http://ftpmaster.internal/ubuntu noble/main arm64 libsm6 arm64 2:1.2.3-1build2 [16.1 kB] 192s Get:106 http://ftpmaster.internal/ubuntu noble/main arm64 libxt6 arm64 1:1.2.1-1.1 [167 kB] 192s Get:107 http://ftpmaster.internal/ubuntu noble/main arm64 libxmu6 arm64 2:1.1.3-3 [48.9 kB] 192s Get:108 http://ftpmaster.internal/ubuntu noble/main arm64 libxaw7 arm64 2:1.0.14-1 [184 kB] 192s Get:109 http://ftpmaster.internal/ubuntu noble/universe arm64 graphviz arm64 2.42.2-8build1 [613 kB] 192s Get:110 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pydot all 1.4.2-2 [24.4 kB] 192s Get:111 http://ftpmaster.internal/ubuntu noble/universe arm64 androguard all 3.4.0~a1-10 [36.7 MB] 194s Get:112 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-args all 0.1.0-5 [6082 B] 194s Get:113 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-clint all 0.5.1-4 [27.8 kB] 194s Get:114 http://ftpmaster.internal/ubuntu noble/main arm64 python3-defusedxml all 0.7.1-2 [42.0 kB] 194s Get:115 http://ftpmaster.internal/ubuntu noble/main arm64 liberror-perl all 0.17029-2 [25.6 kB] 194s Get:116 http://ftpmaster.internal/ubuntu noble/main arm64 git-man all 1:2.43.0-1ubuntu1 [1100 kB] 194s Get:117 http://ftpmaster.internal/ubuntu noble/main arm64 git arm64 1:2.43.0-1ubuntu1 [3786 kB] 194s Get:118 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-smmap all 6.0.0-1 [20.5 kB] 194s Get:119 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-gitdb all 4.0.11-1 [46.2 kB] 194s Get:120 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-git all 3.1.37-3 [138 kB] 194s Get:121 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lockfile all 1:0.12.2-3 [13.7 kB] 194s Get:122 http://ftpmaster.internal/ubuntu noble/main arm64 python3-simplejson arm64 3.19.2-1build1 [61.4 kB] 194s Get:123 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-libcloud all 3.4.1-5 [751 kB] 194s Get:124 http://ftpmaster.internal/ubuntu noble/main arm64 python3-bcrypt arm64 3.2.2-1 [28.8 kB] 194s Get:125 http://ftpmaster.internal/ubuntu noble/main arm64 libsodium23 arm64 1.0.18-1build2 [123 kB] 194s Get:126 http://ftpmaster.internal/ubuntu noble/main arm64 python3-nacl arm64 1.5.0-4 [55.5 kB] 194s Get:127 http://ftpmaster.internal/ubuntu noble/main arm64 python3-paramiko all 2.12.0-2ubuntu4 [137 kB] 194s Get:128 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1 all 0.4.8-4 [51.2 kB] 194s Get:129 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1-modules all 0.2.8-1 [68.0 kB] 194s Get:130 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-png all 0.20231004.0-2 [30.2 kB] 194s Get:131 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-qrcode all 7.4.2-4 [40.1 kB] 194s Get:132 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml.clib arm64 0.2.8-1 [187 kB] 194s Get:133 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml all 0.17.21-1 [86.6 kB] 194s Get:134 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pathspec all 0.12.1-1 [24.5 kB] 194s Get:135 http://ftpmaster.internal/ubuntu noble/universe arm64 yamllint all 1.33.0-1 [47.2 kB] 194s Get:136 http://ftpmaster.internal/ubuntu noble/main arm64 ca-certificates-java all 20240118 [11.6 kB] 194s Get:137 http://ftpmaster.internal/ubuntu noble/main arm64 java-common all 0.75+exp1 [6798 B] 194s Get:138 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common-data arm64 0.8-13ubuntu2 [29.5 kB] 194s Get:139 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common3 arm64 0.8-13ubuntu2 [23.2 kB] 194s Get:140 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-client3 arm64 0.8-13ubuntu2 [27.3 kB] 194s Get:141 http://ftpmaster.internal/ubuntu noble/main arm64 libcups2 arm64 2.4.6-0ubuntu3 [270 kB] 194s Get:142 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2-data all 1.2.10-3build1 [20.7 kB] 195s Get:143 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2 arm64 1.2.10-3build1 [386 kB] 195s Get:144 http://ftpmaster.internal/ubuntu noble/main arm64 libpcsclite1 arm64 2.0.0-1 [21.2 kB] 195s Get:145 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre-headless arm64 21.0.2+13-2 [45.8 MB] 196s Get:146 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre-headless arm64 2:1.21-75+exp1 [3096 B] 196s Get:147 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-common all 2.24.33-2ubuntu2 [125 kB] 196s Get:148 http://ftpmaster.internal/ubuntu noble/main arm64 at-spi2-common all 2.50.0-1 [7864 B] 196s Get:149 http://ftpmaster.internal/ubuntu noble/main arm64 libatk1.0-0 arm64 2.50.0-1 [53.8 kB] 196s Get:150 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [7624 B] 196s Get:151 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.10+dfsg-3 [144 kB] 196s Get:152 http://ftpmaster.internal/ubuntu noble/main arm64 libxcomposite1 arm64 1:0.4.5-1build2 [7080 B] 196s Get:153 http://ftpmaster.internal/ubuntu noble/main arm64 libxfixes3 arm64 1:6.0.0-2 [11.0 kB] 196s Get:154 http://ftpmaster.internal/ubuntu noble/main arm64 libxcursor1 arm64 1:1.2.1-1 [21.3 kB] 196s Get:155 http://ftpmaster.internal/ubuntu noble/main arm64 libxdamage1 arm64 1:1.1.6-1 [6032 B] 196s Get:156 http://ftpmaster.internal/ubuntu noble/main arm64 libxi6 arm64 2:1.8.1-1 [31.9 kB] 196s Get:157 http://ftpmaster.internal/ubuntu noble/main arm64 libxinerama1 arm64 2:1.1.4-3 [7056 B] 196s Get:158 http://ftpmaster.internal/ubuntu noble/main arm64 libxrandr2 arm64 2:1.5.2-2 [19.6 kB] 196s Get:159 http://ftpmaster.internal/ubuntu noble/main arm64 gtk-update-icon-cache arm64 3.24.40-2ubuntu1 [50.5 kB] 196s Get:160 http://ftpmaster.internal/ubuntu noble/main arm64 hicolor-icon-theme all 0.17-2 [9976 B] 196s Get:161 http://ftpmaster.internal/ubuntu noble/main arm64 humanity-icon-theme all 0.6.16 [1282 kB] 196s Get:162 http://ftpmaster.internal/ubuntu noble/main arm64 ubuntu-mono all 20.10-0ubuntu2 [153 kB] 196s Get:163 http://ftpmaster.internal/ubuntu noble/main arm64 adwaita-icon-theme all 46~rc-1 [723 kB] 196s Get:164 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-0 arm64 2.24.33-2ubuntu2 [1981 kB] 196s Get:165 http://ftpmaster.internal/ubuntu noble/main arm64 libglvnd0 arm64 1.7.0-1 [60.0 kB] 196s Get:166 http://ftpmaster.internal/ubuntu noble/main arm64 libglapi-mesa arm64 24.0.1-1ubuntu1 [57.8 kB] 196s Get:167 http://ftpmaster.internal/ubuntu noble/main arm64 libx11-xcb1 arm64 2:1.8.7-1 [7836 B] 196s Get:168 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri2-0 arm64 1.15-1 [7244 B] 196s Get:169 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri3-0 arm64 1.15-1 [7108 B] 196s Get:170 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-glx0 arm64 1.15-1 [25.2 kB] 196s Get:171 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-present0 arm64 1.15-1 [5732 B] 196s Get:172 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-randr0 arm64 1.15-1 [18.2 kB] 197s Get:173 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-sync1 arm64 1.15-1 [9412 B] 197s Get:174 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-xfixes0 arm64 1.15-1 [10.3 kB] 197s Get:175 http://ftpmaster.internal/ubuntu noble/main arm64 libxshmfence1 arm64 1.3-1build4 [5444 B] 197s Get:176 http://ftpmaster.internal/ubuntu noble/main arm64 libxxf86vm1 arm64 1:1.1.4-1build3 [10.3 kB] 197s Get:177 http://ftpmaster.internal/ubuntu noble/main arm64 libvulkan1 arm64 1.3.275.0-1 [150 kB] 197s Get:178 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-amdgpu1 arm64 2.4.120-2 [20.4 kB] 197s Get:179 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-nouveau2 arm64 2.4.120-2 [17.8 kB] 197s Get:180 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-radeon1 arm64 2.4.120-2 [20.9 kB] 197s Get:181 http://ftpmaster.internal/ubuntu noble/main arm64 libllvm17 arm64 1:17.0.6-5build1 [25.0 MB] 198s Get:182 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1-mesa-dri arm64 24.0.1-1ubuntu1 [8226 kB] 198s Get:183 http://ftpmaster.internal/ubuntu noble/main arm64 libglx-mesa0 arm64 24.0.1-1ubuntu1 [166 kB] 198s Get:184 http://ftpmaster.internal/ubuntu noble/main arm64 libglx0 arm64 1.7.0-1 [32.4 kB] 198s Get:185 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1 arm64 1.7.0-1 [107 kB] 198s Get:186 http://ftpmaster.internal/ubuntu noble/main arm64 libgif7 arm64 5.2.1-2.5 [34.2 kB] 198s Get:187 http://ftpmaster.internal/ubuntu noble/main arm64 libxtst6 arm64 2:1.2.3-1.1 [13.7 kB] 198s Get:188 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre arm64 21.0.2+13-2 [226 kB] 198s Get:189 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre arm64 2:1.21-75+exp1 [922 B] 198s Get:190 http://ftpmaster.internal/ubuntu noble/universe arm64 libapksig-java all 31.0.2-1 [402 kB] 198s Get:191 http://ftpmaster.internal/ubuntu noble/universe arm64 apksigner all 31.0.2-1 [438 kB] 198s Get:192 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jdk-headless arm64 21.0.2+13-2 [81.6 MB] 201s Get:193 http://ftpmaster.internal/ubuntu noble/main arm64 default-jdk-headless arm64 2:1.21-75+exp1 [960 B] 201s Get:194 http://ftpmaster.internal/ubuntu noble/universe arm64 fdroidserver all 2.2.1-2 [362 kB] 201s Get:195 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libart arm64 13.0.0+r63-2 [2124 kB] 201s Get:196 http://ftpmaster.internal/ubuntu noble/universe arm64 android-liblog arm64 1:33.0.3-2 [35.2 kB] 201s Get:197 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libbase arm64 1:33.0.3-2 [93.2 kB] 201s Get:198 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libbacktrace arm64 1:33.0.3-2 [226 kB] 201s Get:199 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libziparchive arm64 1:33.0.3-2 [38.4 kB] 201s Get:200 http://ftpmaster.internal/ubuntu noble/main arm64 libatomic1 arm64 14-20240303-1ubuntu1 [11.4 kB] 201s Get:201 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libnativebridge arm64 1:13.0.0+r63-2 [14.4 kB] 201s Get:202 http://ftpmaster.internal/ubuntu noble/universe arm64 android-libnativeloader arm64 1:13.0.0+r63-2 [6304 B] 201s Get:203 http://ftpmaster.internal/ubuntu noble/universe arm64 dexdump arm64 13.0.0+r63-2 [38.6 kB] 203s Fetched 286 MB in 14s (20.2 MB/s) 203s Selecting previously unselected package python3-asn1crypto. 203s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75420 files and directories currently installed.) 203s Preparing to unpack .../000-python3-asn1crypto_1.5.1-3_all.deb ... 203s Unpacking python3-asn1crypto (1.5.1-3) ... 203s Selecting previously unselected package python3-colorama. 203s Preparing to unpack .../001-python3-colorama_0.4.6-4_all.deb ... 203s Unpacking python3-colorama (0.4.6-4) ... 203s Selecting previously unselected package python3-click. 203s Preparing to unpack .../002-python3-click_8.1.6-1_all.deb ... 203s Unpacking python3-click (8.1.6-1) ... 203s Selecting previously unselected package python3-decorator. 203s Preparing to unpack .../003-python3-decorator_5.1.1-5_all.deb ... 203s Unpacking python3-decorator (5.1.1-5) ... 203s Selecting previously unselected package python3-parso. 203s Preparing to unpack .../004-python3-parso_0.8.3-1_all.deb ... 203s Unpacking python3-parso (0.8.3-1) ... 203s Selecting previously unselected package python3-jedi. 203s Preparing to unpack .../005-python3-jedi_0.18.2-1ubuntu1_all.deb ... 203s Unpacking python3-jedi (0.18.2-1ubuntu1) ... 203s Selecting previously unselected package python3-traitlets. 203s Preparing to unpack .../006-python3-traitlets_5.5.0-2_all.deb ... 203s Unpacking python3-traitlets (5.5.0-2) ... 203s Selecting previously unselected package python3-matplotlib-inline. 203s Preparing to unpack .../007-python3-matplotlib-inline_0.1.6-2_all.deb ... 203s Unpacking python3-matplotlib-inline (0.1.6-2) ... 203s Selecting previously unselected package python3-ptyprocess. 203s Preparing to unpack .../008-python3-ptyprocess_0.7.0-5_all.deb ... 203s Unpacking python3-ptyprocess (0.7.0-5) ... 203s Selecting previously unselected package python3-pexpect. 203s Preparing to unpack .../009-python3-pexpect_4.9-2_all.deb ... 203s Unpacking python3-pexpect (4.9-2) ... 203s Selecting previously unselected package python3-wcwidth. 203s Preparing to unpack .../010-python3-wcwidth_0.2.5+dfsg1-1.1ubuntu1_all.deb ... 203s Unpacking python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ... 203s Selecting previously unselected package python3-prompt-toolkit. 203s Preparing to unpack .../011-python3-prompt-toolkit_3.0.43-1_all.deb ... 203s Unpacking python3-prompt-toolkit (3.0.43-1) ... 203s Selecting previously unselected package python3-asttokens. 203s Preparing to unpack .../012-python3-asttokens_2.4.1-1_all.deb ... 203s Unpacking python3-asttokens (2.4.1-1) ... 203s Selecting previously unselected package python3-executing. 203s Preparing to unpack .../013-python3-executing_2.0.1-0.1_all.deb ... 203s Unpacking python3-executing (2.0.1-0.1) ... 203s Selecting previously unselected package python3-pure-eval. 203s Preparing to unpack .../014-python3-pure-eval_0.2.2-1_all.deb ... 203s Unpacking python3-pure-eval (0.2.2-1) ... 203s Selecting previously unselected package python3-stack-data. 203s Preparing to unpack .../015-python3-stack-data_0.6.3-1_all.deb ... 203s Unpacking python3-stack-data (0.6.3-1) ... 203s Selecting previously unselected package python3-ipython. 203s Preparing to unpack .../016-python3-ipython_8.20.0-1_all.deb ... 203s Unpacking python3-ipython (8.20.0-1) ... 203s Selecting previously unselected package libxslt1.1:arm64. 203s Preparing to unpack .../017-libxslt1.1_1.1.35-1_arm64.deb ... 203s Unpacking libxslt1.1:arm64 (1.1.35-1) ... 203s Selecting previously unselected package python3-lxml:arm64. 203s Preparing to unpack .../018-python3-lxml_5.1.0-1_arm64.deb ... 203s Unpacking python3-lxml:arm64 (5.1.0-1) ... 203s Selecting previously unselected package python3-magic. 203s Preparing to unpack .../019-python3-magic_2%3a0.4.27-2_all.deb ... 203s Unpacking python3-magic (2:0.4.27-2) ... 203s Selecting previously unselected package libjs-jquery. 203s Preparing to unpack .../020-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... 203s Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 203s Selecting previously unselected package libjs-jquery-ui. 203s Preparing to unpack .../021-libjs-jquery-ui_1.13.2+dfsg-1_all.deb ... 203s Unpacking libjs-jquery-ui (1.13.2+dfsg-1) ... 203s Selecting previously unselected package fonts-dejavu-mono. 203s Preparing to unpack .../022-fonts-dejavu-mono_2.37-8_all.deb ... 203s Unpacking fonts-dejavu-mono (2.37-8) ... 203s Selecting previously unselected package fonts-dejavu-core. 203s Preparing to unpack .../023-fonts-dejavu-core_2.37-8_all.deb ... 203s Unpacking fonts-dejavu-core (2.37-8) ... 203s Selecting previously unselected package fonts-lyx. 203s Preparing to unpack .../024-fonts-lyx_2.4.0~RC3-1_all.deb ... 203s Unpacking fonts-lyx (2.4.0~RC3-1) ... 204s Selecting previously unselected package python-matplotlib-data. 204s Preparing to unpack .../025-python-matplotlib-data_3.6.3-1ubuntu3_all.deb ... 204s Unpacking python-matplotlib-data (3.6.3-1ubuntu3) ... 204s Selecting previously unselected package python3-dateutil. 204s Preparing to unpack .../026-python3-dateutil_2.8.2-3_all.deb ... 204s Unpacking python3-dateutil (2.8.2-3) ... 204s Selecting previously unselected package libgomp1:arm64. 204s Preparing to unpack .../027-libgomp1_14-20240303-1ubuntu1_arm64.deb ... 204s Unpacking libgomp1:arm64 (14-20240303-1ubuntu1) ... 204s Selecting previously unselected package libimagequant0:arm64. 204s Preparing to unpack .../028-libimagequant0_2.18.0-1_arm64.deb ... 204s Unpacking libimagequant0:arm64 (2.18.0-1) ... 204s Selecting previously unselected package libjpeg-turbo8:arm64. 204s Preparing to unpack .../029-libjpeg-turbo8_2.1.5-2ubuntu1_arm64.deb ... 204s Unpacking libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ... 204s Selecting previously unselected package libjpeg8:arm64. 204s Preparing to unpack .../030-libjpeg8_8c-2ubuntu11_arm64.deb ... 204s Unpacking libjpeg8:arm64 (8c-2ubuntu11) ... 204s Selecting previously unselected package liblcms2-2:arm64. 204s Preparing to unpack .../031-liblcms2-2_2.14-2_arm64.deb ... 204s Unpacking liblcms2-2:arm64 (2.14-2) ... 204s Selecting previously unselected package libopenjp2-7:arm64. 204s Preparing to unpack .../032-libopenjp2-7_2.5.0-2_arm64.deb ... 204s Unpacking libopenjp2-7:arm64 (2.5.0-2) ... 204s Selecting previously unselected package libgraphite2-3:arm64. 204s Preparing to unpack .../033-libgraphite2-3_1.3.14-2_arm64.deb ... 204s Unpacking libgraphite2-3:arm64 (1.3.14-2) ... 204s Selecting previously unselected package libharfbuzz0b:arm64. 204s Preparing to unpack .../034-libharfbuzz0b_8.3.0-2_arm64.deb ... 204s Unpacking libharfbuzz0b:arm64 (8.3.0-2) ... 204s Selecting previously unselected package libraqm0:arm64. 204s Preparing to unpack .../035-libraqm0_0.10.1-1_arm64.deb ... 204s Unpacking libraqm0:arm64 (0.10.1-1) ... 204s Selecting previously unselected package libdeflate0:arm64. 204s Preparing to unpack .../036-libdeflate0_1.19-1_arm64.deb ... 204s Unpacking libdeflate0:arm64 (1.19-1) ... 204s Selecting previously unselected package libjbig0:arm64. 204s Preparing to unpack .../037-libjbig0_2.1-6.1ubuntu1_arm64.deb ... 204s Unpacking libjbig0:arm64 (2.1-6.1ubuntu1) ... 204s Selecting previously unselected package liblerc4:arm64. 204s Preparing to unpack .../038-liblerc4_4.0.0+ds-4ubuntu1_arm64.deb ... 204s Unpacking liblerc4:arm64 (4.0.0+ds-4ubuntu1) ... 204s Selecting previously unselected package libsharpyuv0:arm64. 204s Preparing to unpack .../039-libsharpyuv0_1.3.2-0.4_arm64.deb ... 204s Unpacking libsharpyuv0:arm64 (1.3.2-0.4) ... 204s Selecting previously unselected package libwebp7:arm64. 204s Preparing to unpack .../040-libwebp7_1.3.2-0.4_arm64.deb ... 204s Unpacking libwebp7:arm64 (1.3.2-0.4) ... 204s Selecting previously unselected package libtiff6:arm64. 204s Preparing to unpack .../041-libtiff6_4.5.1+git230720-3ubuntu1_arm64.deb ... 204s Unpacking libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ... 204s Selecting previously unselected package libwebpdemux2:arm64. 204s Preparing to unpack .../042-libwebpdemux2_1.3.2-0.4_arm64.deb ... 204s Unpacking libwebpdemux2:arm64 (1.3.2-0.4) ... 204s Selecting previously unselected package libwebpmux3:arm64. 204s Preparing to unpack .../043-libwebpmux3_1.3.2-0.4_arm64.deb ... 204s Unpacking libwebpmux3:arm64 (1.3.2-0.4) ... 204s Selecting previously unselected package python3-pil:arm64. 204s Preparing to unpack .../044-python3-pil_10.2.0-1_arm64.deb ... 204s Unpacking python3-pil:arm64 (10.2.0-1) ... 204s Selecting previously unselected package libtcl8.6:arm64. 204s Preparing to unpack .../045-libtcl8.6_8.6.13+dfsg-2_arm64.deb ... 204s Unpacking libtcl8.6:arm64 (8.6.13+dfsg-2) ... 204s Selecting previously unselected package fontconfig-config. 204s Preparing to unpack .../046-fontconfig-config_2.15.0-1ubuntu1_arm64.deb ... 204s Unpacking fontconfig-config (2.15.0-1ubuntu1) ... 204s Selecting previously unselected package libfontconfig1:arm64. 204s Preparing to unpack .../047-libfontconfig1_2.15.0-1ubuntu1_arm64.deb ... 204s Unpacking libfontconfig1:arm64 (2.15.0-1ubuntu1) ... 204s Selecting previously unselected package libxrender1:arm64. 204s Preparing to unpack .../048-libxrender1_1%3a0.9.10-1.1_arm64.deb ... 204s Unpacking libxrender1:arm64 (1:0.9.10-1.1) ... 204s Selecting previously unselected package libxft2:arm64. 204s Preparing to unpack .../049-libxft2_2.3.6-1_arm64.deb ... 204s Unpacking libxft2:arm64 (2.3.6-1) ... 204s Selecting previously unselected package x11-common. 204s Preparing to unpack .../050-x11-common_1%3a7.7+23ubuntu2_all.deb ... 204s Unpacking x11-common (1:7.7+23ubuntu2) ... 204s Selecting previously unselected package libxss1:arm64. 204s Preparing to unpack .../051-libxss1_1%3a1.2.3-1build2_arm64.deb ... 204s Unpacking libxss1:arm64 (1:1.2.3-1build2) ... 204s Selecting previously unselected package libtk8.6:arm64. 204s Preparing to unpack .../052-libtk8.6_8.6.13-2_arm64.deb ... 204s Unpacking libtk8.6:arm64 (8.6.13-2) ... 204s Selecting previously unselected package tk8.6-blt2.5. 204s Preparing to unpack .../053-tk8.6-blt2.5_2.5.3+dfsg-7_arm64.deb ... 204s Unpacking tk8.6-blt2.5 (2.5.3+dfsg-7) ... 204s Selecting previously unselected package blt. 204s Preparing to unpack .../054-blt_2.5.3+dfsg-7_arm64.deb ... 204s Unpacking blt (2.5.3+dfsg-7) ... 205s Selecting previously unselected package python3-tk:arm64. 205s Preparing to unpack .../055-python3-tk_3.11.5-1_arm64.deb ... 205s Unpacking python3-tk:arm64 (3.11.5-1) ... 205s Selecting previously unselected package python3-pil.imagetk:arm64. 205s Preparing to unpack .../056-python3-pil.imagetk_10.2.0-1_arm64.deb ... 205s Unpacking python3-pil.imagetk:arm64 (10.2.0-1) ... 205s Selecting previously unselected package libblas3:arm64. 205s Preparing to unpack .../057-libblas3_3.12.0-3_arm64.deb ... 205s Unpacking libblas3:arm64 (3.12.0-3) ... 205s Selecting previously unselected package libgfortran5:arm64. 205s Preparing to unpack .../058-libgfortran5_14-20240303-1ubuntu1_arm64.deb ... 205s Unpacking libgfortran5:arm64 (14-20240303-1ubuntu1) ... 205s Selecting previously unselected package liblapack3:arm64. 205s Preparing to unpack .../059-liblapack3_3.12.0-3_arm64.deb ... 205s Unpacking liblapack3:arm64 (3.12.0-3) ... 205s Selecting previously unselected package python3-numpy. 205s Preparing to unpack .../060-python3-numpy_1%3a1.24.2-2_arm64.deb ... 205s Unpacking python3-numpy (1:1.24.2-2) ... 205s Selecting previously unselected package python3-contourpy. 205s Preparing to unpack .../061-python3-contourpy_1.0.7-1build2_arm64.deb ... 205s Unpacking python3-contourpy (1.0.7-1build2) ... 205s Selecting previously unselected package python3-cycler. 205s Preparing to unpack .../062-python3-cycler_0.11.0-2_all.deb ... 205s Unpacking python3-cycler (0.11.0-2) ... 205s Selecting previously unselected package python3-brotli. 205s Preparing to unpack .../063-python3-brotli_1.1.0-2_arm64.deb ... 205s Unpacking python3-brotli (1.1.0-2) ... 205s Selecting previously unselected package liblbfgsb0:arm64. 205s Preparing to unpack .../064-liblbfgsb0_3.0+dfsg.4-1_arm64.deb ... 205s Unpacking liblbfgsb0:arm64 (3.0+dfsg.4-1) ... 205s Selecting previously unselected package python3-scipy. 205s Preparing to unpack .../065-python3-scipy_1.11.4-6_arm64.deb ... 205s Unpacking python3-scipy (1.11.4-6) ... 206s Selecting previously unselected package python3-ufolib2. 206s Preparing to unpack .../066-python3-ufolib2_0.16.0+dfsg1-1_all.deb ... 206s Unpacking python3-ufolib2 (0.16.0+dfsg1-1) ... 206s Selecting previously unselected package python3-mpmath. 206s Preparing to unpack .../067-python3-mpmath_1.2.1-3_all.deb ... 206s Unpacking python3-mpmath (1.2.1-3) ... 206s Selecting previously unselected package python3-sympy. 206s Preparing to unpack .../068-python3-sympy_1.12-7_all.deb ... 206s Unpacking python3-sympy (1.12-7) ... 206s Selecting previously unselected package python3-appdirs. 206s Preparing to unpack .../069-python3-appdirs_1.4.4-4_all.deb ... 206s Unpacking python3-appdirs (1.4.4-4) ... 206s Selecting previously unselected package python3-fs. 206s Preparing to unpack .../070-python3-fs_2.4.16-3_all.deb ... 206s Unpacking python3-fs (2.4.16-3) ... 206s Selecting previously unselected package python3-lz4. 206s Preparing to unpack .../071-python3-lz4_4.0.2+dfsg-1build2_arm64.deb ... 206s Unpacking python3-lz4 (4.0.2+dfsg-1build2) ... 206s Selecting previously unselected package python3-unicodedata2. 206s Preparing to unpack .../072-python3-unicodedata2_15.1.0+ds-1_arm64.deb ... 206s Unpacking python3-unicodedata2 (15.1.0+ds-1) ... 206s Selecting previously unselected package unicode-data. 206s Preparing to unpack .../073-unicode-data_15.1.0-1_all.deb ... 206s Unpacking unicode-data (15.1.0-1) ... 206s Selecting previously unselected package python3-fonttools. 206s Preparing to unpack .../074-python3-fonttools_4.46.0-1_arm64.deb ... 206s Unpacking python3-fonttools (4.46.0-1) ... 207s Selecting previously unselected package python3-kiwisolver. 207s Preparing to unpack .../075-python3-kiwisolver_1.4.4-1build2_arm64.deb ... 207s Unpacking python3-kiwisolver (1.4.4-1build2) ... 207s Selecting previously unselected package python3-packaging. 207s Preparing to unpack .../076-python3-packaging_23.2-1_all.deb ... 207s Unpacking python3-packaging (23.2-1) ... 207s Selecting previously unselected package libqhull-r8.0:arm64. 207s Preparing to unpack .../077-libqhull-r8.0_2020.2-6_arm64.deb ... 207s Unpacking libqhull-r8.0:arm64 (2020.2-6) ... 207s Selecting previously unselected package python3-matplotlib. 207s Preparing to unpack .../078-python3-matplotlib_3.6.3-1ubuntu3_arm64.deb ... 207s Unpacking python3-matplotlib (3.6.3-1ubuntu3) ... 207s Selecting previously unselected package python3-networkx. 207s Preparing to unpack .../079-python3-networkx_2.8.8-1ubuntu1_all.deb ... 207s Unpacking python3-networkx (2.8.8-1ubuntu1) ... 207s Selecting previously unselected package python3-oscrypto. 207s Preparing to unpack .../080-python3-oscrypto_1.3.0-5_all.deb ... 207s Unpacking python3-oscrypto (1.3.0-5) ... 207s Selecting previously unselected package libann0. 207s Preparing to unpack .../081-libann0_1.1.2+doc-9_arm64.deb ... 207s Unpacking libann0 (1.1.2+doc-9) ... 207s Selecting previously unselected package libcdt5:arm64. 207s Preparing to unpack .../082-libcdt5_2.42.2-8build1_arm64.deb ... 207s Unpacking libcdt5:arm64 (2.42.2-8build1) ... 207s Selecting previously unselected package libcgraph6:arm64. 207s Preparing to unpack .../083-libcgraph6_2.42.2-8build1_arm64.deb ... 207s Unpacking libcgraph6:arm64 (2.42.2-8build1) ... 207s Selecting previously unselected package libxpm4:arm64. 207s Preparing to unpack .../084-libxpm4_1%3a3.5.17-1_arm64.deb ... 207s Unpacking libxpm4:arm64 (1:3.5.17-1) ... 207s Selecting previously unselected package libgd3:arm64. 207s Preparing to unpack .../085-libgd3_2.3.3-9ubuntu1_arm64.deb ... 207s Unpacking libgd3:arm64 (2.3.3-9ubuntu1) ... 207s Selecting previously unselected package libgts-0.7-5:arm64. 207s Preparing to unpack .../086-libgts-0.7-5_0.7.6+darcs121130-5_arm64.deb ... 207s Unpacking libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ... 207s Selecting previously unselected package libpixman-1-0:arm64. 207s Preparing to unpack .../087-libpixman-1-0_0.42.2-1_arm64.deb ... 207s Unpacking libpixman-1-0:arm64 (0.42.2-1) ... 207s Selecting previously unselected package libxcb-render0:arm64. 207s Preparing to unpack .../088-libxcb-render0_1.15-1_arm64.deb ... 207s Unpacking libxcb-render0:arm64 (1.15-1) ... 207s Selecting previously unselected package libxcb-shm0:arm64. 207s Preparing to unpack .../089-libxcb-shm0_1.15-1_arm64.deb ... 207s Unpacking libxcb-shm0:arm64 (1.15-1) ... 207s Selecting previously unselected package libcairo2:arm64. 207s Preparing to unpack .../090-libcairo2_1.18.0-1_arm64.deb ... 207s Unpacking libcairo2:arm64 (1.18.0-1) ... 207s Selecting previously unselected package libltdl7:arm64. 207s Preparing to unpack .../091-libltdl7_2.4.7-7_arm64.deb ... 207s Unpacking libltdl7:arm64 (2.4.7-7) ... 207s Selecting previously unselected package fontconfig. 207s Preparing to unpack .../092-fontconfig_2.15.0-1ubuntu1_arm64.deb ... 207s Unpacking fontconfig (2.15.0-1ubuntu1) ... 207s Selecting previously unselected package libthai-data. 207s Preparing to unpack .../093-libthai-data_0.1.29-2_all.deb ... 207s Unpacking libthai-data (0.1.29-2) ... 207s Selecting previously unselected package libdatrie1:arm64. 207s Preparing to unpack .../094-libdatrie1_0.2.13-3_arm64.deb ... 207s Unpacking libdatrie1:arm64 (0.2.13-3) ... 207s Selecting previously unselected package libthai0:arm64. 207s Preparing to unpack .../095-libthai0_0.1.29-2_arm64.deb ... 207s Unpacking libthai0:arm64 (0.1.29-2) ... 207s Selecting previously unselected package libpango-1.0-0:arm64. 207s Preparing to unpack .../096-libpango-1.0-0_1.51.0+ds-4_arm64.deb ... 207s Unpacking libpango-1.0-0:arm64 (1.51.0+ds-4) ... 207s Selecting previously unselected package libpangoft2-1.0-0:arm64. 207s Preparing to unpack .../097-libpangoft2-1.0-0_1.51.0+ds-4_arm64.deb ... 207s Unpacking libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ... 207s Selecting previously unselected package libpangocairo-1.0-0:arm64. 207s Preparing to unpack .../098-libpangocairo-1.0-0_1.51.0+ds-4_arm64.deb ... 207s Unpacking libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ... 207s Selecting previously unselected package libpathplan4:arm64. 207s Preparing to unpack .../099-libpathplan4_2.42.2-8build1_arm64.deb ... 207s Unpacking libpathplan4:arm64 (2.42.2-8build1) ... 207s Selecting previously unselected package libgvc6. 208s Preparing to unpack .../100-libgvc6_2.42.2-8build1_arm64.deb ... 208s Unpacking libgvc6 (2.42.2-8build1) ... 208s Selecting previously unselected package libgvpr2:arm64. 208s Preparing to unpack .../101-libgvpr2_2.42.2-8build1_arm64.deb ... 208s Unpacking libgvpr2:arm64 (2.42.2-8build1) ... 208s Selecting previously unselected package liblab-gamut1:arm64. 208s Preparing to unpack .../102-liblab-gamut1_2.42.2-8build1_arm64.deb ... 208s Unpacking liblab-gamut1:arm64 (2.42.2-8build1) ... 208s Selecting previously unselected package libice6:arm64. 208s Preparing to unpack .../103-libice6_2%3a1.0.10-1build2_arm64.deb ... 208s Unpacking libice6:arm64 (2:1.0.10-1build2) ... 208s Selecting previously unselected package libsm6:arm64. 208s Preparing to unpack .../104-libsm6_2%3a1.2.3-1build2_arm64.deb ... 208s Unpacking libsm6:arm64 (2:1.2.3-1build2) ... 208s Selecting previously unselected package libxt6:arm64. 208s Preparing to unpack .../105-libxt6_1%3a1.2.1-1.1_arm64.deb ... 208s Unpacking libxt6:arm64 (1:1.2.1-1.1) ... 208s Selecting previously unselected package libxmu6:arm64. 208s Preparing to unpack .../106-libxmu6_2%3a1.1.3-3_arm64.deb ... 208s Unpacking libxmu6:arm64 (2:1.1.3-3) ... 208s Selecting previously unselected package libxaw7:arm64. 208s Preparing to unpack .../107-libxaw7_2%3a1.0.14-1_arm64.deb ... 208s Unpacking libxaw7:arm64 (2:1.0.14-1) ... 208s Selecting previously unselected package graphviz. 208s Preparing to unpack .../108-graphviz_2.42.2-8build1_arm64.deb ... 208s Unpacking graphviz (2.42.2-8build1) ... 208s Selecting previously unselected package python3-pydot. 208s Preparing to unpack .../109-python3-pydot_1.4.2-2_all.deb ... 208s Unpacking python3-pydot (1.4.2-2) ... 208s Selecting previously unselected package androguard. 208s Preparing to unpack .../110-androguard_3.4.0~a1-10_all.deb ... 208s Unpacking androguard (3.4.0~a1-10) ... 208s Selecting previously unselected package python3-args. 208s Preparing to unpack .../111-python3-args_0.1.0-5_all.deb ... 208s Unpacking python3-args (0.1.0-5) ... 208s Selecting previously unselected package python3-clint. 208s Preparing to unpack .../112-python3-clint_0.5.1-4_all.deb ... 208s Unpacking python3-clint (0.5.1-4) ... 208s Selecting previously unselected package python3-defusedxml. 208s Preparing to unpack .../113-python3-defusedxml_0.7.1-2_all.deb ... 208s Unpacking python3-defusedxml (0.7.1-2) ... 208s Selecting previously unselected package liberror-perl. 208s Preparing to unpack .../114-liberror-perl_0.17029-2_all.deb ... 208s Unpacking liberror-perl (0.17029-2) ... 208s Selecting previously unselected package git-man. 208s Preparing to unpack .../115-git-man_1%3a2.43.0-1ubuntu1_all.deb ... 208s Unpacking git-man (1:2.43.0-1ubuntu1) ... 209s Selecting previously unselected package git. 209s Preparing to unpack .../116-git_1%3a2.43.0-1ubuntu1_arm64.deb ... 209s Unpacking git (1:2.43.0-1ubuntu1) ... 209s Selecting previously unselected package python3-smmap. 209s Preparing to unpack .../117-python3-smmap_6.0.0-1_all.deb ... 209s Unpacking python3-smmap (6.0.0-1) ... 209s Selecting previously unselected package python3-gitdb. 209s Preparing to unpack .../118-python3-gitdb_4.0.11-1_all.deb ... 209s Unpacking python3-gitdb (4.0.11-1) ... 209s Selecting previously unselected package python3-git. 209s Preparing to unpack .../119-python3-git_3.1.37-3_all.deb ... 209s Unpacking python3-git (3.1.37-3) ... 209s Selecting previously unselected package python3-lockfile. 209s Preparing to unpack .../120-python3-lockfile_1%3a0.12.2-3_all.deb ... 209s Unpacking python3-lockfile (1:0.12.2-3) ... 209s Selecting previously unselected package python3-simplejson. 209s Preparing to unpack .../121-python3-simplejson_3.19.2-1build1_arm64.deb ... 209s Unpacking python3-simplejson (3.19.2-1build1) ... 209s Selecting previously unselected package python3-libcloud. 209s Preparing to unpack .../122-python3-libcloud_3.4.1-5_all.deb ... 209s Unpacking python3-libcloud (3.4.1-5) ... 209s Selecting previously unselected package python3-bcrypt. 209s Preparing to unpack .../123-python3-bcrypt_3.2.2-1_arm64.deb ... 209s Unpacking python3-bcrypt (3.2.2-1) ... 209s Selecting previously unselected package libsodium23:arm64. 209s Preparing to unpack .../124-libsodium23_1.0.18-1build2_arm64.deb ... 209s Unpacking libsodium23:arm64 (1.0.18-1build2) ... 209s Selecting previously unselected package python3-nacl. 209s Preparing to unpack .../125-python3-nacl_1.5.0-4_arm64.deb ... 209s Unpacking python3-nacl (1.5.0-4) ... 209s Selecting previously unselected package python3-paramiko. 209s Preparing to unpack .../126-python3-paramiko_2.12.0-2ubuntu4_all.deb ... 209s Unpacking python3-paramiko (2.12.0-2ubuntu4) ... 209s Selecting previously unselected package python3-pyasn1. 209s Preparing to unpack .../127-python3-pyasn1_0.4.8-4_all.deb ... 209s Unpacking python3-pyasn1 (0.4.8-4) ... 209s Selecting previously unselected package python3-pyasn1-modules. 209s Preparing to unpack .../128-python3-pyasn1-modules_0.2.8-1_all.deb ... 209s Unpacking python3-pyasn1-modules (0.2.8-1) ... 209s Selecting previously unselected package python3-png. 209s Preparing to unpack .../129-python3-png_0.20231004.0-2_all.deb ... 209s Unpacking python3-png (0.20231004.0-2) ... 209s Selecting previously unselected package python3-qrcode. 209s Preparing to unpack .../130-python3-qrcode_7.4.2-4_all.deb ... 209s Unpacking python3-qrcode (7.4.2-4) ... 209s Selecting previously unselected package python3-ruamel.yaml.clib:arm64. 209s Preparing to unpack .../131-python3-ruamel.yaml.clib_0.2.8-1_arm64.deb ... 209s Unpacking python3-ruamel.yaml.clib:arm64 (0.2.8-1) ... 209s Selecting previously unselected package python3-ruamel.yaml. 209s Preparing to unpack .../132-python3-ruamel.yaml_0.17.21-1_all.deb ... 209s Unpacking python3-ruamel.yaml (0.17.21-1) ... 209s Selecting previously unselected package python3-pathspec. 209s Preparing to unpack .../133-python3-pathspec_0.12.1-1_all.deb ... 209s Unpacking python3-pathspec (0.12.1-1) ... 209s Selecting previously unselected package yamllint. 209s Preparing to unpack .../134-yamllint_1.33.0-1_all.deb ... 209s Unpacking yamllint (1.33.0-1) ... 209s Selecting previously unselected package ca-certificates-java. 209s Preparing to unpack .../135-ca-certificates-java_20240118_all.deb ... 209s Unpacking ca-certificates-java (20240118) ... 209s Selecting previously unselected package java-common. 209s Preparing to unpack .../136-java-common_0.75+exp1_all.deb ... 209s Unpacking java-common (0.75+exp1) ... 209s Selecting previously unselected package libavahi-common-data:arm64. 209s Preparing to unpack .../137-libavahi-common-data_0.8-13ubuntu2_arm64.deb ... 209s Unpacking libavahi-common-data:arm64 (0.8-13ubuntu2) ... 209s Selecting previously unselected package libavahi-common3:arm64. 209s Preparing to unpack .../138-libavahi-common3_0.8-13ubuntu2_arm64.deb ... 209s Unpacking libavahi-common3:arm64 (0.8-13ubuntu2) ... 209s Selecting previously unselected package libavahi-client3:arm64. 209s Preparing to unpack .../139-libavahi-client3_0.8-13ubuntu2_arm64.deb ... 209s Unpacking libavahi-client3:arm64 (0.8-13ubuntu2) ... 209s Selecting previously unselected package libcups2:arm64. 209s Preparing to unpack .../140-libcups2_2.4.6-0ubuntu3_arm64.deb ... 209s Unpacking libcups2:arm64 (2.4.6-0ubuntu3) ... 209s Selecting previously unselected package libasound2-data. 209s Preparing to unpack .../141-libasound2-data_1.2.10-3build1_all.deb ... 209s Unpacking libasound2-data (1.2.10-3build1) ... 209s Selecting previously unselected package libasound2:arm64. 209s Preparing to unpack .../142-libasound2_1.2.10-3build1_arm64.deb ... 209s Unpacking libasound2:arm64 (1.2.10-3build1) ... 209s Selecting previously unselected package libpcsclite1:arm64. 209s Preparing to unpack .../143-libpcsclite1_2.0.0-1_arm64.deb ... 209s Unpacking libpcsclite1:arm64 (2.0.0-1) ... 210s Selecting previously unselected package openjdk-21-jre-headless:arm64. 210s Preparing to unpack .../144-openjdk-21-jre-headless_21.0.2+13-2_arm64.deb ... 210s Unpacking openjdk-21-jre-headless:arm64 (21.0.2+13-2) ... 211s Selecting previously unselected package default-jre-headless. 211s Preparing to unpack .../145-default-jre-headless_2%3a1.21-75+exp1_arm64.deb ... 211s Unpacking default-jre-headless (2:1.21-75+exp1) ... 211s Selecting previously unselected package libgtk2.0-common. 211s Preparing to unpack .../146-libgtk2.0-common_2.24.33-2ubuntu2_all.deb ... 211s Unpacking libgtk2.0-common (2.24.33-2ubuntu2) ... 211s Selecting previously unselected package at-spi2-common. 211s Preparing to unpack .../147-at-spi2-common_2.50.0-1_all.deb ... 211s Unpacking at-spi2-common (2.50.0-1) ... 211s Selecting previously unselected package libatk1.0-0:arm64. 211s Preparing to unpack .../148-libatk1.0-0_2.50.0-1_arm64.deb ... 211s Unpacking libatk1.0-0:arm64 (2.50.0-1) ... 211s Selecting previously unselected package libgdk-pixbuf2.0-common. 211s Preparing to unpack .../149-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ... 211s Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... 211s Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64. 211s Preparing to unpack .../150-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3_arm64.deb ... 211s Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ... 211s Selecting previously unselected package libxcomposite1:arm64. 211s Preparing to unpack .../151-libxcomposite1_1%3a0.4.5-1build2_arm64.deb ... 211s Unpacking libxcomposite1:arm64 (1:0.4.5-1build2) ... 211s Selecting previously unselected package libxfixes3:arm64. 211s Preparing to unpack .../152-libxfixes3_1%3a6.0.0-2_arm64.deb ... 211s Unpacking libxfixes3:arm64 (1:6.0.0-2) ... 211s Selecting previously unselected package libxcursor1:arm64. 211s Preparing to unpack .../153-libxcursor1_1%3a1.2.1-1_arm64.deb ... 211s Unpacking libxcursor1:arm64 (1:1.2.1-1) ... 211s Selecting previously unselected package libxdamage1:arm64. 211s Preparing to unpack .../154-libxdamage1_1%3a1.1.6-1_arm64.deb ... 211s Unpacking libxdamage1:arm64 (1:1.1.6-1) ... 211s Selecting previously unselected package libxi6:arm64. 211s Preparing to unpack .../155-libxi6_2%3a1.8.1-1_arm64.deb ... 211s Unpacking libxi6:arm64 (2:1.8.1-1) ... 211s Selecting previously unselected package libxinerama1:arm64. 211s Preparing to unpack .../156-libxinerama1_2%3a1.1.4-3_arm64.deb ... 211s Unpacking libxinerama1:arm64 (2:1.1.4-3) ... 211s Selecting previously unselected package libxrandr2:arm64. 211s Preparing to unpack .../157-libxrandr2_2%3a1.5.2-2_arm64.deb ... 211s Unpacking libxrandr2:arm64 (2:1.5.2-2) ... 211s Selecting previously unselected package gtk-update-icon-cache. 211s Preparing to unpack .../158-gtk-update-icon-cache_3.24.40-2ubuntu1_arm64.deb ... 211s Unpacking gtk-update-icon-cache (3.24.40-2ubuntu1) ... 211s Selecting previously unselected package hicolor-icon-theme. 211s Preparing to unpack .../159-hicolor-icon-theme_0.17-2_all.deb ... 211s Unpacking hicolor-icon-theme (0.17-2) ... 211s Selecting previously unselected package humanity-icon-theme. 211s Preparing to unpack .../160-humanity-icon-theme_0.6.16_all.deb ... 211s Unpacking humanity-icon-theme (0.6.16) ... 212s Selecting previously unselected package ubuntu-mono. 212s Preparing to unpack .../161-ubuntu-mono_20.10-0ubuntu2_all.deb ... 212s Unpacking ubuntu-mono (20.10-0ubuntu2) ... 212s Selecting previously unselected package adwaita-icon-theme. 212s Preparing to unpack .../162-adwaita-icon-theme_46~rc-1_all.deb ... 212s Unpacking adwaita-icon-theme (46~rc-1) ... 212s Selecting previously unselected package libgtk2.0-0:arm64. 212s Preparing to unpack .../163-libgtk2.0-0_2.24.33-2ubuntu2_arm64.deb ... 212s Unpacking libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ... 212s Selecting previously unselected package libglvnd0:arm64. 212s Preparing to unpack .../164-libglvnd0_1.7.0-1_arm64.deb ... 212s Unpacking libglvnd0:arm64 (1.7.0-1) ... 212s Selecting previously unselected package libglapi-mesa:arm64. 212s Preparing to unpack .../165-libglapi-mesa_24.0.1-1ubuntu1_arm64.deb ... 212s Unpacking libglapi-mesa:arm64 (24.0.1-1ubuntu1) ... 212s Selecting previously unselected package libx11-xcb1:arm64. 212s Preparing to unpack .../166-libx11-xcb1_2%3a1.8.7-1_arm64.deb ... 212s Unpacking libx11-xcb1:arm64 (2:1.8.7-1) ... 212s Selecting previously unselected package libxcb-dri2-0:arm64. 212s Preparing to unpack .../167-libxcb-dri2-0_1.15-1_arm64.deb ... 212s Unpacking libxcb-dri2-0:arm64 (1.15-1) ... 212s Selecting previously unselected package libxcb-dri3-0:arm64. 212s Preparing to unpack .../168-libxcb-dri3-0_1.15-1_arm64.deb ... 212s Unpacking libxcb-dri3-0:arm64 (1.15-1) ... 212s Selecting previously unselected package libxcb-glx0:arm64. 212s Preparing to unpack .../169-libxcb-glx0_1.15-1_arm64.deb ... 212s Unpacking libxcb-glx0:arm64 (1.15-1) ... 212s Selecting previously unselected package libxcb-present0:arm64. 212s Preparing to unpack .../170-libxcb-present0_1.15-1_arm64.deb ... 212s Unpacking libxcb-present0:arm64 (1.15-1) ... 213s Selecting previously unselected package libxcb-randr0:arm64. 213s Preparing to unpack .../171-libxcb-randr0_1.15-1_arm64.deb ... 213s Unpacking libxcb-randr0:arm64 (1.15-1) ... 213s Selecting previously unselected package libxcb-sync1:arm64. 213s Preparing to unpack .../172-libxcb-sync1_1.15-1_arm64.deb ... 213s Unpacking libxcb-sync1:arm64 (1.15-1) ... 213s Selecting previously unselected package libxcb-xfixes0:arm64. 213s Preparing to unpack .../173-libxcb-xfixes0_1.15-1_arm64.deb ... 213s Unpacking libxcb-xfixes0:arm64 (1.15-1) ... 213s Selecting previously unselected package libxshmfence1:arm64. 213s Preparing to unpack .../174-libxshmfence1_1.3-1build4_arm64.deb ... 213s Unpacking libxshmfence1:arm64 (1.3-1build4) ... 213s Selecting previously unselected package libxxf86vm1:arm64. 213s Preparing to unpack .../175-libxxf86vm1_1%3a1.1.4-1build3_arm64.deb ... 213s Unpacking libxxf86vm1:arm64 (1:1.1.4-1build3) ... 213s Selecting previously unselected package libvulkan1:arm64. 213s Preparing to unpack .../176-libvulkan1_1.3.275.0-1_arm64.deb ... 213s Unpacking libvulkan1:arm64 (1.3.275.0-1) ... 213s Selecting previously unselected package libdrm-amdgpu1:arm64. 213s Preparing to unpack .../177-libdrm-amdgpu1_2.4.120-2_arm64.deb ... 213s Unpacking libdrm-amdgpu1:arm64 (2.4.120-2) ... 213s Selecting previously unselected package libdrm-nouveau2:arm64. 213s Preparing to unpack .../178-libdrm-nouveau2_2.4.120-2_arm64.deb ... 213s Unpacking libdrm-nouveau2:arm64 (2.4.120-2) ... 213s Selecting previously unselected package libdrm-radeon1:arm64. 213s Preparing to unpack .../179-libdrm-radeon1_2.4.120-2_arm64.deb ... 213s Unpacking libdrm-radeon1:arm64 (2.4.120-2) ... 213s Selecting previously unselected package libllvm17:arm64. 213s Preparing to unpack .../180-libllvm17_1%3a17.0.6-5build1_arm64.deb ... 213s Unpacking libllvm17:arm64 (1:17.0.6-5build1) ... 214s Selecting previously unselected package libgl1-mesa-dri:arm64. 214s Preparing to unpack .../181-libgl1-mesa-dri_24.0.1-1ubuntu1_arm64.deb ... 214s Unpacking libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ... 214s Selecting previously unselected package libglx-mesa0:arm64. 214s Preparing to unpack .../182-libglx-mesa0_24.0.1-1ubuntu1_arm64.deb ... 214s Unpacking libglx-mesa0:arm64 (24.0.1-1ubuntu1) ... 214s Selecting previously unselected package libglx0:arm64. 214s Preparing to unpack .../183-libglx0_1.7.0-1_arm64.deb ... 214s Unpacking libglx0:arm64 (1.7.0-1) ... 214s Selecting previously unselected package libgl1:arm64. 214s Preparing to unpack .../184-libgl1_1.7.0-1_arm64.deb ... 214s Unpacking libgl1:arm64 (1.7.0-1) ... 214s Selecting previously unselected package libgif7:arm64. 214s Preparing to unpack .../185-libgif7_5.2.1-2.5_arm64.deb ... 214s Unpacking libgif7:arm64 (5.2.1-2.5) ... 214s Selecting previously unselected package libxtst6:arm64. 214s Preparing to unpack .../186-libxtst6_2%3a1.2.3-1.1_arm64.deb ... 214s Unpacking libxtst6:arm64 (2:1.2.3-1.1) ... 214s Selecting previously unselected package openjdk-21-jre:arm64. 214s Preparing to unpack .../187-openjdk-21-jre_21.0.2+13-2_arm64.deb ... 214s Unpacking openjdk-21-jre:arm64 (21.0.2+13-2) ... 214s Selecting previously unselected package default-jre. 214s Preparing to unpack .../188-default-jre_2%3a1.21-75+exp1_arm64.deb ... 214s Unpacking default-jre (2:1.21-75+exp1) ... 214s Selecting previously unselected package libapksig-java. 214s Preparing to unpack .../189-libapksig-java_31.0.2-1_all.deb ... 214s Unpacking libapksig-java (31.0.2-1) ... 214s Selecting previously unselected package apksigner. 214s Preparing to unpack .../190-apksigner_31.0.2-1_all.deb ... 214s Unpacking apksigner (31.0.2-1) ... 214s Selecting previously unselected package openjdk-21-jdk-headless:arm64. 214s Preparing to unpack .../191-openjdk-21-jdk-headless_21.0.2+13-2_arm64.deb ... 214s Unpacking openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ... 215s Selecting previously unselected package default-jdk-headless. 215s Preparing to unpack .../192-default-jdk-headless_2%3a1.21-75+exp1_arm64.deb ... 215s Unpacking default-jdk-headless (2:1.21-75+exp1) ... 215s Selecting previously unselected package fdroidserver. 215s Preparing to unpack .../193-fdroidserver_2.2.1-2_all.deb ... 215s Unpacking fdroidserver (2.2.1-2) ... 215s Selecting previously unselected package android-libart:arm64. 215s Preparing to unpack .../194-android-libart_13.0.0+r63-2_arm64.deb ... 215s Unpacking android-libart:arm64 (13.0.0+r63-2) ... 215s Selecting previously unselected package android-liblog:arm64. 215s Preparing to unpack .../195-android-liblog_1%3a33.0.3-2_arm64.deb ... 215s Unpacking android-liblog:arm64 (1:33.0.3-2) ... 215s Selecting previously unselected package android-libbase:arm64. 215s Preparing to unpack .../196-android-libbase_1%3a33.0.3-2_arm64.deb ... 215s Unpacking android-libbase:arm64 (1:33.0.3-2) ... 215s Selecting previously unselected package android-libbacktrace:arm64. 215s Preparing to unpack .../197-android-libbacktrace_1%3a33.0.3-2_arm64.deb ... 215s Unpacking android-libbacktrace:arm64 (1:33.0.3-2) ... 215s Selecting previously unselected package android-libziparchive:arm64. 215s Preparing to unpack .../198-android-libziparchive_1%3a33.0.3-2_arm64.deb ... 215s Unpacking android-libziparchive:arm64 (1:33.0.3-2) ... 215s Selecting previously unselected package libatomic1:arm64. 215s Preparing to unpack .../199-libatomic1_14-20240303-1ubuntu1_arm64.deb ... 215s Unpacking libatomic1:arm64 (14-20240303-1ubuntu1) ... 215s Selecting previously unselected package android-libnativebridge:arm64. 215s Preparing to unpack .../200-android-libnativebridge_1%3a13.0.0+r63-2_arm64.deb ... 215s Unpacking android-libnativebridge:arm64 (1:13.0.0+r63-2) ... 215s Selecting previously unselected package android-libnativeloader:arm64. 215s Preparing to unpack .../201-android-libnativeloader_1%3a13.0.0+r63-2_arm64.deb ... 215s Unpacking android-libnativeloader:arm64 (1:13.0.0+r63-2) ... 215s Selecting previously unselected package dexdump. 215s Preparing to unpack .../202-dexdump_13.0.0+r63-2_arm64.deb ... 215s Unpacking dexdump (13.0.0+r63-2) ... 215s Setting up libgraphite2-3:arm64 (1.3.14-2) ... 215s Setting up libxcb-dri3-0:arm64 (1.15-1) ... 215s Setting up liblcms2-2:arm64 (2.14-2) ... 215s Setting up libpixman-1-0:arm64 (0.42.2-1) ... 215s Setting up python3-lockfile (1:0.12.2-3) ... 215s Setting up libsharpyuv0:arm64 (1.3.2-0.4) ... 215s Setting up libx11-xcb1:arm64 (2:1.8.7-1) ... 215s Setting up python3-pure-eval (0.2.2-1) ... 215s Setting up libdrm-nouveau2:arm64 (2.4.120-2) ... 215s Setting up libsodium23:arm64 (1.0.18-1build2) ... 215s Setting up libxdamage1:arm64 (1:1.1.6-1) ... 215s Setting up libxcb-xfixes0:arm64 (1.15-1) ... 215s Setting up liblerc4:arm64 (4.0.0+ds-4ubuntu1) ... 215s Setting up libxpm4:arm64 (1:3.5.17-1) ... 215s Setting up hicolor-icon-theme (0.17-2) ... 215s Setting up libxi6:arm64 (2:1.8.1-1) ... 215s Setting up android-liblog:arm64 (1:33.0.3-2) ... 215s Setting up java-common (0.75+exp1) ... 215s Setting up libxrender1:arm64 (1:0.9.10-1.1) ... 215s Setting up libdatrie1:arm64 (0.2.13-3) ... 215s Setting up python3-parso (0.8.3-1) ... 216s Setting up python3-colorama (0.4.6-4) ... 216s Setting up python3-lz4 (4.0.2+dfsg-1build2) ... 216s Setting up libxcb-render0:arm64 (1.15-1) ... 216s Setting up python3-defusedxml (0.7.1-2) ... 216s Setting up python3-asttokens (2.4.1-1) ... 216s Setting up libdrm-radeon1:arm64 (2.4.120-2) ... 216s Setting up libglvnd0:arm64 (1.7.0-1) ... 216s Setting up python3-unicodedata2 (15.1.0+ds-1) ... 216s Setting up fonts-lyx (2.4.0~RC3-1) ... 216s Setting up libxcb-glx0:arm64 (1.15-1) ... 216s Setting up python3-bcrypt (3.2.2-1) ... 216s Setting up liblab-gamut1:arm64 (2.42.2-8build1) ... 216s Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... 216s Setting up python3-ruamel.yaml.clib:arm64 (0.2.8-1) ... 216s Setting up x11-common (1:7.7+23ubuntu2) ... 217s Setting up libdeflate0:arm64 (1.19-1) ... 217s Setting up libqhull-r8.0:arm64 (2020.2-6) ... 217s Setting up libxcb-shm0:arm64 (1.15-1) ... 217s Setting up libgomp1:arm64 (14-20240303-1ubuntu1) ... 217s Setting up python3-click (8.1.6-1) ... 217s Setting up python3-networkx (2.8.8-1ubuntu1) ... 218s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:556: SyntaxWarning: invalid octal escape sequence '\420' 218s "graph [edge [ source u'u\4200' target u'u\4200' ] " 218s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:557: SyntaxWarning: invalid octal escape sequence '\420' 218s + "node [ id u'u\4200' label b ] ]" 218s Setting up libjbig0:arm64 (2.1-6.1ubuntu1) ... 218s Setting up android-libart:arm64 (13.0.0+r63-2) ... 218s Setting up libxxf86vm1:arm64 (1:1.1.4-1build3) ... 218s Setting up python3-png (0.20231004.0-2) ... 218s Setting up libxcb-present0:arm64 (1.15-1) ... 218s Setting up liberror-perl (0.17029-2) ... 218s Setting up unicode-data (15.1.0-1) ... 218s Setting up libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ... 218s Setting up python3-simplejson (3.19.2-1build1) ... 218s Setting up libasound2-data (1.2.10-3build1) ... 218s Setting up python3-decorator (5.1.1-5) ... 218s Setting up libblas3:arm64 (3.12.0-3) ... 218s update-alternatives: using /usr/lib/aarch64-linux-gnu/blas/libblas.so.3 to provide /usr/lib/aarch64-linux-gnu/libblas.so.3 (libblas.so.3-aarch64-linux-gnu) in auto mode 218s Setting up python3-packaging (23.2-1) ... 219s Setting up python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ... 219s Setting up python3-args (0.1.0-5) ... 219s Setting up libxfixes3:arm64 (1:6.0.0-2) ... 219s Setting up libxcb-sync1:arm64 (1.15-1) ... 219s Setting up python3-executing (2.0.1-0.1) ... 219s Setting up libpathplan4:arm64 (2.42.2-8build1) ... 219s Setting up python3-brotli (1.1.0-2) ... 219s Setting up libavahi-common-data:arm64 (0.8-13ubuntu2) ... 219s Setting up libann0 (1.1.2+doc-9) ... 219s Setting up python3-cycler (0.11.0-2) ... 219s Setting up libxinerama1:arm64 (2:1.1.4-3) ... 219s Setting up libimagequant0:arm64 (2.18.0-1) ... 219s Setting up fonts-dejavu-mono (2.37-8) ... 219s Setting up python3-kiwisolver (1.4.4-1build2) ... 219s Setting up libatomic1:arm64 (14-20240303-1ubuntu1) ... 219s Setting up libxrandr2:arm64 (2:1.5.2-2) ... 219s Setting up libtcl8.6:arm64 (8.6.13+dfsg-2) ... 219s Setting up fonts-dejavu-core (2.37-8) ... 219s Setting up libpcsclite1:arm64 (2.0.0-1) ... 219s Setting up libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ... 219s Setting up libltdl7:arm64 (2.4.7-7) ... 219s Setting up libglapi-mesa:arm64 (24.0.1-1ubuntu1) ... 219s Setting up libgfortran5:arm64 (14-20240303-1ubuntu1) ... 219s Setting up libvulkan1:arm64 (1.3.275.0-1) ... 219s Setting up libwebp7:arm64 (1.3.2-0.4) ... 219s Setting up libxcb-dri2-0:arm64 (1.15-1) ... 219s Setting up python3-ruamel.yaml (0.17.21-1) ... 220s Setting up libgif7:arm64 (5.2.1-2.5) ... 220s Setting up libxshmfence1:arm64 (1.3-1build4) ... 220s Setting up at-spi2-common (2.50.0-1) ... 220s Setting up libxcb-randr0:arm64 (1.15-1) ... 220s Setting up python3-traitlets (5.5.0-2) ... 220s Setting up libasound2:arm64 (1.2.10-3build1) ... 220s Setting up libxslt1.1:arm64 (1.1.35-1) ... 220s Setting up python3-pyasn1 (0.4.8-4) ... 220s Setting up libopenjp2-7:arm64 (2.5.0-2) ... 220s Setting up git-man (1:2.43.0-1ubuntu1) ... 220s Setting up libharfbuzz0b:arm64 (8.3.0-2) ... 220s Setting up libthai-data (0.1.29-2) ... 220s Setting up python3-dateutil (2.8.2-3) ... 220s Setting up libgtk2.0-common (2.24.33-2ubuntu2) ... 220s Setting up libcdt5:arm64 (2.42.2-8build1) ... 220s Setting up libatk1.0-0:arm64 (2.50.0-1) ... 220s Setting up libcgraph6:arm64 (2.42.2-8build1) ... 220s Setting up libxss1:arm64 (1:1.2.3-1build2) ... 220s Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 220s Setting up ca-certificates-java (20240118) ... 220s No JRE found. Skipping Java certificates setup. 220s Setting up python3-mpmath (1.2.1-3) ... 221s Setting up python3-magic (2:0.4.27-2) ... 221s Setting up android-libbase:arm64 (1:33.0.3-2) ... 221s Setting up python-matplotlib-data (3.6.3-1ubuntu3) ... 221s Setting up libwebpmux3:arm64 (1.3.2-0.4) ... 221s Setting up python3-pathspec (0.12.1-1) ... 221s Setting up libllvm17:arm64 (1:17.0.6-5build1) ... 221s Setting up python3-appdirs (1.4.4-4) ... 221s Setting up python3-smmap (6.0.0-1) ... 221s Setting up libxcomposite1:arm64 (1:0.4.5-1build2) ... 221s Setting up python3-stack-data (0.6.3-1) ... 221s Setting up python3-asn1crypto (1.5.1-3) ... 222s Setting up python3-nacl (1.5.0-4) ... 222s Setting up libapksig-java (31.0.2-1) ... 222s Setting up python3-ptyprocess (0.7.0-5) ... 222s Setting up libdrm-amdgpu1:arm64 (2.4.120-2) ... 222s Setting up libjpeg8:arm64 (8c-2ubuntu11) ... 222s Setting up python3-prompt-toolkit (3.0.43-1) ... 222s Setting up python3-sympy (1.12-7) ... 228s Setting up android-libnativebridge:arm64 (1:13.0.0+r63-2) ... 228s Setting up libice6:arm64 (2:1.0.10-1build2) ... 228s Setting up liblapack3:arm64 (3.12.0-3) ... 228s update-alternatives: using /usr/lib/aarch64-linux-gnu/lapack/liblapack.so.3 to provide /usr/lib/aarch64-linux-gnu/liblapack.so.3 (liblapack.so.3-aarch64-linux-gnu) in auto mode 228s Setting up python3-clint (0.5.1-4) ... 228s /usr/lib/python3/dist-packages/clint/packages/appdirs.py:82: SyntaxWarning: invalid escape sequence '\D' 228s """Return full path to the user-shared data dir for this application. 228s /usr/lib/python3/dist-packages/clint/packages/colorama/ansitowin32.py:43: SyntaxWarning: invalid escape sequence '\[' 228s ANSI_RE = re.compile('\033\[((?:\d|;)*)([a-zA-Z])') 228s /usr/lib/python3/dist-packages/clint/textui/colored.py:118: SyntaxWarning: invalid escape sequence '\$' 228s strip = re.compile("([^-_a-zA-Z0-9!@#%&=,/'\";:~`\$\^\*\(\)\+\[\]\.\{\}\|\?\<\>\\]+|[^\s]+)") 228s Setting up android-libziparchive:arm64 (1:33.0.3-2) ... 228s Setting up python3-jedi (0.18.2-1ubuntu1) ... 228s Setting up fontconfig-config (2.15.0-1ubuntu1) ... 228s Setting up libxtst6:arm64 (2:1.2.3-1.1) ... 228s Setting up libwebpdemux2:arm64 (1.3.2-0.4) ... 228s Setting up libxcursor1:arm64 (1:1.2.1-1) ... 228s Setting up libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ... 228s Setting up libavahi-common3:arm64 (0.8-13ubuntu2) ... 228s Setting up python3-libcloud (3.4.1-5) ... 229s Setting up python3-gitdb (4.0.11-1) ... 229s Setting up python3-matplotlib-inline (0.1.6-2) ... 229s Setting up python3-fs (2.4.16-3) ... 230s Setting up libthai0:arm64 (0.1.29-2) ... 230s Setting up yamllint (1.33.0-1) ... 230s Setting up python3-oscrypto (1.3.0-5) ... 230s Setting up libjs-jquery-ui (1.13.2+dfsg-1) ... 230s Setting up python3-pexpect (4.9-2) ... 230s Setting up python3-pyasn1-modules (0.2.8-1) ... 230s Setting up libraqm0:arm64 (0.10.1-1) ... 230s Setting up android-libnativeloader:arm64 (1:13.0.0+r63-2) ... 230s Setting up git (1:2.43.0-1ubuntu1) ... 230s Setting up python3-numpy (1:1.24.2-2) ... 232s Setting up android-libbacktrace:arm64 (1:33.0.3-2) ... 232s Setting up libgvpr2:arm64 (2.42.2-8build1) ... 232s Setting up python3-lxml:arm64 (5.1.0-1) ... 232s Setting up libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ... 232s Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ... 232s Setting up python3-contourpy (1.0.7-1build2) ... 233s Setting up libfontconfig1:arm64 (2.15.0-1ubuntu1) ... 233s Setting up python3-paramiko (2.12.0-2ubuntu4) ... 233s Setting up libsm6:arm64 (2:1.2.3-1build2) ... 233s Setting up libavahi-client3:arm64 (0.8-13ubuntu2) ... 233s Setting up liblbfgsb0:arm64 (3.0+dfsg.4-1) ... 233s Setting up gtk-update-icon-cache (3.24.40-2ubuntu1) ... 233s Setting up fontconfig (2.15.0-1ubuntu1) ... 235s Regenerating fonts cache... done. 235s Setting up libxft2:arm64 (2.3.6-1) ... 235s Setting up libglx-mesa0:arm64 (24.0.1-1ubuntu1) ... 235s Setting up python3-scipy (1.11.4-6) ... 238s Setting up libglx0:arm64 (1.7.0-1) ... 238s Setting up libtk8.6:arm64 (8.6.13-2) ... 238s Setting up libpango-1.0-0:arm64 (1.51.0+ds-4) ... 238s Setting up libcairo2:arm64 (1.18.0-1) ... 238s Setting up python3-pil:arm64 (10.2.0-1) ... 238s Setting up dexdump (13.0.0+r63-2) ... 238s Setting up libgl1:arm64 (1.7.0-1) ... 238s Setting up python3-ipython (8.20.0-1) ... 239s Setting up python3-git (3.1.37-3) ... 239s Setting up libgd3:arm64 (2.3.3-9ubuntu1) ... 239s Setting up libxt6:arm64 (1:1.2.1-1.1) ... 239s Setting up libcups2:arm64 (2.4.6-0ubuntu3) ... 239s Setting up python3-qrcode (7.4.2-4) ... 239s update-alternatives: using /usr/bin/python3-qr to provide /usr/bin/qr (qr) in auto mode 239s Setting up libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ... 239s Setting up libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ... 239s Setting up tk8.6-blt2.5 (2.5.3+dfsg-7) ... 239s Setting up libxmu6:arm64 (2:1.1.3-3) ... 239s Setting up openjdk-21-jre-headless:arm64 (21.0.2+13-2) ... 239s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode 239s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode 239s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode 239s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode 239s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode 239s Setting up blt (2.5.3+dfsg-7) ... 239s Setting up python3-tk:arm64 (3.11.5-1) ... 239s Setting up libxaw7:arm64 (2:1.0.14-1) ... 239s Setting up python3-pil.imagetk:arm64 (10.2.0-1) ... 240s Setting up libgvc6 (2.42.2-8build1) ... 240s Setting up graphviz (2.42.2-8build1) ... 240s Setting up python3-pydot (1.4.2-2) ... 240s Setting up python3-fonttools (4.46.0-1) ... 241s Setting up adwaita-icon-theme (46~rc-1) ... 241s update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode 241s Setting up python3-ufolib2 (0.16.0+dfsg1-1) ... 241s Setting up python3-matplotlib (3.6.3-1ubuntu3) ... 242s Setting up libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ... 242s Setting up androguard (3.4.0~a1-10) ... 242s /usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:1027: SyntaxWarning: invalid escape sequence '\>' 242s """ 242s Setting up humanity-icon-theme (0.6.16) ... 243s Setting up ubuntu-mono (20.10-0ubuntu2) ... 243s Processing triggers for man-db (2.12.0-3) ... 243s Processing triggers for libc-bin (2.39-0ubuntu2) ... 243s Processing triggers for ca-certificates-java (20240118) ... 244s Adding debian:ACCVRAIZ1.pem 244s Adding debian:AC_RAIZ_FNMT-RCM.pem 244s Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem 244s Adding debian:ANF_Secure_Server_Root_CA.pem 244s Adding debian:Actalis_Authentication_Root_CA.pem 244s Adding debian:AffirmTrust_Commercial.pem 244s Adding debian:AffirmTrust_Networking.pem 244s Adding debian:AffirmTrust_Premium.pem 244s Adding debian:AffirmTrust_Premium_ECC.pem 244s Adding debian:Amazon_Root_CA_1.pem 244s Adding debian:Amazon_Root_CA_2.pem 244s Adding debian:Amazon_Root_CA_3.pem 244s Adding debian:Amazon_Root_CA_4.pem 244s Adding debian:Atos_TrustedRoot_2011.pem 244s Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem 244s Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem 244s Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem 244s Adding debian:BJCA_Global_Root_CA1.pem 244s Adding debian:BJCA_Global_Root_CA2.pem 244s Adding debian:Baltimore_CyberTrust_Root.pem 244s Adding debian:Buypass_Class_2_Root_CA.pem 244s Adding debian:Buypass_Class_3_Root_CA.pem 244s Adding debian:CA_Disig_Root_R2.pem 244s Adding debian:CFCA_EV_ROOT.pem 244s Adding debian:COMODO_Certification_Authority.pem 244s Adding debian:COMODO_ECC_Certification_Authority.pem 244s Adding debian:COMODO_RSA_Certification_Authority.pem 244s Adding debian:Certainly_Root_E1.pem 244s Adding debian:Certainly_Root_R1.pem 244s Adding debian:Certigna.pem 244s Adding debian:Certigna_Root_CA.pem 244s Adding debian:Certum_EC-384_CA.pem 244s Adding debian:Certum_Trusted_Network_CA.pem 244s Adding debian:Certum_Trusted_Network_CA_2.pem 244s Adding debian:Certum_Trusted_Root_CA.pem 244s Adding debian:CommScope_Public_Trust_ECC_Root-01.pem 244s Adding debian:CommScope_Public_Trust_ECC_Root-02.pem 244s Adding debian:CommScope_Public_Trust_RSA_Root-01.pem 244s Adding debian:CommScope_Public_Trust_RSA_Root-02.pem 244s Adding debian:Comodo_AAA_Services_root.pem 244s Adding debian:D-TRUST_BR_Root_CA_1_2020.pem 244s Adding debian:D-TRUST_EV_Root_CA_1_2020.pem 244s Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem 244s Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem 244s Adding debian:DigiCert_Assured_ID_Root_CA.pem 244s Adding debian:DigiCert_Assured_ID_Root_G2.pem 244s Adding debian:DigiCert_Assured_ID_Root_G3.pem 244s Adding debian:DigiCert_Global_Root_CA.pem 244s Adding debian:DigiCert_Global_Root_G2.pem 244s Adding debian:DigiCert_Global_Root_G3.pem 244s Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem 244s Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem 244s Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem 244s Adding debian:DigiCert_Trusted_Root_G4.pem 244s Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem 244s Adding debian:Entrust_Root_Certification_Authority.pem 244s Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem 244s Adding debian:Entrust_Root_Certification_Authority_-_G2.pem 244s Adding debian:Entrust_Root_Certification_Authority_-_G4.pem 244s Adding debian:GDCA_TrustAUTH_R5_ROOT.pem 244s Adding debian:GLOBALTRUST_2020.pem 244s Adding debian:GTS_Root_R1.pem 244s Adding debian:GTS_Root_R2.pem 244s Adding debian:GTS_Root_R3.pem 244s Adding debian:GTS_Root_R4.pem 244s Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem 244s Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem 244s Adding debian:GlobalSign_Root_CA.pem 244s Adding debian:GlobalSign_Root_CA_-_R3.pem 244s Adding debian:GlobalSign_Root_CA_-_R6.pem 244s Adding debian:GlobalSign_Root_E46.pem 244s Adding debian:GlobalSign_Root_R46.pem 244s Adding debian:Go_Daddy_Class_2_CA.pem 244s Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem 244s Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem 244s Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem 244s Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem 244s Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem 244s Adding debian:HiPKI_Root_CA_-_G1.pem 244s Adding debian:Hongkong_Post_Root_CA_3.pem 244s Adding debian:ISRG_Root_X1.pem 244s Adding debian:ISRG_Root_X2.pem 244s Adding debian:IdenTrust_Commercial_Root_CA_1.pem 244s Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem 244s Adding debian:Izenpe.com.pem 244s Adding debian:Microsec_e-Szigno_Root_CA_2009.pem 244s Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem 244s Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem 244s Adding debian:NAVER_Global_Root_Certification_Authority.pem 244s Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem 244s Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem 244s Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem 244s Adding debian:QuoVadis_Root_CA_1_G3.pem 244s Adding debian:QuoVadis_Root_CA_2.pem 244s Adding debian:QuoVadis_Root_CA_2_G3.pem 244s Adding debian:QuoVadis_Root_CA_3.pem 244s Adding debian:QuoVadis_Root_CA_3_G3.pem 244s Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem 244s Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem 244s Adding debian:SSL.com_Root_Certification_Authority_ECC.pem 244s Adding debian:SSL.com_Root_Certification_Authority_RSA.pem 244s Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem 244s Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem 244s Adding debian:SZAFIR_ROOT_CA2.pem 244s Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem 244s Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem 244s Adding debian:SecureSign_RootCA11.pem 244s Adding debian:SecureTrust_CA.pem 244s Adding debian:Secure_Global_CA.pem 244s Adding debian:Security_Communication_ECC_RootCA1.pem 244s Adding debian:Security_Communication_RootCA2.pem 244s Adding debian:Security_Communication_RootCA3.pem 244s Adding debian:Security_Communication_Root_CA.pem 244s Adding debian:Starfield_Class_2_CA.pem 244s Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem 244s Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem 244s Adding debian:SwissSign_Gold_CA_-_G2.pem 244s Adding debian:SwissSign_Silver_CA_-_G2.pem 244s Adding debian:T-TeleSec_GlobalRoot_Class_2.pem 244s Adding debian:T-TeleSec_GlobalRoot_Class_3.pem 244s Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem 244s Adding debian:TWCA_Global_Root_CA.pem 244s Adding debian:TWCA_Root_Certification_Authority.pem 244s Adding debian:TeliaSonera_Root_CA_v1.pem 244s Adding debian:Telia_Root_CA_v2.pem 244s Adding debian:TrustAsia_Global_Root_CA_G3.pem 244s Adding debian:TrustAsia_Global_Root_CA_G4.pem 244s Adding debian:Trustwave_Global_Certification_Authority.pem 244s Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem 244s Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem 244s Adding debian:TunTrust_Root_CA.pem 244s Adding debian:UCA_Extended_Validation_Root.pem 244s Adding debian:UCA_Global_G2_Root.pem 244s Adding debian:USERTrust_ECC_Certification_Authority.pem 244s Adding debian:USERTrust_RSA_Certification_Authority.pem 244s Adding debian:XRamp_Global_CA_Root.pem 244s Adding debian:certSIGN_ROOT_CA.pem 244s Adding debian:certSIGN_Root_CA_G2.pem 244s Adding debian:e-Szigno_Root_CA_2017.pem 244s Adding debian:ePKI_Root_Certification_Authority.pem 244s Adding debian:emSign_ECC_Root_CA_-_C3.pem 244s Adding debian:emSign_ECC_Root_CA_-_G3.pem 244s Adding debian:emSign_Root_CA_-_C1.pem 244s Adding debian:emSign_Root_CA_-_G1.pem 244s Adding debian:vTrus_ECC_Root_CA.pem 244s Adding debian:vTrus_Root_CA.pem 244s done. 244s Setting up openjdk-21-jre:arm64 (21.0.2+13-2) ... 244s Setting up openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ... 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode 244s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode 244s Setting up default-jre-headless (2:1.21-75+exp1) ... 244s Setting up apksigner (31.0.2-1) ... 244s Setting up fdroidserver (2.2.1-2) ... 245s Setting up default-jre (2:1.21-75+exp1) ... 245s Setting up default-jdk-headless (2:1.21-75+exp1) ... 245s Setting up autopkgtest-satdep (0) ... 253s (Reading database ... 103082 files and directories currently installed.) 253s Removing autopkgtest-satdep (0) ... 254s autopkgtest [19:56:21]: test command1: echo Depends; export LANG=C.UTF-8 ANDROID_HOME=/usr/lib/android-sdk TRAVIS_OS_NAME=osx; fdroid=/usr/bin/fdroid ./tests/run-tests 254s autopkgtest [19:56:21]: test command1: [----------------------- 255s Depends 255s Using ANDROID_HOME=/usr/lib/android-sdk 255s Setting Workspace to /tmp/autopkgtest.MqVFDp/build.8ZF/src 255s + echo_header 'run commit hooks' 255s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src 255s + test -x ./hooks/pre-commit 255s + echo_header 'run unit tests' 255s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests 255s + for testcase in $WORKSPACE/tests/*.TestCase 255s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/build.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 255s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/build.TestCase 255s ============================================================================== 255s run commit hooks 255s ============================================================================== 255s run unit tests 255s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/build.TestCase:641: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 255s newSuite.addTest(unittest.makeSuite(BuildTest)) 255s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 255s INFO:root:Getting source for revision 1.0 255s INFO:root:Creating local.properties file at /tmp/tmparjivztj/local.properties 255s DEBUG:root:Removing debuggable flags from /tmp/tmparjivztj 255s INFO:root:Scanning source for common problems... 255s INFO:root:Ignoring Android AAR library at foo.aar 255s INFO:root:Removing shared library at baz.so 255s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar 255s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 255s DEBUG:root:Checking /tmp/tmparjivztj/mocked.app.id.apk 255s .WARNING:root:Android NDK version 'r21e' could not be found! 255s WARNING:root:Configured versions: 255s WARNING:root:Android NDK version 'r21e' could not be found! 255s WARNING:root:Configured versions: 256s INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r21e-linux-x86_64.zip 256s INFO:root:Unzipping to /tmp/tmpl5jgie0v/ndk 256s INFO:root:Set NDK r21e (21.4.7075529) up 256s INFO:root:Getting source for revision 1.0 256s INFO:root:Creating local.properties file at /tmp/tmpgd1eymvh/local.properties 256s DEBUG:root:Removing debuggable flags from /tmp/tmpgd1eymvh 256s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 256s DEBUG:root:Checking /tmp/tmpgd1eymvh/mocked.app.id.apk 256s .DEBUG:root:Fetched buildserverid from VM: 0123456789abcdef0123456789abcdefcafebabe 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Connecting to virtual machine... 256s INFO:root:Preparing server for build... 256s DEBUG:root:rsyncing /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver to 256s INFO:root:Starting build... 256s INFO:root:...getting exit status 256s DEBUG:root:retrieved fake.id_123_toolsversion.log 256s INFO:root:Retrieving build output... 256s INFO:root:destroying buildserver after build 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s .DEBUG:root:Reading 'config.yml' 256s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 256s INFO:root:Creating log directory 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Creating build directory 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:Getting git vcs interface for 256s DEBUG:root:Checking info.guardianproject.checkey:123 256s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 256s INFO:root:compared built binary to supplied reference binary successfully 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:success: info.guardianproject.checkey 256s INFO:root:Finished 256s INFO:root:1 build succeeded 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:Getting git vcs interface for 256s DEBUG:root:Checking info.guardianproject.checkey:123 256s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 256s DEBUG:root:removing unsigned/info.guardianproject.checkey_123.apk 256s DEBUG:root:removing unsigned/binaries/info.guardianproject.checkey_123.binary.apk 256s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed 256s ==== detail begin ==== 256s failed 256s ==== detail end ==== 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Build for app info.guardianproject.checkey:123 failed 256s INFO:root:Finished 256s INFO:root:1 build failed 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:Getting git vcs interface for 256s DEBUG:root:Checking info.guardianproject.checkey:123 256s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 256s INFO:root:compared built binary to supplied reference binary successfully 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:success: info.guardianproject.checkey 256s INFO:root:Finished 256s INFO:root:1 build succeeded 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:Getting git vcs interface for 256s DEBUG:root:Checking info.guardianproject.checkey:123 256s INFO:root:...retrieving https://example.com/fdroid/repo/info.guardianproject.checkey_1.2.3.apk 256s WARNING:root:Keeping failed build "tmp/info.guardianproject.checkey_123.apk" 256s DEBUG:root:removing tmp/binaries/info.guardianproject.checkey_123.binary.apk 256s ERROR:root:Could not build app info.guardianproject.checkey: compared built binary to supplied reference binary but failed 256s ==== detail begin ==== 256s failed 256s ==== detail end ==== 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s INFO:root:Build for app info.guardianproject.checkey:123 failed 256s INFO:root:Finished 256s INFO:root:1 build failed 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s DEBUG:root:skip deploying full build logs: not enabled in config 256s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 256s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 256s INFO:androguard.apk:APK file was successfully validated! 256s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 256s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 256s INFO:androguard.apk:APK file was successfully validated! 256s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 256s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 256s INFO:root:Getting source for revision master 256s INFO:root:Creating local.properties file at build/local.properties 256s DEBUG:root:Removing debuggable flags from build 256s DEBUG:root:scanner is configured to use signature data from: 'suss' 256s ERROR:root:Found Java JAR file at libs/android-support-v4r11.jar 256s INFO:root:Getting source for revision master 256s INFO:root:Updating local.properties file at build/local.properties 256s DEBUG:root:Removing debuggable flags from build 256s INFO:root:Collecting prebuilt libraries 256s INFO:root:...installing extlib android/android-support-v4r11.jar 256s INFO:root:Ignoring Java JAR file at libs/android-support-v4r11.jar 256s . 256s ---------------------------------------------------------------------- 256s Ran 6 tests in 0.196s 256s 256s OK 256s + for testcase in $WORKSPACE/tests/*.TestCase 256s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/checkupdates.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 256s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/checkupdates.TestCase 256s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/checkupdates.TestCase:350: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 256s newSuite.addTest(unittest.makeSuite(CheckupdatesTest)) 256s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/common.py:4098: DeprecationWarning: ast.Num is deprecated and will be removed in Python 3.14; use ast.Constant instead 256s if isinstance(node, ast.Num): # 256s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/common.py:4099: DeprecationWarning: Attribute n is deprecated and will be removed in Python 3.14; use value instead 256s return node.n 256s DEBUG:root:Applied vercode operation: 10109 -> 101091 256s DEBUG:root:Applied vercode operation: 10109 -> 101093 256s DEBUG:root:...updating - old vercode=101083, new vercode=101093 256s INFO:root:...updating to version 1.1.9 (101093) 256s INFO:root:...auto-generating build for 1.1.9 256s INFO:root:...auto-generating build for 1.1.9 256s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 256s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 256s INFO:root:...updating to version 1.1.9 (10109) 256s INFO:root:...auto-generating build for 1.1.9 256s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 256s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 256s INFO:root:...updating to version 1.1.9 (10109) 256s INFO:root:...auto-generating build for 1.1.9.10109-fdroid 256s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 256s .DEBUG:root:...requesting https://a.net/b.txt 256s DEBUG:root:...requesting https://d.net/e.txt 256s ..DEBUG:root:...requesting https://a.net/b.txt 256s DEBUG:root:...requesting https://d.net/e.txt 256s INFO:root:Version 1.1.9-beta for loop.starts.shooting is ignored 256s .DEBUG:root:All tags: 1.1.9,1.1.8 256s DEBUG:root:Check tag: '1.1.9' 256s DEBUG:root:UpdateCheckData found version 1.1.9 (10109) 256s DEBUG:root:Check tag: '1.1.8' 256s DEBUG:root:UpdateCheckData found version 1.1.9 (10109) 256s DEBUG:root:All tags: 1.1.9,1.1.8 256s DEBUG:root:Check tag: '1.1.9' 256s DEBUG:root:UpdateCheckData found version 1.1.0 (10109) 256s DEBUG:root:Check tag: '1.1.8' 256s DEBUG:root:UpdateCheckData found version 1.1.0 (10109) 256s DEBUG:root:All tags: 1.1.9,1.1.8 256s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 256s FakeFDroidPopen ['sudo', 'passwd', '--lock', 'root'] {} 256s FakeFDroidPopen ['sudo', 'SUDO_FORCE_REMOVE=yes', 'dpkg', '--purge', 'sudo'] {} 256s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 256s DEBUG:root:Check tag: '1.1.9' 256s DEBUG:root:UpdateCheckData found version 1.1.9 (10109) 256s DEBUG:root:Check tag: '1.1.8' 256s DEBUG:root:UpdateCheckData found version 1.1.8 (10109) 256s DEBUG:root:All tags: Android-1.1.0,1.1.8 256s DEBUG:root:Check tag: 'Android-1.1.0' 256s DEBUG:root:UpdateCheckData found version 1.1.0 (10109) 256s DEBUG:root:Check tag: '1.1.8' 256s DEBUG:root:UpdateCheckData found version 1.1.8 (10109) 256s DEBUG:root:All tags: Android-1.1.0+1 256s DEBUG:root:Check tag: 'Android-1.1.0+1' 256s DEBUG:root:UpdateCheckData found version 1.1.0 (1) 256s DEBUG:root:All tags: 2 256s DEBUG:root:Check tag: '2' 256s DEBUG:root:UpdateCheckData found version 2 (2) 256s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 256s INFO:root:...updating to version 1.1.9 (10109) 256s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 256s .DEBUG:root:...updating - old vercode=10108, new vercode=10109 256s INFO:root:...updating to version 1.1.9 (10109) 256s INFO:root:...auto-generating build for 1.1.9 256s INFO:root:Commiting update for metadata/loop.starts.shooting.yml 256s . 256s ---------------------------------------------------------------------- 256s Ran 9 tests in 0.039s 256s 256s OK 256s + for testcase in $WORKSPACE/tests/*.TestCase 256s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 257s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase 257s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase:2682: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 257s newSuite.addTest(unittest.makeSuite(CommonTest)) 257s .....CRITICAL:root:'repo_keyalias' not found in config.yml! 257s CRITICAL:root:'keystore' not found in config.yml! 257s CRITICAL:root:'keystorepass' not found in config.yml! 257s CRITICAL:root:'keypass' not found in config.yml! 257s ..s./tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/common.py:4098: DeprecationWarning: ast.Num is deprecated and will be removed in Python 3.14; use ast.Constant instead 257s if isinstance(node, ast.Num): # 257s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/common.py:4099: DeprecationWarning: Attribute n is deprecated and will be removed in Python 3.14; use value instead 257s return node.n 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)! 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s WARNING:root:config.py is deprecated, use config.yml 257s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:['rsync', '--archive', '--delete-after', '--safe-links', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ssh/id_rsa', 'repo/com.example.app_4711.log.gz', 'example.com:/var/www/fdroid/repo/'] 257s DEBUG:root:deployed process log repo/com.example.app_4711.log.gz to example.com:/var/www/fdroid/ 257s DEBUG:root:['rsync', '--archive', '--delete-after', '--safe-links', '-e', 'ssh -oBatchMode=yes -oIdentitiesOnly=yes -i ssh/id_rsa', 'repo/com.example.app_4711.log.gz', 'example.com:/var/www/fbot/repo/'] 257s DEBUG:root:deployed process log repo/com.example.app_4711.log.gz to example.com:/var/www/fbot/ 257s .DEBUG:root:skip deploying full build logs: not enabled in config 257s DEBUG:root:skip deploying full build logs: not enabled in config 257s DEBUG:root:skip deploying full build logs: not enabled in config 257s DEBUG:root:deployed process log repo/status/running.json to example.com:/var/www/fbot/ 257s DEBUG:root:deployed process log repo/status/running.json to example.com:/var/www/fbot/ 257s DEBUG:root:deployed process log repo/status/fakesubcommand.json to example.com:/var/www/fbot/ 257s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s DEBUG:root:> sh -c echo stdout message && echo stderr message 1>&2 257s DEBUG:root:> sh -c echo stdout message && echo stderr message 1>&2 257s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s ../tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/common.py:591: DeprecationWarning: distutils Version classes are deprecated. Use packaging.version instead. 257s if LooseVersion(f) < LooseVersion(MINIMUM_APKSIGNER_BUILD_TOOLS_VERSION): 257s INFO:root:Using /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/ANDROID_HOME/build-tools/30.0.3/apksigner 257s ..s.....DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s ...ERROR:androguard.axml:This does not look like an AXML file. header size does not equal 8! header size = 8308 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s ERROR:androguard.axml:This does not look like an AXML file. header size does not equal 8! header size = 8308 257s ERROR:androguard.apk:Error while parsing AndroidManifest.xml - is the file valid? 257s ...DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s ..INFO:root:[PosixPath('source-files/cn.wildfirechat.chat/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/settings.gradle'), PosixPath('source-files/cn.wildfirechat.chat/gradle/build_libraries.gradle'), PosixPath('source-files/cn.wildfirechat.chat/push/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/mars-core-release/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/avenginekit/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/emojilibrary/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/imagepicker/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/chat/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/client/build.gradle'), PosixPath('source-files/cn.wildfirechat.chat/client/src/main/AndroidManifest.xml')] 257s INFO:root:[PosixPath('source-files/com.anpmech.launcher/build.gradle'), PosixPath('source-files/com.anpmech.launcher/settings.gradle'), PosixPath('source-files/com.anpmech.launcher/app/build.gradle'), PosixPath('source-files/com.anpmech.launcher/app/src/main/AndroidManifest.xml')] 257s INFO:root:[PosixPath('source-files/org.tasks/build.gradle'), PosixPath('source-files/org.tasks/build.gradle.kts'), PosixPath('source-files/org.tasks/settings.gradle.kts'), PosixPath('source-files/org.tasks/buildSrc/build.gradle.kts'), PosixPath('source-files/org.tasks/app/build.gradle.kts')] 257s INFO:root:[PosixPath('source-files/ut.ewh.audiometrytest/build.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/settings.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/app/build.gradle'), PosixPath('source-files/ut.ewh.audiometrytest/app/src/main/AndroidManifest.xml')] 257s INFO:root:[PosixPath('source-files/org.noise_planet.noisecapture/settings.gradle'), PosixPath('source-files/org.noise_planet.noisecapture/sosfilter/build.gradle'), PosixPath('source-files/org.noise_planet.noisecapture/app/build.gradle')] 257s ...INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s WARNING:androguard.core.api_specific_resources:Requested API level 30 is larger than maximum we have, returning API level 28 instead. 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 257s INFO:androguard.apk:APK file was successfully validated! 257s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 257s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 257s https://dl.google.com/android/repository/android-ndk-r10e-linux-x86_64.zip /tmp/android-ndk-91la8rgw/android-ndk-r10e-linux-x86_64.zip 257s https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip /tmp/android-ndk-kw70c_gs/android-ndk-r20-linux-x86_64.zip 257s https://dl.google.com/android/repository/android-ndk-r23-linux.zip /tmp/android-ndk-wiaoapov/android-ndk-r23-linux.zip.WARNING:root:config.py is deprecated, use config.yml 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s .DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s ......sINFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r10e-linux-x86_64.zip 257s INFO:root:Unzipping to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_install_ndk_versionszn8g14f2/ndk 257s INFO:root:Set NDK r10e (r10e) up 257s INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip 257s INFO:root:Unzipping to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_install_ndk_versionszn8g14f2/ndk 257s INFO:root:Set NDK r20 (r20) up 257s INFO:root:Set NDK r20 (r20) up 257s INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r23-linux.zip 257s 257s https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip /tmp/android-ndk-6jw_thg8/android-ndk-r20-linux-x86_64.zip 257s INFO:root:Unzipping to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_install_ndk_versionszn8g14f2/ndk 257s INFO:root:Set NDK r23 (23.0.7599858) up 257s INFO:root:Set NDK r23 (23.0.7599858) up 257s .INFO:root:Downloading https://dl.google.com/android/repository/android-ndk-r20-linux-x86_64.zip 257s INFO:root:Unzipping to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/ndk 257s ERROR:root:Unexpected symlink target: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/ndk/ndk/bad_abs_link -> /etc/passwd 257s ERROR:root:Unexpected symlink target: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/ndk/ndk/bad_rel_link -> /etc/passwd 257s total 4 257s -rw-r--r-- 1 ubuntu ubuntu 73 Mar 7 19:56 android-ndk-r20-linux-x86_64.zip 257s lrwxrwxrwx 1 ubuntu ubuntu 32 Mar 7 19:56 basename -> android-ndk-r20-linux-x86_64.zip 257s ERROR:root:Unexpected symlink target: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/ndk/ndk/bad_rel_link2 -> /etc/passwd 257s INFO:root:Set NDK r20 (r20) up 257s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s ....DEBUG:root:Reading 'config.yml' 257s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 257s ....DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml' 257s DEBUG:root:..got package=org.fdroid.fdroid, version=0.94-test, vercode=940 257s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/avenginekit/build.gradle' 257s DEBUG:root:..got package=None, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/build.gradle' 257s DEBUG:root:..got package=None, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/client/build.gradle' 257s DEBUG:root:..got package=None, version=1.0, vercode=1 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/client/src/main/AndroidManifest.xml' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/emojilibrary/build.gradle' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/gradle/build_libraries.gradle' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/imagepicker/build.gradle' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/mars-core-release/build.gradle' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/push/build.gradle' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=1.0, vercode=1 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/settings.gradle' 257s DEBUG:root:..got package=cn.wildfirechat.client, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/cn.wildfirechat.chat/chat/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/pagerIndicator/src/main/AndroidManifest.xml' 257s DEBUG:root:..got package=com.viewpagerindicator, version=2.4.1, vercode=65 257s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/pagerIndicator/build.gradle' 257s DEBUG:root:..got package=com.viewpagerindicator, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/oneSheeld/src/main/AndroidManifest.xml' 257s DEBUG:root:..got package=com.integreight.onesheeld, version=None, vercode=None 257s DEBUG:root:Parsing manifest at 'source-files/com.integreight.onesheeld/oneSheeld/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/dev.patrickgold.florisboard/app/build.gradle.kts' 257s DEBUG:root:Parsing manifest at 'source-files/com.ubergeek42.WeechatAndroid/app/build.gradle.kts' 257s DEBUG:root:..got package=None, version=1.8.1, vercode=10801 257s DEBUG:root:Parsing manifest at 'source-files/com.ubergeek42.WeechatAndroid/app/src/main/res/values/strings.xml' 257s WARNING:root:Problem with xml at 'source-files/com.ubergeek42.WeechatAndroid/app/src/main/res/values/strings.xml' 257s .DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml' 257s DEBUG:root:..got package=org.fdroid.fdroid, version=0.94-test, vercode=940 257s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle' 257s DEBUG:root:..got package=org.fdroid.fdroid, version=None, vercode=None 257s .DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/AndroidManifest.xml' 257s DEBUG:root:..got package=None, version=0.94-test, vercode=940 257s DEBUG:root:Parsing manifest at 'source-files/fdroid/fdroidclient/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/eu.siacs.conversations/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.nextcloud.client/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.nextcloud.client/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/at.bitfire.davdroid/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.kunzisoft.testcase/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.github.jameshnsears.quoteunquote/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/com.jens.automation2/build.gradle' 257s DEBUG:root:Parsing manifest at 'source-files/de.varengold.activeTAN/build.gradle' 257s .....INFO:root:Getting source for revision master 257s INFO:root:Creating local.properties file at /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/source-files/fdroid/fdroidclient/local.properties 257s DEBUG:root:Removing debuggable flags from /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/source-files/fdroid/fdroidclient 257s INFO:root:Changing the version name 257s INFO:root:Changing the version code 257s .DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 258s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 258s DEBUG:root:> git rev-parse --show-toplevel 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git checkout -f 0.3 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git clean -dffx 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git rev-parse --show-toplevel 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git submodule foreach --recursive git reset --hard 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git reset --hard 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git submodule foreach --recursive git clean -dffx 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git clean -dffx 259s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 259s DEBUG:root:> git checkout -f 0.3 260s DEBUG:root:Directory: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/build/org.fdroid.ci.test.app 260s DEBUG:root:> git clean -dffx 260s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 260s INFO:root:Getting source for revision master 260s INFO:root:Collecting source libraries 260s DEBUG:root:Removing debuggable flags from /tmp/tmpgyjtnfpa/build/srclib/FakeSrcLib 260s INFO:root:Creating local.properties file at /tmp/tmpgyjtnfpa/build/com.example/local.properties 260s INFO:root:Creating local.properties file at /tmp/tmpgyjtnfpa/build/com.example/baz/local.properties 260s INFO:root:Creating local.properties file at /tmp/tmpgyjtnfpa/build/com.example/baz/bar/local.properties 260s DEBUG:root:Removing debuggable flags from /tmp/tmpgyjtnfpa/build/com.example/baz/bar 260s INFO:root:Running 'prebuild' commands in /tmp/tmpgyjtnfpa/build/com.example/baz/bar 260s DEBUG:root:Directory: /tmp/tmpgyjtnfpa/build/com.example/baz/bar 260s DEBUG:root:> bash -e -u -o pipefail -x -c -- test -d /tmp/tmpgyjtnfpa/build/srclib/FakeSrcLib/testdirshouldexist 260s ..INFO:root:Cleaned build.gradle of keysigning configs at source-files/com.seafile.seadroid2/app/build.gradle 260s INFO:root:Cleaned build.gradle of keysigning configs at source-files/eu.siacs.conversations/build.gradle 260s INFO:root:Cleaned build.gradle of keysigning configs at source-files/open-keychain/open-keychain/OpenKeychain/build.gradle 260s INFO:root:Cleaned build.gradle.kts of keysigning configs at source-files/org.tasks/app/build.gradle.kts 260s INFO:root:Cleaned build.gradle of keysigning configs at source-files/osmandapp/osmand/build.gradle 260s INFO:root:Cleaned build.gradle of keysigning configs at source-files/ut.ewh.audiometrytest/app/build.gradle 260s .s..DEBUG:root:skip deploying full build logs: not enabled in config 260s .DEBUG:root:skip deploying full build logs: not enabled in config 260s DEBUG:root:skip deploying full build logs: not enabled in config 260s .DEBUG:root:Getting srclib vcs interface for TransportsRennes 260s .WARNING:root:config.py is deprecated, use config.yml 260s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 260s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 260s DOES NOT VERIFY 260s ERROR: Missing META-INF/MANIFEST.MF 260s ERROR:root: 260s /tmp/tmp5881mx15/urzip-release-unsigned.apk: 260s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp5881mx15/urzip-release-unsigned.apk --out /tmp/tmp5881mx15/urzip-release.apk 261s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp5881mx15/duplicate.permisssions_9999999-unsigned.apk --out /tmp/tmp5881mx15/duplicate.permisssions_9999999.apk 263s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 263s INFO:androguard.apk:APK file was successfully validated! 263s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 263s DOES NOT VERIFY 263s ERROR: No JAR signatures 263s ERROR:root: 263s /tmp/tmp5881mx15/minimal_targetsdk_30_unsigned.apk: 263s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp5881mx15/minimal_targetsdk_30_unsigned.apk --out /tmp/tmp5881mx15/minimal_targetsdk_30.apk 264s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 264s INFO:androguard.apk:APK file was successfully validated! 264s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 264s WARNING:androguard.core.api_specific_resources:Requested API level 30 is larger than maximum we have, returning API level 28 instead. 264s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 264s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp5881mx15/no_targetsdk_minsdk30_unsigned.apk --out /tmp/tmp5881mx15/no_targetsdk_minsdk30_signed.apk 265s INFO:androguard.apk:Starting analysis on AndroidManifest.xml 265s INFO:androguard.apk:APK file was successfully validated! 265s DEBUG:androguard.core.api_specific_resources:Available API levels: 4, 5, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 21, 22, 23, 24, 25, 26, 27, 28 266s DOES NOT VERIFY 266s ERROR: No JAR signatures 266s ERROR:root: 266s /tmp/tmp5881mx15/no_targetsdk_minsdk1_unsigned.apk: 266s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmp5881mx15/no_targetsdk_minsdk1_unsigned.apk --out /tmp/tmp5881mx15/no_targetsdk_minsdk1_signed.apk 267s .WARNING:root:config.py is deprecated, use config.yml 267s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 267s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 267s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpu1mcydiy/urzip-release-unsigned.apk --out /tmp/tmpu1mcydiy/urzip-release.apk 267s .WARNING:root:config.py is deprecated, use config.yml 267s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 267s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 267s DEBUG:root:> /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias sova --in /tmp/tmpiinxyq5x/urzip-release-unsigned.apk --out /tmp/tmpiinxyq5x/urzip-release.apk 267s .WARNING:root:config.py is deprecated, use config.yml 267s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 267s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 267s DEBUG:root:> /usr/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_signjaru_cg5pft/testy.jar sova -keypass:env FDROID_KEY_PASS 268s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex/testy.jar'> 268s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 268s ResourceWarning: Enable tracemalloc to get the object allocation traceback 268s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_signjaru_cg5pft/testy.jar'> 268s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 268s ResourceWarning: Enable tracemalloc to get the object allocation traceback 268s DEBUG:root:> /usr/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_signjaru_cg5pft/guardianproject.jar sova -keypass:env FDROID_KEY_PASS 269s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex/guardianproject.jar'> 269s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 269s ResourceWarning: Enable tracemalloc to get the object allocation traceback 269s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/common.TestCase:487: ResourceWarning: unclosed file <_io.BufferedReader name='/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_signjaru_cg5pft/guardianproject.jar'> 269s open(sourcefile, 'rb').read(), open(testfile, 'rb').read() 269s ResourceWarning: Enable tracemalloc to get the object allocation traceback 269s ...DEBUG:root:Directory: /tmp/tmpc9hklthr 269s DEBUG:root:> git rev-parse --show-toplevel 269s DEBUG:root:Directory: /tmp/tmpc9hklthr 269s DEBUG:root:> git rev-parse --show-toplevel 270s .DEBUG:root:Directory: /tmp/tmp8qt6igt2 270s DEBUG:root:> git rev-parse --show-toplevel 270s .WARNING:root:config.py is deprecated, use config.yml 270s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 270s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 272s DOES NOT VERIFY 272s ERROR: JAR signer CERT.RSA: JAR signature META-INF/CERT.RSA did not verify against META-INF/CERT.SF 272s ERROR:root: 272s urzip-badcert.apk: 273s DOES NOT VERIFY 273s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 273s ERROR:root: 273s urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 273s 273s DOES NOT VERIFY 273s ERROR: Missing META-INF/MANIFEST.MF 273s ERROR:root: 273s urzip-release-unsigned.apk: 273s .WARNING:root:config.py is deprecated, use config.yml 273s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 273s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 274s INFO:root:...successfully verified 275s INFO:root:...successfully verified 275s /usr/lib/python3.12/zipfile/__init__.py:1598: UserWarning: Duplicate name: 'META-INF/MANIFEST.MF' 275s return self._open_to_write(zinfo, force_zip64=force_zip64) 275s /usr/lib/python3.12/zipfile/__init__.py:1598: UserWarning: Duplicate name: 'META-INF/CERT.SF' 275s return self._open_to_write(zinfo, force_zip64=force_zip64) 275s /usr/lib/python3.12/zipfile/__init__.py:1598: UserWarning: Duplicate name: 'META-INF/CERT.RSA' 275s return self._open_to_write(zinfo, force_zip64=force_zip64) 275s DOES NOT VERIFY 275s ERROR: Duplicate entry: META-INF/MANIFEST.MF 275s ERROR: Duplicate entry: META-INF/CERT.SF 275s ERROR: Duplicate entry: META-INF/CERT.RSA 275s ERROR:root: 275s /tmp/tmp4ti5gplc/urzip-twosig.apk: 276s INFO:root:...successfully verified 276s .WARNING:root:config.py is deprecated, use config.yml 276s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 276s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 276s DEBUG:root:JAR signature verified: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex/testy.jar 277s DEBUG:root:JAR signature verified: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex/guardianproject.jar 277s .WARNING:root:config.py is deprecated, use config.yml 277s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 277s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 277s DEBUG:root:> /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 279s DEBUG:root:JAR signature verified: repo/entry.jar 279s .WARNING:root:config.py is deprecated, use config.yml 279s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 279s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 280s .WARNING:root:config.py is deprecated, use config.yml 280s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 280s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 281s DEBUG:root:JAR signature verified: bad-unicode-πÇÇ现代通用字-български-عربي1.apk 282s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_1.apk 282s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_2.apk 283s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_3.apk 284s DEBUG:root:JAR signature verified: org.bitbucket.tickytacky.mirrormirror_4.apk 284s DEBUG:root:JAR signature verified: org.dyndns.fules.ck_20.apk 285s DEBUG:root:JAR signature verified: urzip.apk 286s DEBUG:root:JAR signature verified: urzip-release.apk 287s ..ERROR:root:Conflicting config files! Using config.yml, ignoring config.py! 287s DEBUG:root:Reading 'config.yml' 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .WARNING:root:config.py is deprecated, use config.yml 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .DEBUG:root:Reading 'config.yml' 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .DEBUG:root:Reading 'config.yml' 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .DEBUG:root:Reading 'config.yml' 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .DEBUG:root:Reading 'config.yml' 287s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)! 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s .DEBUG:root:Reading 'config.yml' 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s ..WARNING:root:config.py is deprecated, use config.yml 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s WARNING:root:config.py is deprecated, use config.yml 287s WARNING:root:unsafe permissions on 'config.py' (should be 0600)! 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s ..apksigner: yml 287s 287s keypass: mysecretpassword 287s 287s 287s DEBUG:root:Reading 'config.yml' 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s DEBUG:root:Reading 'config.yml' 287s WARNING:root:unsafe permissions on 'config.yml' (should be 0600)! 287s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 287s . 287s ---------------------------------------------------------------------- 287s Ran 107 tests in 30.517s 287s 287s OK (skipped=4) 287s + for testcase in $WORKSPACE/tests/*.TestCase 287s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/deploy.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 287s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/deploy.TestCase 287s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/deploy.TestCase:238: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 287s newSuite.addTest(unittest.makeSuite(DeployTest)) 287s .INFO:root:rsyncing repo to example.com:/var/www/fdroid 287s .INFO:root:rsyncing archive to example.com:/var/www/fdroid 287s .s 287s ---------------------------------------------------------------------- 287s Ran 4 tests in 0.003s 287s 287s OK (skipped=1) 287s + for testcase in $WORKSPACE/tests/*.TestCase 287s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/exception.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 287s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/exception.TestCase 288s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 288s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/exception.TestCase:72: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 288s newSuite.addTest(unittest.makeSuite(ExceptionTest)) 288s . 288s ---------------------------------------------------------------------- 288s Ran 1 test in 0.000s 288s 288s OK 288s + for testcase in $WORKSPACE/tests/*.TestCase 288s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/import_subcommand.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 288s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/import_subcommand.TestCase 288s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/import_subcommand.TestCase:138: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 288s newSuite.addTest(unittest.makeSuite(ImportTest)) 288s .INFO:root:tmp/importer 288s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/gradle/build_libraries.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/push/build.gradle' 288s DEBUG:root:..got package=None, version=1.0, vercode=1 288s DEBUG:root:Parsing manifest at 'tmp/importer/mars-core-release/build.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/avenginekit/build.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/emojilibrary/build.gradle' 288s DEBUG:root:..got package=None, version=1.0, vercode=1 288s DEBUG:root:Parsing manifest at 'tmp/importer/imagepicker/build.gradle' 288s DEBUG:root:..got package=None, version=1.0, vercode=1 288s DEBUG:root:Parsing manifest at 'tmp/importer/chat/build.gradle' 288s INFO:root:tmp/importer 288s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/app/build.gradle' 288s DEBUG:root:..got package=com.anpmech.launcher, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/app/src/main/AndroidManifest.xml' 288s DEBUG:root:..got package=com.anpmech.launcher, version=None, vercode=None 288s INFO:root:tmp/importer 288s DEBUG:root:Parsing manifest at 'tmp/importer/build.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/settings.gradle' 288s DEBUG:root:..got package=None, version=None, vercode=None 288s DEBUG:root:Parsing manifest at 'tmp/importer/app/build.gradle' 288s DEBUG:root:..got package=None, version=1.65, vercode=14 288s DEBUG:root:Parsing manifest at 'tmp/importer/app/src/main/AndroidManifest.xml' 288s DEBUG:root:..got package=ut.ewh.audiometrytest, version=1.0, vercode=1 288s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 288s DEBUG:urllib3.connectionpool:Starting new HTTPS connection (1): gitlab.com:443 289s DEBUG:urllib3.connectionpool:https://gitlab.com:443 "HEAD /fdroid/ci-test-app HTTP/1.1" 200 0 289s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git tmp/importer 289s Cloning into 'tmp/importer'... 290s DEBUG:root:Directory: tmp/importer 290s DEBUG:root:> git rev-parse --show-toplevel 290s DEBUG:root:Directory: tmp/importer 290s DEBUG:root:> git checkout -f origin/HEAD 291s DEBUG:root:Directory: tmp/importer 291s DEBUG:root:> git clean -dffx 291s . 291s ---------------------------------------------------------------------- 291s Ran 3 tests in 2.558s 291s 291s OK 291s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 291s + for testcase in $WORKSPACE/tests/*.TestCase 291s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/index.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 291s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/index.TestCase 291s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/index.TestCase:670: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 291s newSuite.addTest(unittest.makeSuite(IndexTest)) 306s ........................ 306s ---------------------------------------------------------------------- 306s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 306s WARNING: skipping rest of test since html5print is missing! 306s Ran 24 tests in 15.037s 306s 306s OK 306s + for testcase in $WORKSPACE/tests/*.TestCase 306s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/init.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 306s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/init.TestCase 307s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/init.TestCase:89: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 307s newSuite.addTest(unittest.makeSuite(InitTest)) 307s DEBUG:root:Reading 'config.yml' 307s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Reading 'config.yml' 307s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Reading 'config.yml' 307s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s WARNING:root: 307s Using existing keystore "/tmp/tmpi028apx8/keystore.jks" 307s Now set these in config.yml: keystorepass, keypass, keydname 307s 307s INFO:root: 307s Built repo based in "/tmp/tmpi028apx8" with this config: 307s 307s Android SDK: /usr/lib/android-sdk 307s Keystore for signing key: /tmp/tmpi028apx8/keystore.jks 307s Alias for key in store: sova 307s 307s To complete the setup, add your APKs to "/tmp/tmpi028apx8/repo" 307s then run "fdroid update -c; fdroid update". You might also want to edit 307s "config.yml" to set the URL, repo name, and more. You should also set up 307s a signing key (a temporary one might have been automatically generated). 307s 307s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 307s and https://f-droid.org/docs/Signing_Process 307s . 307s ---------------------------------------------------------------------- 307s Ran 2 tests in 0.018s 307s 307s OK 307s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 307s + for testcase in $WORKSPACE/tests/*.TestCase 307s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 307s + echo 'skipping install.TestCase, its too troublesome in CI builds' 307s + continue 307s + for testcase in $WORKSPACE/tests/*.TestCase 307s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/lint.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 307s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/lint.TestCase 307s skipping install.TestCase, its too troublesome in CI builds 307s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/lint.TestCase:345: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 307s newSuite.addTest(unittest.makeSuite(LintTest)) 307s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:fake.app: AntiFeatures must be a 'list', but it is a 'str!' 307s DEBUG:root:fake.app: AntiFeatures must be a 'list', but it is a 'str!' 307s DEBUG:root:fake.app: Categories must be a 'list', but it is a 'str!' 307s DEBUG:root:fake.app: Categories must be a 'list', but it is a 'str!' 307s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'list'! 307s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'list'! 307s DEBUG:root:fake.app: WebSite must be a 'str', but it is a 'int'! 307s ..DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Unexpected license tag "Adobe-2006"! Only use FSF or OSI approved tags from https://spdx.org/license-list 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Unexpected license tag "Apache-2.0"! Only use license tags configured in your config file 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Unexpected license tag "Apache-2.0"! Only use license tags configured in your config file 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Invalid VercodeOperation: ['o', 'p', 'e', 'n', '(', '"', '/', 'e', 't', 'c', '/', 'p', 'a', 's', 's', 'w', 'd', '"', ')'] 307s DEBUG:root:Invalid VercodeOperation: ['%', 'C', ' ', '+', ' ', '1'] 307s DEBUG:root:Invalid VercodeOperation: ['%', '%', 'c', ' ', '*', ' ', '1', '2', '3'] 307s DEBUG:root:Invalid VercodeOperation: ['1', '2', '3', ' ', '+', ' ', '%', '%'] 307s DEBUG:root:Invalid VercodeOperation: ['%', 'c', ' ', '%', ' ', '7'] 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:Description at line 'This way: ': Forbidden HTML tags 307s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 307s DEBUG:root:bad urls: 307s DEBUG:root:SourceCode 'github.com/my/proj': URL must start with https:// or http:// 307s DEBUG:root:SourceCode 'http://github.com/not/secure': github.com URLs should always use https:// 307s DEBUG:root:SourceCode 'https://github.com/foo/bar.git': Appending .git is not necessary 307s DEBUG:root:SourceCode 'https://gitlab.com/group/subgroup/project.git': Appending .git is not necessary 307s DEBUG:root:SourceCode 'https://raw.githubusercontent.com/Seva-coder/Finder/master/ChangeLog.txt': Use /HEAD instead of /master to point at a file in the default branch 307s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 307s "metadata/apk/" has no matching metadata file! 307s "metadata/dump/" has no matching metadata file! 307s "metadata/org.adaway.json" is not a supported file format (use: metadata/*.yml) 307s DEBUG:root:SourceCode 'https://github.com/scoutant/blokish/blob/master/README.md#changelog': Use /HEAD instead of /master to point at a file in the default branch 307s DEBUG:root:SourceCode 'http://htmlpreview.github.io/?https://github.com/my/project/blob/HEAD/index.html': github.io URLs should always use https:// 307s DEBUG:root:SourceCode 'http://fdroid.gitlab.io/fdroid-website': gitlab.io URLs should always use https:// 307s . 307s ---------------------------------------------------------------------- 307s Ran 11 tests in 0.019s 307s 307s OK 307s + for testcase in $WORKSPACE/tests/*.TestCase 307s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/main.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 307s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/main.TestCase 307s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/main.TestCase:280: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 307s newSuite.addTest(unittest.makeSuite(MainTest)) 307s ....2024-03-07 19:57:14,864 CRITICAL: Unknown exception found! 307s ....2024-03-07 19:57:14,906 CRITICAL: no APK supplied 307s ......localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 307s all good 307s all good 307s 307s ---------------------------------------------------------------------- 307s Ran 14 tests in 0.109s 307s 307s OK 308s + for testcase in $WORKSPACE/tests/*.TestCase 308s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 308s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata.TestCase 308s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata.TestCase:1157: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 308s newSuite.addTest(unittest.makeSuite(MetadataTest)) 308s ..........WARNING:root:Ignoring 'Provides' in 'mock_filename.yaml' metadata because it is deprecated. 308s ........DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 308s ............... 308s ---------------------------------------------------------------------- 308s Ran 33 tests in 0.422s 308s 308s OK 308s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 308s + for testcase in $WORKSPACE/tests/*.TestCase 308s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/nightly.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 308s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/nightly.TestCase 309s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/nightly.TestCase:376: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 309s newSuite.addTest(unittest.makeSuite(NightlyTest)) 310s ..WARNING:root:overwriting existing /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore 310s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/nightly.py:314: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 310s date=datetime.datetime.utcnow().strftime('%Y-%m-%d %H:%M:%S UTC')) 310s sending incremental file list 310s ./ 310s 310s sent 46 bytes received 19 bytes 130.00 bytes/sec 310s total size is 0 speedup is 0.00 310s Importing keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore to /tmp/.ybx6livs/.keystore.p12... 311s 311s Warning: 311s uses the SHA1withRSA signature algorithm which is considered a security risk. 311s uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 311s writing RSA key 312s 2024-03-07 19:57:19,270 DEBUG: Reading 'config.yml' 312s 2024-03-07 19:57:19,275 DEBUG: ipfs_cid not found, skipping CIDv1 generation 312s 2024-03-07 19:57:19,276 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 312s 2024-03-07 19:57:19,276 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 312s 2024-03-07 19:57:19,277 DEBUG: Processing urzip-debug.apk 312s 2024-03-07 19:57:19,360 INFO: Starting analysis on AndroidManifest.xml 312s 2024-03-07 19:57:19,369 INFO: APK file was successfully validated! 312s 2024-03-07 19:57:19,371 DEBUG: Getting signature of urzip-debug.apk 312s 2024-03-07 19:57:19,379 WARNING: repo/urzip-debug.apk is set to android:debuggable="true" 312s 2024-03-07 19:57:19,751 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 312s Verified using v1 scheme (JAR signing): true 312s Verified using v2 scheme (APK Signature Scheme v2): true 312s Verified using v3 scheme (APK Signature Scheme v3): true 312s Verified using v4 scheme (APK Signature Scheme v4): false 312s Verified for SourceStamp: false 312s Number of signers: 1 312s 312s 2024-03-07 19:57:19,755 DEBUG: Density 120 not available, resizing down from 160 312s 2024-03-07 19:57:19,757 INFO: Generated skeleton metadata for info.guardianproject.urzip 312s 2024-03-07 19:57:19,760 DEBUG: Checking archiving for info.guardianproject.urzip - apks:1, keepversions:20, archapks:0 312s 2024-03-07 19:57:19,760 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 313s 313s Warning: 313s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 313s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 313s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -deststoretype pkcs12". 313s 2024-03-07 19:57:20,468 INFO: Creating signed index with this key (SHA256): 313s 2024-03-07 19:57:20,468 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 313s 2024-03-07 19:57:20,468 DEBUG: Directory: archive 313s 2024-03-07 19:57:20,468 DEBUG: > jar cf index.jar index.xml 313s 2024-03-07 19:57:20,771 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 314s jar signed. 314s 314s Warning: 314s The signer's certificate is self-signed. 314s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 314s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 314s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 314s 2024-03-07 19:57:21,576 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 314s 2024-03-07 19:57:21,587 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 315s jar signed. 315s 315s Warning: 315s The signer's certificate is self-signed. 315s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 315s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 315s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 315s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 315s 2024-03-07 19:57:22,394 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS archive/entry.jar 315s 2024-03-07 19:57:22,799 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 316s 316s Warning: 316s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 316s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 316s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -deststoretype pkcs12". 316s 2024-03-07 19:57:23,521 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 317s 317s Warning: 317s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 317s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 317s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -deststoretype pkcs12". 317s 2024-03-07 19:57:24,230 INFO: Creating signed index with this key (SHA256): 317s 2024-03-07 19:57:24,230 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 317s 2024-03-07 19:57:24,230 DEBUG: Directory: repo 317s 2024-03-07 19:57:24,230 DEBUG: > jar cf index.jar index.xml 317s 2024-03-07 19:57:24,435 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 318s jar signed. 318s 318s Warning: 318s The signer's certificate is self-signed. 318s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 318s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 318s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 318s 2024-03-07 19:57:25,249 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 318s 2024-03-07 19:57:25,259 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 318s jar signed. 318s 318s Warning: 318s The signer's certificate is self-signed. 318s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 318s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 318s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 318s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 319s 2024-03-07 19:57:26,070 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS repo/entry.jar 319s 2024-03-07 19:57:26,473 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 320s 320s Warning: 320s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 320s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 320s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/home/.android/debug.keystore -deststoretype pkcs12". 320s 2024-03-07 19:57:27,196 DEBUG: Outputting JSON 320s 2024-03-07 19:57:27,197 DEBUG: skip deploying full build logs: not enabled in config 320s 2024-03-07 19:57:27,197 DEBUG: skip deploying full build logs: not enabled in config 320s 2024-03-07 19:57:27,197 DEBUG: skip deploying full build logs: not enabled in config 320s 2024-03-07 19:57:27,198 INFO: Finished 320s sending incremental file list 320s created directory /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/fdroid/git-mirror/fdroid/metadata 320s ./ 320s info.guardianproject.urzip.yml 320s 320s sent 418 bytes received 190 bytes 1,216.00 bytes/sec 320s total size is 268 speedup is 0.44 320s sending incremental file list 320s created directory /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_github_actions_79xvqkte1709841437.4220214/fdroid/git-mirror/fdroid/stats 320s ./ 320s known_apks.txt 320s 320s sent 205 bytes received 187 bytes 784.00 bytes/sec 320s total size is 73 speedup is 0.19 320s .WARNING:root:overwriting existing /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore 320s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/nightly.py:314: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 320s date=datetime.datetime.utcnow().strftime('%Y-%m-%d %H:%M:%S UTC')) 320s sending incremental file list 320s ./ 320s 320s sent 42 bytes received 19 bytes 122.00 bytes/sec 320s total size is 0 speedup is 0.00 320s Importing keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore to /tmp/.sf7rhsrt/.keystore.p12... 321s 321s Warning: 321s uses the SHA1withRSA signature algorithm which is considered a security risk. 321s uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 321s writing RSA key 322s 2024-03-07 19:57:29,279 DEBUG: Reading 'config.yml' 322s 2024-03-07 19:57:29,284 DEBUG: ipfs_cid not found, skipping CIDv1 generation 322s 2024-03-07 19:57:29,285 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 322s 2024-03-07 19:57:29,285 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 322s 2024-03-07 19:57:29,286 DEBUG: Processing urzip-debug.apk 322s 2024-03-07 19:57:29,372 INFO: Starting analysis on AndroidManifest.xml 322s 2024-03-07 19:57:29,382 INFO: APK file was successfully validated! 322s 2024-03-07 19:57:29,384 DEBUG: Getting signature of urzip-debug.apk 322s 2024-03-07 19:57:29,391 WARNING: repo/urzip-debug.apk is set to android:debuggable="true" 322s 2024-03-07 19:57:29,737 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 322s Verified using v1 scheme (JAR signing): true 322s Verified using v2 scheme (APK Signature Scheme v2): true 322s Verified using v3 scheme (APK Signature Scheme v3): true 322s Verified using v4 scheme (APK Signature Scheme v4): false 322s Verified for SourceStamp: false 322s Number of signers: 1 322s 322s 2024-03-07 19:57:29,741 DEBUG: Density 120 not available, resizing down from 160 322s 2024-03-07 19:57:29,744 INFO: Generated skeleton metadata for info.guardianproject.urzip 322s 2024-03-07 19:57:29,746 DEBUG: Checking archiving for info.guardianproject.urzip - apks:1, keepversions:20, archapks:0 322s 2024-03-07 19:57:29,746 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 323s 323s Warning: 323s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 323s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 323s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -deststoretype pkcs12". 323s 2024-03-07 19:57:30,455 INFO: Creating signed index with this key (SHA256): 323s 2024-03-07 19:57:30,455 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 323s 2024-03-07 19:57:30,455 DEBUG: Directory: archive 323s 2024-03-07 19:57:30,455 DEBUG: > jar cf index.jar index.xml 323s 2024-03-07 19:57:30,759 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 324s jar signed. 324s 324s Warning: 324s The signer's certificate is self-signed. 324s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 324s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 324s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 324s 2024-03-07 19:57:31,571 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 324s 2024-03-07 19:57:31,582 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA archive/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 325s jar signed. 325s 325s Warning: 325s The signer's certificate is self-signed. 325s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 325s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 325s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 325s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 325s 2024-03-07 19:57:32,391 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS archive/entry.jar 325s 2024-03-07 19:57:32,800 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 326s 326s Warning: 326s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 326s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 326s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -deststoretype pkcs12". 326s 2024-03-07 19:57:33,525 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 327s 327s Warning: 327s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 327s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 327s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -deststoretype pkcs12". 327s 2024-03-07 19:57:34,230 INFO: Creating signed index with this key (SHA256): 327s 2024-03-07 19:57:34,230 INFO: 7E AB D8 C1 5D E8 83 D1 E8 2B 5D F2 FD 4F 7F 76 9E 49 80 78 E9 AD 6D C9 01 F0 E9 6D B7 7C EA C3 327s 2024-03-07 19:57:34,230 DEBUG: Directory: repo 327s 2024-03-07 19:57:34,230 DEBUG: > jar cf index.jar index.xml 327s 2024-03-07 19:57:34,435 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar androiddebugkey -keypass:env FDROID_KEY_PASS 328s jar signed. 328s 328s Warning: 328s The signer's certificate is self-signed. 328s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 328s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 328s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 328s 2024-03-07 19:57:35,248 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 328s 2024-03-07 19:57:35,258 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar androiddebugkey -keypass:env FDROID_KEY_PASS 328s jar signed. 328s 328s Warning: 328s The signer's certificate is self-signed. 328s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 328s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 328s The RSA signing key has a keysize of 1024 which is considered a security risk. This key size will be disabled in a future update. 328s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 329s 2024-03-07 19:57:36,066 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias androiddebugkey --key-pass env:FDROID_KEY_PASS repo/entry.jar 329s 2024-03-07 19:57:36,472 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias androiddebugkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -storepass:env FDROID_KEY_STORE_PASS 330s 330s Warning: 330s The certificate uses the SHA1withRSA signature algorithm which is considered a security risk. 330s The certificate uses a 1024-bit RSA key which is considered a security risk. This key size will be disabled in a future update. 330s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/home/.android/debug.keystore -deststoretype pkcs12". 330s 2024-03-07 19:57:37,192 DEBUG: Outputting JSON 330s 2024-03-07 19:57:37,193 DEBUG: skip deploying full build logs: not enabled in config 330s 2024-03-07 19:57:37,193 DEBUG: skip deploying full build logs: not enabled in config 330s 2024-03-07 19:57:37,194 DEBUG: skip deploying full build logs: not enabled in config 330s 2024-03-07 19:57:37,194 INFO: Finished 330s sending incremental file list 330s created directory /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/fdroid/git-mirror/fdroid/metadata 330s ./ 330s info.guardianproject.urzip.yml 330s 330s sent 413 bytes received 185 bytes 1,196.00 bytes/sec 330s total size is 263 speedup is 0.44 330s sending incremental file list 330s created directory /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_gitlab_ci_mgw4yxmi1709841447.3988075/fdroid/git-mirror/fdroid/stats 330s ./ 330s known_apks.txt 330s 330s sent 205 bytes received 182 bytes 774.00 bytes/sec 330s total size is 73 speedup is 0.19 330s .ERROR:root:/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_main_empty_dot_android_uq9hta461709841457.4010813/home/.android/debug.keystore does not exist! Create it by running: 330s keytool -genkey -v -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_main_empty_dot_android_uq9hta461709841457.4010813/home/.android/debug.keystore -storepass android \ 330s -alias androiddebugkey -keypass android -keyalg RSA -keysize 2048 -validity 10000 \ 330s -dname "CN=Android Debug,O=Android,C=US" 330s .Importing keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_main_empty_dot_ssh_b585458s1709841457.402547/home/.android/debug.keystore to /tmp/.ps6ocouj/.keystore.p12... 331s 331s Warning: 331s uses the SHA1withRSA signature algorithm which is considered a security risk. 331s writing RSA key 331s .Importing keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/test_main_on_user_machine_8bszm3d81709841458.5055957/home/.android/debug.keystore to /tmp/.i17_lmv3/.keystore.p12... 332s 332s Warning: 332s uses the SHA1withRSA signature algorithm which is considered a security risk. 332s writing RSA key 332s ..Importing keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/aosp_testkey_debug.keystore to /tmp/.to2fgbtm/.keystore.p12... 333s 333s Warning: 333s uses the SHA1withRSA signature algorithm which is considered a security risk. 333s writing RSA key 333s . 333s ---------------------------------------------------------------------- 333s Ran 9 tests in 24.572s 333s 333s OK 333s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 333s WARNING: only public git repos are supported! 333s + for testcase in $WORKSPACE/tests/*.TestCase 333s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/publish.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 333s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/publish.TestCase 334s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/publish.TestCase:342: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 334s newSuite.addTest(unittest.makeSuite(PublishTest)) 334s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 334s ERROR:root:There is a keyalias collision - publishing halted 334s .s.DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 334s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS 335s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 335s INFO:root:Creating log directory 335s INFO:root:Creating temporary directory 335s INFO:root:1 app, 1 key aliases 335s INFO:root:Processing unsigned/com.politedroid_6.apk 335s DEBUG:root:unsigned/binaries/com.politedroid_6.binary.apk: Verifies 335s Verified using v1 scheme (JAR signing): true 335s Verified using v2 scheme (APK Signature Scheme v2): false 335s Verified using v3 scheme (APK Signature Scheme v3): false 335s Verified using v4 scheme (APK Signature Scheme v4): false 335s Verified for SourceStamp: false 335s Number of signers: 1 335s 335s DEBUG:root:tmp/sigcp_com.politedroid_6.apk: Verifies 335s Verified using v1 scheme (JAR signing): true 335s Verified using v2 scheme (APK Signature Scheme v2): false 335s Verified using v3 scheme (APK Signature Scheme v3): false 335s Verified using v4 scheme (APK Signature Scheme v4): false 335s Verified for SourceStamp: false 335s Number of signers: 1 335s 335s INFO:root:...successfully verified 335s DEBUG:root:...no source tarball for com.politedroid_6.apk 335s INFO:root:Published com.politedroid_6.apk 335s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 336s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS 337s jar signed. 337s 337s Warning: 337s The signer's certificate is self-signed. 337s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 337s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 337s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 337s DEBUG:root:Outputting JSON 337s DEBUG:root:skip deploying full build logs: not enabled in config 337s DEBUG:root:skip deploying full build logs: not enabled in config 337s DEBUG:root:skip deploying full build logs: not enabled in config 337s INFO:root:published list signing-key fingerprints 337s .INFO:root:Creating log directory 337s INFO:root:Creating temporary directory 337s INFO:root:Creating output directory 337s INFO:root:1 app, 1 key aliases 337s INFO:root:Processing unsigned/org.fdroid.ci_1.apk 337s INFO:root:Key alias: 59d3c650 337s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -alias 59d3c650 -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 337s keytool error: java.lang.Exception: Alias <59d3c650> does not exist 338s INFO:root:Key does not exist - generating... 338s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -genkey -keystore keystore.jks -alias 59d3c650 -keyalg RSA -keysize 2048 -validity 10000 -storepass:env FDROID_KEY_STORE_PASS -dname CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US -keypass:env FDROID_KEY_PASS 339s Generating 2,048 bit RSA key pair and self-signed certificate (SHA384withRSA) with a validity of 10,000 days 339s for: CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, ST=California, C=US 339s 339s Warning: 339s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore keystore.jks -destkeystore keystore.jks -deststoretype pkcs12". 339s DEBUG:root:> /usr/bin/apksigner sign --ks keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias 59d3c650 --in unsigned/org.fdroid.ci_1.apk --out repo/org.fdroid.ci_1.apk 340s DEBUG:root:...no source tarball for org.fdroid.ci_1.apk 340s INFO:root:Published org.fdroid.ci_1.apk 340s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 341s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS 342s jar signed. 342s 342s Warning: 342s The signer's certificate is self-signed. 342s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 342s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 342s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 342s DEBUG:root:Outputting JSON 342s DEBUG:root:skip deploying full build logs: not enabled in config 342s DEBUG:root:skip deploying full build logs: not enabled in config 342s DEBUG:root:skip deploying full build logs: not enabled in config 342s INFO:root:published list signing-key fingerprints 342s DEBUG:root:repo/org.fdroid.ci_1.apk: Verifies 342s Verified using v1 scheme (JAR signing): true 342s Verified using v2 scheme (APK Signature Scheme v2): true 342s Verified using v3 scheme (APK Signature Scheme v3): true 342s Verified using v4 scheme (APK Signature Scheme v4): false 342s Verified for SourceStamp: false 342s Number of signers: 1 342s 342s DEBUG:root:signature okay: repo/org.fdroid.ci_1.apk 342s DEBUG:androguard.axml:AXML contains a RESOURCE MAP 342s DEBUG:androguard.axml:Start of Namespace mapping: prefix 8: 'android' --> uri 10: 'http://schemas.android.com/apk/res/android' 342s INFO:root:Fetched signatures for 'repo/org.fdroid.ci_1.apk' -> 'metadata/org.fdroid.ci/signatures/1' 342s INFO:root:1 app, 1 key aliases 342s INFO:root:Processing unsigned/org.fdroid.ci_1.apk 342s DEBUG:root:tmp/org.fdroid.ci_1_51cce33.apk: Verifies 342s Verified using v1 scheme (JAR signing): true 342s Verified using v2 scheme (APK Signature Scheme v2): true 342s Verified using v3 scheme (APK Signature Scheme v3): true 342s Verified using v4 scheme (APK Signature Scheme v4): false 342s Verified for SourceStamp: false 342s Number of signers: 1 342s 342s INFO:root:Key alias: 59d3c650 342s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -alias 59d3c650 -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 343s 59d3c650, Mar 7, 2024, PrivateKeyEntry, 343s Certificate fingerprint (SHA-256): 51:CC:E3:37:93:E8:F6:DD:32:9E:2A:00:0D:60:DB:F8:80:F1:49:46:78:0E:44:D5:47:6B:5C:93:AA:7E:1D:34 343s 343s Warning: 343s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore keystore.jks -destkeystore keystore.jks -deststoretype pkcs12". 343s DEBUG:root:> /usr/bin/apksigner sign --ks keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias 59d3c650 --in unsigned/org.fdroid.ci_1.apk --out repo/org.fdroid.ci_1.apk 344s DEBUG:root:...no source tarball for org.fdroid.ci_1.apk 344s INFO:root:Published org.fdroid.ci_1.apk 344s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS 345s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS 346s jar signed. 346s 346s Warning: 346s The signer's certificate is self-signed. 346s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 346s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 346s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 346s DEBUG:root:Outputting JSON 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s INFO:root:published list signing-key fingerprints 346s .DEBUG:root:Outputting JSON 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:Outputting JSON 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 346s DEBUG:root:Outputting JSON 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s DEBUG:root:skip deploying full build logs: not enabled in config 346s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 346s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS 347s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar repokey -keypass:env FDROID_KEY_PASS 347s jar signed. 347s 347s Warning: 347s The signer's certificate is self-signed. 347s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 347s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 347s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 348s DEBUG:root:JAR signature verified: stats/publishsigkeys.jar 348s WARNING:root:repo_key_sha256 not in config.yml, setting it to the signature key fingerprint of 'stats/publishsigkeys.jar' 348s .DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 348s DEBUG:root:> /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS 349s DEBUG:root:> /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/dummy-keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar repokey -keypass:env FDROID_KEY_PASS 350s jar signed. 350s 350s Warning: 350s The signer's certificate is self-signed. 350s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 350s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 350s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 350s DEBUG:root:JAR signature verified: stats/publishsigkeys.jar 350s . 350s ---------------------------------------------------------------------- 350s Ran 9 tests in 16.513s 350s 350s OK (skipped=1) 350s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 350s + for testcase in $WORKSPACE/tests/*.TestCase 350s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/rewritemeta.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 350s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/rewritemeta.TestCase 351s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/rewritemeta.TestCase:106: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 351s newSuite.addTest(unittest.makeSuite(RewriteMetaTest)) 351s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 351s INFO:root:Rewriting 'a' 351s INFO:root:Rewriting 'b' 351s DEBUG:root:Finished 351s .INFO:root:Rewriting 'a' 351s . 351s ---------------------------------------------------------------------- 351s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 351s Ran 2 tests in 0.011s 351s 351s OK 351s + for testcase in $WORKSPACE/tests/*.TestCase 351s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 351s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase 351s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase:780: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 351s unittest.makeSuite(ScannerTest), 351s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase:781: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 351s unittest.makeSuite(Test_scan_binary), 351s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase:782: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 351s unittest.makeSuite(Test_SignatureDataController), 351s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase:783: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 351s unittest.makeSuite(Test_main), 351s INFO:root:Getting source for revision 1.0 351s INFO:root:Creating local.properties file at /tmp/tmpfix046fd/local.properties 351s INFO:root:Scanning source for common problems... 351s INFO:root:Ignoring Android AAR library at foo.aar 351s INFO:root:Ignoring shared library at baz.so 351s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar 351s INFO:root:Successfully built version 1.0 of mocked.app.id from 1.0 358s ......INFO:root:Removing unknown maven repo 'https://maven.fabric.io/public' at build.gradle 358s INFO:root:Removing unknown maven repo 'https://evilcorp.com/maven' at build.gradle 358s .-rw-rw-r-- 1 ubuntu ubuntu 18 Mar 7 19:58 binary.out 358s -rwxr-xr-x 1 ubuntu ubuntu 18 Mar 7 19:58 fake.png 358s ERROR:root:Found binary at binary.out 358s WARNING:root:Found executable binary, possibly code at fake.png 358s ERROR:root:Found shared library at baz.so 358s ERROR:root:Found Java JAR file at arg.jar 358s INFO:root:Removing gradlew at gradlew 358s INFO:root:Removing gradlew.bat at gradlew.bat 358s ERROR:root:Found Android AAR library at sqlcipher.aar 358s ERROR:root:Found static library at static.a 358s INFO:root:Removing gradle-wrapper.jar at gradle-wrapper.jar 358s ERROR:root:Found Android DEX code at classes.dex 358s WARNING:root:Found Android DEX code at src/test/resources/classes.dex 358s .ERROR:root:Found usual suspect 'google.*play.*services' at app/build.gradle 358s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at build.gradle.kts 358s ERROR:root:Found usual suspect 'com\.mapbox(?!\.mapboxsdk:mapbox-sdk-services)' at app/build.gradle.kts 358s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at app/build.gradle 358s ERROR:root:Found usual suspect 'google.*play.*services' at app/build.gradle 358s ERROR:root:Found unknown maven repo 'http://developer.huawei.com/repo/' at build.gradle 358s ERROR:root:Found unknown maven repo 'https://dl.bintray.com/jenly/maven' at build.gradle 358s ERROR:root:Found usual suspect 'com.tencent.bugly' at chat/build.gradle 358s ERROR:root:Found usual suspect 'com.tencent.bugly' at chat/build.gradle 358s ERROR:root:Found usual suspect '["']com.facebook.android['":]' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'crashlytics' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'google.*play.*services' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at oneSheeld/build.gradle 358s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at oneSheeld/build.gradle 358s ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at oneSheeld/build.gradle 358s ERROR:root:Found usual suspect 'com(\.google)?\.firebase[.:](?!firebase-jobdispatcher|geofire-java)' at app/build.gradle 358s ERROR:root:Found unknown maven repo '../../m2/repository' at syncthing-silk/build.gradle 358s ERROR:root:Found unknown maven repo '$rootDir/../node_modules/react-native/android' at android/build.gradle 358s ERROR:root:Found unknown maven repo '$rootDir/../node_modules/jsc-android/dist' at android/build.gradle 358s ERROR:root:Found unknown maven repo '$projectDir/../../tests/react-test-app/node_modules/react-native/android' at react-native/android/build.gradle 358s .ERROR:root:Found unknown maven repo 'https://maven.fabric.io/public' at build.gradle 358s ERROR:root:Found unknown maven repo 'https://evilcorp.com/maven' at build.gradle 358s ..../tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase:536: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 358s sdc.data['last_updated'] = (datetime.utcnow() - timedelta(days=30)).timestamp() 358s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/scanner.py:118: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 358s return datetime.utcnow() 358s ..../tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/scanner.TestCase:528: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 358s sdc.data['last_updated'] = datetime.utcnow().timestamp() 358s ........INFO:root:Creating build directory 358s INFO:root:Finished 358s .INFO:root:Scanning APK with dexdump for known non-free classes. 359s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 359s .INFO:root:Scanning APK with dexdump for known non-free classes. 359s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/no_targetsdk_minsdk1_unsigned.apk 359s .INFO:root:Scanning APK with dexdump for known non-free classes. 359s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 359s basedir 359s 0 problems found 359s CRITICAL:root:Found 1 problems in /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 359s . 359s ---------------------------------------------------------------------- 359s Ran 29 tests in 8.033s 359s 359s OK 359s + for testcase in $WORKSPACE/tests/*.TestCase 359s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signatures.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 359s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signatures.TestCase 360s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signatures.TestCase:73: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 360s newSuite.addTest(unittest.makeSuite(SignaturesTest)) 360s WARNING:root:config.py is deprecated, use config.yml 360s DEBUG:root:ipfs_cid not found, skipping CIDv1 generation 360s DEBUG:root:/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk: Verifies 360s Verified using v1 scheme (JAR signing): true 360s Verified using v2 scheme (APK Signature Scheme v2): false 360s Verified using v3 scheme (APK Signature Scheme v3): false 360s Verified using v4 scheme (APK Signature Scheme v4): false 360s Verified for SourceStamp: false 360s Number of signers: 1 360s 360s DEBUG:root:signature okay: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 360s DEBUG:androguard.axml:AXML contains a RESOURCE MAP 360s DEBUG:androguard.axml:Start of Namespace mapping: prefix 6: 'android' --> uri 7: 'http://schemas.android.com/apk/res/android' 360s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 360s INFO:root:Fetched signatures for '/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk' -> 'metadata/com.politedroid/signatures/3' 360s . 360s ---------------------------------------------------------------------- 360s Ran 1 test in 0.409s 360s 360s OK 360s + for testcase in $WORKSPACE/tests/*.TestCase 360s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 360s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex.TestCase 361s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/signindex.TestCase:208: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 361s newSuite.addTest(unittest.makeSuite(SignindexTest)) 361s WARNING:root:config.py is deprecated, use config.yml 362s ....jar signed. 362s 362s Warning: 362s The signer's certificate is self-signed. 362s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 362s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 362s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 362s ...s 362s ---------------------------------------------------------------------- 362s Ran 8 tests in 1.623s 362s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 362s 362s OK (skipped=1) 362s + for testcase in $WORKSPACE/tests/*.TestCase 362s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/update.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 362s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/update.TestCase 363s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/update.TestCase:1773: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 363s newSuite.addTest(unittest.makeSuite(UpdateTest)) 363s ./usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:884: DeprecationWarning: This method is deprecated since 3.3.5. 363s warnings.warn("This method is deprecated since 3.3.5.", DeprecationWarning) 363s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/common.py:2447: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 363s default_date = datetime.utcnow() 365s WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 365s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 371s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 371s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 377s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 378s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 381s ..WARNING:root:repo/urzip.apk is set to android:debuggable="true" 382s INFO:root:Generated skeleton metadata for info.guardianproject.urzip 382s INFO:root:Generated skeleton metadata for info.guardianproject.urzip 382s .WARNING:root:rocks.janicerand does not have a name! Using application ID instead. 382s INFO:root:Generated skeleton metadata for rocks.janicerand 383s ...WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 384s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 390s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 391s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 397s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 397s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 402s .ERROR:root:No signing certificates found in urzip-release-unsigned.apk 402s .....ERROR:root:Found bad funding file "build/fake.app.id/FUNDING.yml" for "fake.app.id": 402s ERROR:root:mapping values are not allowed in this context 402s in "build/fake.app.id/FUNDING.yml", line 4, column 12 403s ..WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 404s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 408s WARNING:root:Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 408s WARNING:root:Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 408s WARNING:root:Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 408s WARNING:root:Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 408s .....WARNING:root:skipping test_insert_triple_t_metadata, import.TestCase must run first! 410s ..WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 411s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 415s .WARNING:root:repo/../urzip.apk is set to android:debuggable="true" 416s .localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 416s SKIPPING: apksigner installed and it allows MD5 signatures 416s .WARNING:androguard.apk:Missing AndroidManifest.xml. Is this an APK file? 416s ERROR:root:Failed to get APK information, skipping repo/fake.ota.update_1234.zip 416s WARNING:root:Skipping 'fake.ota.update_1234.zip' with invalid signature! 418s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 419s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 423s .WARNING:root:Ignoring FUNDING.yml entry longer than 2048: VTIUZOSYJTARINLANWUCWVOZEVENZEKBVPWLBJXBMYJFNCEVNZOCNHYJKGOHXPCTAJQOSPHJFDUMFICOXHBKJXMODMPRTSPOFOWCRODPZFZVLDIXPHFXLPCXQSZYUXXPMXSPALIPFNSLHEYHRESSUOKAOAXGMAMUGUZRRLAANUXTVJRVTEXEIQTVDDTAEYIJQDXQRIGIYKDVFCQEVWTAOQZKTGMRVWVRNOOGNOJQCHJTSRFLSHVNZOCAEMAYXDNBYOYIEHVWPWZWUKVTMZVZKAFUVKVBGZJPHQZCOUFSCMUTBVNVVRGXNBGKWYAIGULNDDNUOKTXMBAPTJOIHCNPQJFMAZZQBHEEXJJAFGQWZVFHNXZYLKGPZQLCCJMFGFZFCQSGWVFDRUNXYTVBGMAHTKLSVEHOQDPPQWKMUFAEVOFTOJRCBPOPSCBVAPXONHOOIBDNWQZEAGDPUHPWHDEUERYNKSRBWCSXFNCNRFMZZYFUQZDBJFEEXPSIRTGPBSDQBZFQCMDBRAKPVXYNEHMLHFEJUQBBFOGKWCDLDIKHYCYDEJLDSFIAVHXYAKIMSLFRBJSDCCEOWSPAKMUMZKTLWIPBXMWXDGFOXVQFMYFLRDMWVIWDIQZEEYMDGMTANZCSEIRDQPHEXJQIGGVFJEZJMFNYJFXLDOVCIJFDEDYTCRSHJLOXXYBWFWXNRWNXMOUQRITTLTULDFLDUMHGQQUUEJHAAILTYNNYKFINHSGOPXSTPSDYNZDSTCYUFCDXUVUCVWPHPILKTEOHGKSNTQLZUQWYUANUGNWBBCTRKUVEOTNJUSQTIGQDCHYVWFQMUZWDHHOEVJGIRVIHCYYBJFJYHRYRCAGZTYLJYFIMCSTURPCGXNRCMKXVEKEXPQGEBJWVWFFQTPJMVECLGYIBPMQOFLNBDCNFESADVOTRBGJVTDSCVHXNWACFHXZYPJFNXCIGHBAVEIXUCYIAJOYJZNBKWYNFNCQNWTECPGAKFLJJQXSPSBBTWZJNPTHKMIWQYOCHTXKRMMTRDXZUGDKKYXUICXWEXSFKTTELAPAAZIFDVDYTBVUFYVOBDJFEJXGYNWVIQJYBTVEZUKPIKIRXCKJTTORDNCRQYQMOTFNNZJQNQIKLMFKUAJKVZFPNZTAPHFOPFWNSKNGGLFIMFCLKFHYTKNENLHIKPMFMDPMFUNTLCACWRQEZVSYJRYWAWBUTGPECJZODOEJGDRNNIKGEIWBECLPVNULROCWAQNLPXNDIISGOFJEQTZKVIVLWGPLFBMGAIJTXJUYEUQRRFJQTCHUCRQOCSTAIHOICCTKAIHERKNWHUVZPOGLMBMHJGIBDRZNOPOOEFHBQDKAVHXOVSECQIWJLPTWFEYVNXGOXLYUKZDLYOIFMVTBMQFQOGMITCDUKTLMQUSVQZBXVTLEKNKGXUBMKIFEDSMDWERUSMRULGAPRKYLMHDPSVWJDBGZLVSBQLQLURRVLECSAFIBGCMEFSMONKHXNOGGAOFRVNHMQAFPAQWWTPUWYPEQQUIIPPDJOFKHKQCIHFGHNSEEGKABGDMIZDQJQVWSEMRJEKGPTJQPXYLNFCVZQMIRNZSXZBQBZEOPRNKKCXEPCJXQGKCYNBPFLRZWBFEBZRXFMGXWOWSOYSQQOECHOKOAGPIJGDTZHQZSGZGSPONCBGGGNITLGKHFIZTHJWCNDBMXRCNWLCOTCOHZWUEJWGLDTOVELYPBACWQNWNGVZPUDMMXLMAGNQPGOKKPZYEMHJPZBNWHUGKGHQMSUBELODFYQBDITMSCEPDHYITGTYKJJNEQOKXOSVUASZOIWHPEBLYOMHWXJQISLVHPHDBOUDJTBTWEJEMECEOWMKDKIZCTAKKQEGZBHEUSBCQUMVAPFKSRPQSDBHRCNYXAXJFYWAWWUIRNKSJUQASKOPIDRFJTORNGDZJJZWSKYTEDNNIZESHHJAHXMLYRWCHRCEFKUUJWIEGJOTJHWPIIPKMHEXTBZAYQTKVHICJNEGXNDYURSYWWHMSWUMZJQXJQCUGRCLXFDFTUCJISD 423s .WARNING:root:No minimum SDK version found in SpeedoMeterApp.main_1.apk, using default (3). 423s .sERROR:root:Could not open APK repo/badzip_1.apk for analysis: File is not a zip file 423s .WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 423s .ERROR:root:No signing certificates found in urzip-release-unsigned.apk 423s ...ERROR:root:badlink.txt: [Errno 2] No such file or directory: 'badlink.txt' 423s .ERROR:root:badlink-full-description.txt: [Errno 2] No such file or directory: 'badlink-full-description.txt' 423s ERROR:root:badlink-short-description.txt: [Errno 2] No such file or directory: 'badlink-short-description.txt' 423s ERROR:root:badlink-title.txt: [Errno 2] No such file or directory: 'badlink-title.txt' 423s ERROR:root:badlink-video-url.txt: [Errno 2] No such file or directory: 'badlink-video-url.txt' 423s ..ERROR:root:Failed copying /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/corrupt-featureGraphic.png: cannot identify image file <_io.BufferedReader name='/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/corrupt-featureGraphic.png'> 425s .WARNING:root:repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 425s WARNING:root:No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 429s .WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 429s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 429s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 430s 430s Warning: 430s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 430s INFO:root:Creating signed index with this key (SHA256): 430s INFO:root:F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 431s jar signed. 431s 431s Warning: 431s The signer's certificate is self-signed. 431s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 431s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 431s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 432s jar signed. 432s 432s Warning: 432s The signer's certificate is self-signed. 432s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 432s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 432s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 434s 434s Warning: 434s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 434s INFO:root:Finished 434s WARNING:root:repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 434s WARNING:root:"com.politedroid_6.apk" is signed by a key that is not allowed: 434s 32a23624c201b949f085996ba5ed53d40f703aca4989476949cae891022e0ed6 434s WARNING:root:Removing repo/com.politedroid_6.apk" 434s /tmp/autopkgtest.MqVFDp/build.8ZF/src/fdroidserver/index.py:80: DeprecationWarning: datetime.datetime.utcnow() is deprecated and scheduled for removal in a future version. Use timezone-aware objects to represent datetimes in UTC: datetime.datetime.now(datetime.UTC). 434s repodict['timestamp'] = datetime.utcnow().replace(tzinfo=timezone.utc) 434s 434s Warning: 434s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 434s INFO:root:Creating signed index with this key (SHA256): 434s INFO:root:F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 436s jar signed. 436s 436s Warning: 436s The signer's certificate is self-signed. 436s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 436s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 436s WARNING:root:repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 437s jar signed. 437s 437s Warning: 437s The signer's certificate is self-signed. 437s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 437s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 437s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 438s 438s Warning: 438s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 438s INFO:root:Finished 438s . 438s ---------------------------------------------------------------------- 438s Ran 45 tests in 75.368s 438s 438s OK (skipped=1) 438s + for testcase in $WORKSPACE/tests/*.TestCase 438s + '[' /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/vcs.TestCase == /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/install.TestCase ']' 438s + /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/vcs.TestCase 439s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/vcs.TestCase:96: DeprecationWarning: unittest.makeSuite() is deprecated and will be removed in Python 3.13. Please use unittest.TestLoader.loadTestsFromTestCase() instead. 439s newSuite.addTest(unittest.makeSuite(VCSTest)) 439s DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpb_api69h/upstream_repo, universal_newlines=False, shell=None, istream=None) 439s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpb_api69h/upstream_repo, universal_newlines=False, shell=None, istream=) 439s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch'], cwd=/tmp/tmpb_api69h/upstream_repo, universal_newlines=False, shell=None, istream=) 439s DEBUG:git.cmd:Popen(['git', 'init'], cwd=/tmp/tmpb_api69h/clone1, universal_newlines=False, shell=None, istream=None) 439s DEBUG:git.cmd:Popen(['git', 'remote', 'add', '--', 'upstream', 'file:///tmp/tmpb_api69h/upstream_repo'], cwd=/tmp/tmpb_api69h/clone1, universal_newlines=False, shell=None, istream=None) 439s DEBUG:git.cmd:Popen(['git', 'fetch', '-v', '--', 'upstream'], cwd=/tmp/tmpb_api69h/clone1, universal_newlines=True, shell=None, istream=None) 439s DEBUG:git.cmd:Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/tmpb_api69h/clone1, universal_newlines=False, shell=None, istream=) 439s DEBUG:git.cmd:Popen(['git', 'reset', '--hard', 'HEAD', '--'], cwd=/tmp/tmpb_api69h/clone1, universal_newlines=False, shell=None, istream=None) 439s DEBUG:root:Getting git vcs interface for /tmp/tmpb_api69h/clone1 439s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- /tmp/tmpb_api69h/clone1 build/com.gpl.rpg.AndorsTrail 439s Cloning into 'build/com.gpl.rpg.AndorsTrail'... 439s done. 439s Note: switching to 'b0d062f85e0a2efce86b606ad4af69d4ebc84693'. 439s 439s You are in 'detached HEAD' state. You can look around, make experimental 439s changes and commit them, and you can discard any commits you make in this 439s state without impacting any branches by switching back to a branch. 439s 439s If you want to create a new branch to retain commits you create, you may 439s do so (now or later) by using -c with the switch command. Example: 439s 439s git switch -c 439s 439s Or undo this operation with: 439s 439s git switch - 439s 439s Turn off this advice by setting config variable advice.detachedHead to false 439s 439s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 439s DEBUG:root:> git rev-parse --show-toplevel 439s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 439s DEBUG:root:> git checkout -f b0d062f85e0a2efce86b606ad4af69d4ebc84693 439s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 439s DEBUG:root:> git clean -dffx 439s INFO:root:Getting source for revision b0d062f85e0a2efce86b606ad4af69d4ebc84693 439s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 439s DEBUG:root:> git rev-parse --show-toplevel 439s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 439s DEBUG:root:> git submodule foreach --recursive git reset --hard 439s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 439s DEBUG:root:> git reset --hard 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git submodule foreach --recursive git clean -dffx 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git clean -dffx 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch origin 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org remote prune origin 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git remote set-head origin --auto 440s WARNING:root:Git remote set-head failed: "error: Cannot determine remote HEAD" 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git checkout -f b0d062f85e0a2efce86b606ad4af69d4ebc84693 440s DEBUG:root:Directory: build/com.gpl.rpg.AndorsTrail 440s DEBUG:root:> git clean -dffx 440s INFO:root:Creating local.properties file at build/com.gpl.rpg.AndorsTrail/local.properties 440s DEBUG:root:Removing debuggable flags from build/com.gpl.rpg.AndorsTrail 440s . 440s localmodule: /tmp/autopkgtest.MqVFDp/build.8ZF/src 440s ---------------------------------------------------------------------- 440s Ran 1 test in 1.780s 440s 440s OK 440s ============================================================================== 440s print fdroid version 440s + echo_header 'print fdroid version' 440s + /usr/bin/fdroid --version 441s no version info found! 441s + echo_header 'run process when building and signing are on separate machines' 441s ============================================================================== 441s + use_apksigner 441s + python3 -c ' 441s import sys 441s sys.path.insert(0, '\''/tmp/autopkgtest.MqVFDp/build.8ZF/src'\'') 441s from fdroidserver import common 441s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 441s common.find_apksigner(c) 441s exit(c.get('\''apksigner'\'') is None) 441s ' 441s run process when building and signing are on separate machines 441s ++ create_test_dir 441s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 441s ++ mkdir /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 441s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 441s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW 441s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW 441s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/ 441s + /usr/bin/fdroid init --keystore keystore.jks --repo-keyalias=sova 442s 2024-03-07 19:59:29,158 WARNING: 442s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks" 442s Now set these in config.yml: keystorepass, keypass, keydname 442s 442s 2024-03-07 19:59:29,158 INFO: 442s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW" with this config: 442s 442s Android SDK: /usr/lib/android-sdk 442s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks 442s Alias for key in store: sova 442s 442s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/repo" 442s then run "fdroid update -c; fdroid update". You might also want to edit 442s "config.yml" to set the URL, repo name, and more. You should also set up 442s a signing key (a temporary one might have been automatically generated). 442s 442s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 442s and https://f-droid.org/docs/Signing_Process 442s + echo 'make_current_version_link: true' 442s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 442s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 442s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"' 442s + test -d archive 442s + mkdir archive 442s + test -d metadata 442s + mkdir metadata 442s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/info.guardianproject.urzip.yml metadata/ 442s + test -d repo 442s + test -d unsigned 442s + mkdir unsigned 442s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release-unsigned.apk unsigned/info.guardianproject.urzip_100.apk 442s + /usr/bin/fdroid publish --verbose 442s 2024-03-07 19:59:29,604 DEBUG: Reading 'config.yml' 442s 2024-03-07 19:59:29,616 DEBUG: ipfs_cid not found, skipping CIDv1 generation 442s 2024-03-07 19:59:29,617 INFO: Creating log directory 442s 2024-03-07 19:59:29,617 INFO: Creating temporary directory 442s 2024-03-07 19:59:29,619 INFO: 1 app, 1 key aliases 442s 2024-03-07 19:59:29,620 INFO: Processing unsigned/info.guardianproject.urzip_100.apk 442s 2024-03-07 19:59:29,620 INFO: Key alias: d0299f24 442s 2024-03-07 19:59:29,620 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -list -alias d0299f24 -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 443s keytool error: java.lang.Exception: Alias does not exist 443s 2024-03-07 19:59:30,229 INFO: Key does not exist - generating... 443s 2024-03-07 19:59:30,229 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -genkey -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -alias d0299f24 -keyalg RSA -keysize 2048 -validity 10000 -storepass:env FDROID_KEY_STORE_PASS -dname CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US -keypass:env FDROID_KEY_PASS 444s Generating 2,048 bit RSA key pair and self-signed certificate (SHA384withRSA) with a validity of 10,000 days 444s for: CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, ST=California, C=US 444s 444s Warning: 444s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -deststoretype pkcs12". 444s 2024-03-07 19:59:31,743 DEBUG: > /usr/bin/apksigner sign --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --key-pass env:FDROID_KEY_PASS --ks-key-alias d0299f24 --in unsigned/info.guardianproject.urzip_100.apk --out repo/info.guardianproject.urzip_100.apk 445s 2024-03-07 19:59:32,448 DEBUG: ...no source tarball for info.guardianproject.urzip_100.apk 445s 2024-03-07 19:59:32,448 INFO: Published info.guardianproject.urzip_100.apk 445s 2024-03-07 19:59:32,449 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -list -v -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 446s 2024-03-07 19:59:33,255 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA stats/publishsigkeys.jar sova -keypass:env FDROID_KEY_PASS 447s jar signed. 447s 447s Warning: 447s The signer's certificate is self-signed. 447s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 447s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 447s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 447s 2024-03-07 19:59:34,361 DEBUG: Outputting JSON 447s 2024-03-07 19:59:34,361 DEBUG: skip deploying full build logs: not enabled in config 447s 2024-03-07 19:59:34,362 DEBUG: skip deploying full build logs: not enabled in config 447s 2024-03-07 19:59:34,362 DEBUG: skip deploying full build logs: not enabled in config 447s 2024-03-07 19:59:34,362 INFO: published list signing-key fingerprints 447s + /usr/bin/fdroid update --verbose --nosign 447s 2024-03-07 19:59:34,805 DEBUG: Reading 'config.yml' 447s 2024-03-07 19:59:34,818 DEBUG: ipfs_cid not found, skipping CIDv1 generation 447s 2024-03-07 19:59:34,818 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 447s 2024-03-07 19:59:34,818 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 447s 2024-03-07 19:59:34,821 DEBUG: Processing info.guardianproject.urzip_100.apk 447s 2024-03-07 19:59:34,911 INFO: Starting analysis on AndroidManifest.xml 447s 2024-03-07 19:59:34,921 INFO: APK file was successfully validated! 447s 2024-03-07 19:59:34,923 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 448s 2024-03-07 19:59:35,304 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 448s Verified using v1 scheme (JAR signing): true 448s Verified using v2 scheme (APK Signature Scheme v2): true 448s Verified using v3 scheme (APK Signature Scheme v3): true 448s Verified using v4 scheme (APK Signature Scheme v4): false 448s Verified for SourceStamp: false 448s Number of signers: 1 448s 448s 2024-03-07 19:59:35,307 DEBUG: Density 120 not available, resizing down from 160 448s 2024-03-07 19:59:35,952 DEBUG: JAR signature verified: stats/publishsigkeys.jar 448s 2024-03-07 19:59:35,956 WARNING: repo_key_sha256 not in config.yml, setting it to the signature key fingerprint of 'stats/publishsigkeys.jar' 448s 2024-03-07 19:59:35,958 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 449s 449s Warning: 449s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -deststoretype pkcs12". 449s 2024-03-07 19:59:36,666 INFO: Creating unsigned index in preparation for signing 449s 2024-03-07 19:59:36,666 DEBUG: Directory: repo 449s 2024-03-07 19:59:36,667 DEBUG: > jar cf index_unsigned.jar index.xml 449s 2024-03-07 19:59:36,971 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 450s 2024-03-07 19:59:36,979 DEBUG: index-v1 must have a signature, use `fdroid signindex` to create it! 450s 2024-03-07 19:59:36,981 DEBUG: index-v2 must have a signature, use `fdroid signindex` to create it! 450s 2024-03-07 19:59:36,981 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 450s 450s Warning: 450s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -deststoretype pkcs12". 450s 2024-03-07 19:59:37,701 DEBUG: Outputting JSON 450s 2024-03-07 19:59:37,702 DEBUG: skip deploying full build logs: not enabled in config 450s 2024-03-07 19:59:37,702 DEBUG: skip deploying full build logs: not enabled in config 450s 2024-03-07 19:59:37,702 DEBUG: skip deploying full build logs: not enabled in config 450s 2024-03-07 19:59:37,703 INFO: Finished 450s + /usr/bin/fdroid signindex --verbose 451s 2024-03-07 19:59:38,178 DEBUG: Reading 'config.yml' 451s 2024-03-07 19:59:38,189 DEBUG: ipfs_cid not found, skipping CIDv1 generation 451s 2024-03-07 19:59:38,190 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/index_unsigned.jar 451s 2024-03-07 19:59:38,796 INFO: Signed index in repo 451s 2024-03-07 19:59:38,796 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 452s jar signed. 452s 452s Warning: 452s The signer's certificate is self-signed. 452s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 452s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 452s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 452s 2024-03-07 19:59:39,904 INFO: Signed repo/index-v1.json 452s 2024-03-07 19:59:39,904 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.6zpW/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 453s 2024-03-07 19:59:40,509 INFO: Signed repo/entry.json 453s 2024-03-07 19:59:40,509 DEBUG: Outputting JSON 453s 2024-03-07 19:59:40,510 DEBUG: skip deploying full build logs: not enabled in config 453s 2024-03-07 19:59:40,512 DEBUG: skip deploying full build logs: not enabled in config 453s 2024-03-07 19:59:40,512 DEBUG: skip deploying full build logs: not enabled in config 453s + test -e repo/index.xml 453s + test -e repo/index.jar 453s + test -e repo/index-v1.jar 453s + test -e tmp/apkcache.json 453s + test -z tmp/apkcache.json 453s + test -L urzip.apk 453s + grep -F ') 462s 2024-03-07 19:59:48,984 DEBUG: Including metadata from build/org.fdroid.ci.test.app/.fdroid.yml@723e955be8fa0647c021992040f0ae8ae8c4569d 462s 2024-03-07 19:59:48,986 INFO: Processing org.fdroid.ci.test.app 462s 2024-03-07 19:59:48,986 INFO: ...scanning version 0.3 462s 2024-03-07 19:59:48,986 INFO: Getting source for revision 0.3 462s 2024-03-07 19:59:48,986 INFO: Repository details for build/org.fdroid.ci.test.app missing - deleting 462s 2024-03-07 19:59:48,995 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- https://gitlab.com/fdroid/ci-test-app.git build/org.fdroid.ci.test.app 462s Cloning into 'build/org.fdroid.ci.test.app'... 463s 2024-03-07 19:59:50,400 DEBUG: Directory: build/org.fdroid.ci.test.app 463s 2024-03-07 19:59:50,400 DEBUG: > git rev-parse --show-toplevel 463s 2024-03-07 19:59:50,502 DEBUG: Directory: build/org.fdroid.ci.test.app 463s 2024-03-07 19:59:50,502 DEBUG: > git checkout -f 0.3 463s 2024-03-07 19:59:50,707 DEBUG: Directory: build/org.fdroid.ci.test.app 463s 2024-03-07 19:59:50,708 DEBUG: > git clean -dffx 463s 2024-03-07 19:59:50,710 INFO: Creating local.properties file at build/org.fdroid.ci.test.app/local.properties 463s 2024-03-07 19:59:50,711 INFO: Creating local.properties file at build/org.fdroid.ci.test.app/app/local.properties 463s 2024-03-07 19:59:50,711 DEBUG: Removing debuggable flags from build/org.fdroid.ci.test.app/app 463s 2024-03-07 19:59:50,715 DEBUG: scanner is configured to use signature data from: 'suss' 463s 2024-03-07 19:59:50,718 INFO: Finished 463s 0 problems found 463s ============================================================================== 463s copy tests/repo, generate java/gpg keys, update, and gpgsign 463s + echo_header 'copy tests/repo, generate java/gpg keys, update, and gpgsign' 463s ++ create_test_dir 463s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 463s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 463s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8 463s + GNUPGHOME=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8/gnupghome 463s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8 463s + fdroid_init_with_prebuilt_keystore 463s + '[' -z '' ']' 463s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 463s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 464s 2024-03-07 19:59:51,180 WARNING: 464s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 464s Now set these in config.yml: keystorepass, keypass, keydname 464s 464s 2024-03-07 19:59:51,180 INFO: 464s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8" with this config: 464s 464s Android SDK: /usr/lib/android-sdk 464s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 464s Alias for key in store: sova 464s 464s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8/repo" 464s then run "fdroid update -c; fdroid update". You might also want to edit 464s "config.yml" to set the URL, repo name, and more. You should also set up 464s a signing key (a temporary one might have been automatically generated). 464s 464s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 464s and https://f-droid.org/docs/Signing_Process 464s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 464s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 464s + cp -a /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/stats /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8/ 464s + cp -a /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/gnupghome /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8/gnupghome 464s + chmod 0700 /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8/gnupghome 464s + echo 'install_list: org.adaway' 464s + echo 'uninstall_list: [com.android.vending, com.facebook.orca]' 464s + echo 'gpghome: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qgL8/gnupghome' 464s + echo 'gpgkey: CE71F7FB' 464s + echo 'mirrors: ['\''http://foobarfoobarfoobar.onion/fdroid'\'', '\''https://foo.bar/fdroid'\'']' 464s + /usr/bin/fdroid update --verbose --pretty 464s 2024-03-07 19:59:51,636 DEBUG: Reading 'config.yml' 464s 2024-03-07 19:59:51,648 DEBUG: ipfs_cid not found, skipping CIDv1 generation 464s 2024-03-07 19:59:51,649 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 464s 2024-03-07 19:59:51,649 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 464s 2024-03-07 19:59:51,726 DEBUG: Processing com.example.test.helloworld_1.apk 464s 2024-03-07 19:59:51,787 INFO: Starting analysis on AndroidManifest.xml 464s 2024-03-07 19:59:51,796 INFO: APK file was successfully validated! 464s 2024-03-07 19:59:51,800 DEBUG: Getting signature of com.example.test.helloworld_1.apk 465s 2024-03-07 19:59:52,147 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 465s Verified using v1 scheme (JAR signing): true 465s Verified using v2 scheme (APK Signature Scheme v2): false 465s Verified using v3 scheme (APK Signature Scheme v3): false 465s Verified using v4 scheme (APK Signature Scheme v4): false 465s Verified for SourceStamp: false 465s Number of signers: 1 465s 465s 2024-03-07 19:59:52,148 DEBUG: Processing com.politedroid_3.apk 465s 2024-03-07 19:59:52,148 INFO: Starting analysis on AndroidManifest.xml 465s 2024-03-07 19:59:52,149 INFO: APK file was successfully validated! 465s 2024-03-07 19:59:52,151 DEBUG: Getting signature of com.politedroid_3.apk 465s 2024-03-07 19:59:52,509 DEBUG: repo/com.politedroid_3.apk: Verifies 465s Verified using v1 scheme (JAR signing): true 465s Verified using v2 scheme (APK Signature Scheme v2): false 465s Verified using v3 scheme (APK Signature Scheme v3): false 465s Verified using v4 scheme (APK Signature Scheme v4): false 465s Verified for SourceStamp: false 465s Number of signers: 1 465s 465s 2024-03-07 19:59:52,514 DEBUG: Processing com.politedroid_4.apk 465s 2024-03-07 19:59:52,514 INFO: Starting analysis on AndroidManifest.xml 465s 2024-03-07 19:59:52,515 INFO: APK file was successfully validated! 465s 2024-03-07 19:59:52,517 DEBUG: Getting signature of com.politedroid_4.apk 465s 2024-03-07 19:59:52,860 DEBUG: repo/com.politedroid_4.apk: Verifies 465s Verified using v1 scheme (JAR signing): true 465s Verified using v2 scheme (APK Signature Scheme v2): false 465s Verified using v3 scheme (APK Signature Scheme v3): false 465s Verified using v4 scheme (APK Signature Scheme v4): false 465s Verified for SourceStamp: false 465s Number of signers: 1 465s 465s 2024-03-07 19:59:52,862 DEBUG: Processing com.politedroid_5.apk 465s 2024-03-07 19:59:52,862 INFO: Starting analysis on AndroidManifest.xml 465s 2024-03-07 19:59:52,863 INFO: APK file was successfully validated! 465s 2024-03-07 19:59:52,864 DEBUG: Getting signature of com.politedroid_5.apk 466s 2024-03-07 19:59:53,220 DEBUG: repo/com.politedroid_5.apk: Verifies 466s Verified using v1 scheme (JAR signing): true 466s Verified using v2 scheme (APK Signature Scheme v2): false 466s Verified using v3 scheme (APK Signature Scheme v3): false 466s Verified using v4 scheme (APK Signature Scheme v4): false 466s Verified for SourceStamp: false 466s Number of signers: 1 466s 466s 2024-03-07 19:59:53,222 DEBUG: Processing com.politedroid_6.apk 466s 2024-03-07 19:59:53,222 INFO: Starting analysis on AndroidManifest.xml 466s 2024-03-07 19:59:53,223 INFO: APK file was successfully validated! 466s 2024-03-07 19:59:53,226 DEBUG: Getting signature of com.politedroid_6.apk 466s 2024-03-07 19:59:53,582 DEBUG: repo/com.politedroid_6.apk: Verifies 466s Verified using v1 scheme (JAR signing): true 466s Verified using v2 scheme (APK Signature Scheme v2): false 466s Verified using v3 scheme (APK Signature Scheme v3): false 466s Verified using v4 scheme (APK Signature Scheme v4): false 466s Verified for SourceStamp: false 466s Number of signers: 1 466s 466s 2024-03-07 19:59:53,584 DEBUG: Processing duplicate.permisssions_9999999.apk 466s 2024-03-07 19:59:53,585 INFO: Starting analysis on AndroidManifest.xml 466s 2024-03-07 19:59:53,587 INFO: APK file was successfully validated! 466s 2024-03-07 19:59:53,589 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 466s 2024-03-07 19:59:53,596 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 467s 2024-03-07 19:59:53,976 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 467s Verified using v1 scheme (JAR signing): true 467s Verified using v2 scheme (APK Signature Scheme v2): true 467s Verified using v3 scheme (APK Signature Scheme v3): false 467s Verified using v4 scheme (APK Signature Scheme v4): false 467s Verified for SourceStamp: false 467s Number of signers: 1 467s 467s 2024-03-07 19:59:53,977 DEBUG: Density 120 not available, resizing down from 160 467s 2024-03-07 19:59:53,979 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 467s 2024-03-07 19:59:53,979 INFO: Starting analysis on AndroidManifest.xml 467s 2024-03-07 19:59:53,980 INFO: APK file was successfully validated! 467s 2024-03-07 19:59:53,982 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 467s 2024-03-07 19:59:54,333 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 467s Verified using v1 scheme (JAR signing): true 467s Verified using v2 scheme (APK Signature Scheme v2): false 467s Verified using v3 scheme (APK Signature Scheme v3): false 467s Verified using v4 scheme (APK Signature Scheme v4): false 467s Verified for SourceStamp: false 467s Number of signers: 1 467s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 467s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 467s 467s 2024-03-07 19:59:54,333 DEBUG: Processing no.min.target.sdk_987.apk 467s 2024-03-07 19:59:54,334 INFO: Starting analysis on AndroidManifest.xml 467s 2024-03-07 19:59:54,335 INFO: APK file was successfully validated! 467s 2024-03-07 19:59:54,337 DEBUG: Getting signature of no.min.target.sdk_987.apk 467s 2024-03-07 19:59:54,345 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 467s 2024-03-07 19:59:54,727 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 467s Verified using v1 scheme (JAR signing): true 467s Verified using v2 scheme (APK Signature Scheme v2): true 467s Verified using v3 scheme (APK Signature Scheme v3): false 467s Verified using v4 scheme (APK Signature Scheme v4): false 467s Verified for SourceStamp: false 467s Number of signers: 1 467s 467s 2024-03-07 19:59:54,727 DEBUG: Density 120 not available, resizing down from 160 467s 2024-03-07 19:59:54,729 DEBUG: Processing obb.main.oldversion_1444412523.apk 467s 2024-03-07 19:59:54,729 INFO: Starting analysis on AndroidManifest.xml 467s 2024-03-07 19:59:54,731 INFO: APK file was successfully validated! 467s 2024-03-07 19:59:54,733 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 468s 2024-03-07 19:59:55,110 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 468s Verified using v1 scheme (JAR signing): true 468s Verified using v2 scheme (APK Signature Scheme v2): true 468s Verified using v3 scheme (APK Signature Scheme v3): false 468s Verified using v4 scheme (APK Signature Scheme v4): false 468s Verified for SourceStamp: false 468s Number of signers: 1 468s 468s 2024-03-07 19:59:55,111 DEBUG: Density 120 not available, resizing down from 160 468s 2024-03-07 19:59:55,112 DEBUG: Processing obb.main.twoversions_1101613.apk 468s 2024-03-07 19:59:55,113 INFO: Starting analysis on AndroidManifest.xml 468s 2024-03-07 19:59:55,114 INFO: APK file was successfully validated! 468s 2024-03-07 19:59:55,116 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 468s 2024-03-07 19:59:55,473 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 468s Verified using v1 scheme (JAR signing): true 468s Verified using v2 scheme (APK Signature Scheme v2): false 468s Verified using v3 scheme (APK Signature Scheme v3): false 468s Verified using v4 scheme (APK Signature Scheme v4): false 468s Verified for SourceStamp: false 468s Number of signers: 1 468s 468s 2024-03-07 19:59:55,473 DEBUG: Density 120 not available, resizing down from 160 468s 2024-03-07 19:59:55,475 DEBUG: Processing obb.main.twoversions_1101615.apk 468s 2024-03-07 19:59:55,475 INFO: Starting analysis on AndroidManifest.xml 468s 2024-03-07 19:59:55,477 INFO: APK file was successfully validated! 468s 2024-03-07 19:59:55,478 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 468s 2024-03-07 19:59:55,839 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 468s Verified using v1 scheme (JAR signing): true 468s Verified using v2 scheme (APK Signature Scheme v2): false 468s Verified using v3 scheme (APK Signature Scheme v3): false 468s Verified using v4 scheme (APK Signature Scheme v4): false 468s Verified for SourceStamp: false 468s Number of signers: 1 468s 468s 2024-03-07 19:59:55,840 DEBUG: Density 120 not available, resizing down from 160 468s 2024-03-07 19:59:55,842 DEBUG: Processing obb.main.twoversions_1101617.apk 468s 2024-03-07 19:59:55,842 INFO: Starting analysis on AndroidManifest.xml 468s 2024-03-07 19:59:55,843 INFO: APK file was successfully validated! 468s 2024-03-07 19:59:55,845 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 469s 2024-03-07 19:59:56,204 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 469s Verified using v1 scheme (JAR signing): true 469s Verified using v2 scheme (APK Signature Scheme v2): false 469s Verified using v3 scheme (APK Signature Scheme v3): false 469s Verified using v4 scheme (APK Signature Scheme v4): false 469s Verified for SourceStamp: false 469s Number of signers: 1 469s 469s 2024-03-07 19:59:56,205 DEBUG: Density 120 not available, resizing down from 160 469s 2024-03-07 19:59:56,207 DEBUG: Processing obb.mainpatch.current_1619.apk 469s 2024-03-07 19:59:56,207 INFO: Starting analysis on AndroidManifest.xml 469s 2024-03-07 19:59:56,208 INFO: APK file was successfully validated! 469s 2024-03-07 19:59:56,210 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 469s 2024-03-07 19:59:56,563 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 469s Verified using v1 scheme (JAR signing): true 469s Verified using v2 scheme (APK Signature Scheme v2): false 469s Verified using v3 scheme (APK Signature Scheme v3): false 469s Verified using v4 scheme (APK Signature Scheme v4): false 469s Verified for SourceStamp: false 469s Number of signers: 1 469s 469s 2024-03-07 19:59:56,563 DEBUG: Density 120 not available, resizing down from 160 469s 2024-03-07 19:59:56,565 DEBUG: Processing obb.mainpatch.current_1619_another-release-key.apk 469s 2024-03-07 19:59:56,565 INFO: Starting analysis on AndroidManifest.xml 469s 2024-03-07 19:59:56,567 INFO: APK file was successfully validated! 469s 2024-03-07 19:59:56,568 DEBUG: Getting signature of obb.mainpatch.current_1619_another-release-key.apk 469s 2024-03-07 19:59:56,913 DEBUG: repo/obb.mainpatch.current_1619_another-release-key.apk: Verifies 469s Verified using v1 scheme (JAR signing): true 469s Verified using v2 scheme (APK Signature Scheme v2): false 469s Verified using v3 scheme (APK Signature Scheme v3): false 469s Verified using v4 scheme (APK Signature Scheme v4): false 469s Verified for SourceStamp: false 469s Number of signers: 1 469s 469s 2024-03-07 19:59:56,914 DEBUG: Density 120 not available, resizing down from 160 469s 2024-03-07 19:59:56,916 DEBUG: Processing souch.smsbypass_9.apk 469s 2024-03-07 19:59:56,916 INFO: Starting analysis on AndroidManifest.xml 469s 2024-03-07 19:59:56,918 INFO: APK file was successfully validated! 469s 2024-03-07 19:59:56,921 DEBUG: Getting signature of souch.smsbypass_9.apk 470s 2024-03-07 19:59:57,335 DEBUG: repo/souch.smsbypass_9.apk: Verifies 470s Verified using v1 scheme (JAR signing): true 470s Verified using v2 scheme (APK Signature Scheme v2): false 470s Verified using v3 scheme (APK Signature Scheme v3): false 470s Verified using v4 scheme (APK Signature Scheme v4): false 470s Verified for SourceStamp: false 470s Number of signers: 1 470s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 470s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 470s 470s 2024-03-07 19:59:57,336 DEBUG: Density 120 not available, resizing down from 160 470s 2024-03-07 19:59:57,338 DEBUG: Processing urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 470s 2024-03-07 19:59:57,339 INFO: Starting analysis on AndroidManifest.xml 470s 2024-03-07 19:59:57,340 INFO: APK file was successfully validated! 470s 2024-03-07 19:59:57,342 DEBUG: Getting signature of urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 470s 2024-03-07 19:59:57,698 DEBUG: repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk: Verifies 470s Verified using v1 scheme (JAR signing): true 470s Verified using v2 scheme (APK Signature Scheme v2): false 470s Verified using v3 scheme (APK Signature Scheme v3): false 470s Verified using v4 scheme (APK Signature Scheme v4): false 470s Verified for SourceStamp: false 470s Number of signers: 1 470s 470s 2024-03-07 19:59:57,699 DEBUG: Density 120 not available, resizing down from 160 470s 2024-03-07 19:59:57,701 DEBUG: Processing v1.v2.sig_1020.apk 470s 2024-03-07 19:59:57,701 INFO: Starting analysis on AndroidManifest.xml 470s 2024-03-07 19:59:57,702 INFO: APK file was successfully validated! 470s 2024-03-07 19:59:57,704 DEBUG: Getting signature of v1.v2.sig_1020.apk 471s 2024-03-07 19:59:58,097 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 471s Verified using v1 scheme (JAR signing): true 471s Verified using v2 scheme (APK Signature Scheme v2): true 471s Verified using v3 scheme (APK Signature Scheme v3): false 471s Verified using v4 scheme (APK Signature Scheme v4): false 471s Verified for SourceStamp: false 471s Number of signers: 1 471s 471s 2024-03-07 19:59:58,098 DEBUG: Density 120 not available, resizing down from 160 471s 2024-03-07 19:59:58,100 DEBUG: Processing fake.ota.update_1234.zip 471s 2024-03-07 19:59:58,100 DEBUG: skipping source tarball: repo/obb.main.twoversions_1101617_src.tar.gz 471s 2024-03-07 19:59:58,100 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 471s Use `fdroid update -c` to create it. 471s 2024-03-07 19:59:58,100 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 471s Use `fdroid update -c` to create it. 471s 2024-03-07 19:59:58,103 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 471s 2024-03-07 19:59:58,103 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 471s 2024-03-07 19:59:58,103 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 471s 2024-03-07 19:59:58,103 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/icon.png repo/info.guardianproject.urzip/en-US 471s 2024-03-07 19:59:58,104 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/featureGraphic.png repo/info.guardianproject.urzip/en-US 471s 2024-03-07 19:59:58,184 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 471s 2024-03-07 19:59:58,184 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 471s 2024-03-07 19:59:58,184 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 471s 2024-03-07 19:59:58,185 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 471s 2024-03-07 19:59:58,186 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 471s 2024-03-07 19:59:58,187 DEBUG: adding to phoneScreenshots: repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 471s 2024-03-07 19:59:58,187 DEBUG: adding to sevenInchScreenshots: repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 471s 2024-03-07 19:59:58,188 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,188 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,189 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 471s 2024-03-07 19:59:58,190 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 471s 471s Warning: 471s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 471s 2024-03-07 19:59:58,901 INFO: Creating signed index with this key (SHA256): 471s 2024-03-07 19:59:58,901 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 471s 2024-03-07 19:59:58,901 DEBUG: Directory: repo 471s 2024-03-07 19:59:58,901 DEBUG: > jar cf index.jar index.xml 472s 2024-03-07 19:59:59,103 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 473s jar signed. 473s 473s Warning: 473s The signer's certificate is self-signed. 473s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 473s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 473s 2024-03-07 20:00:00,211 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 473s 2024-03-07 20:00:00,218 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 473s 2024-03-07 20:00:00,219 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 473s 2024-03-07 20:00:00,221 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 474s jar signed. 474s 474s Warning: 474s The signer's certificate is self-signed. 474s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 474s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 474s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 474s 2024-03-07 20:00:01,327 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 474s 2024-03-07 20:00:01,327 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 474s 2024-03-07 20:00:01,332 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 474s 2024-03-07 20:00:01,939 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 475s 475s Warning: 475s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 475s 2024-03-07 20:00:02,658 DEBUG: Outputting JSON 475s 2024-03-07 20:00:02,659 DEBUG: skip deploying full build logs: not enabled in config 475s 2024-03-07 20:00:02,660 DEBUG: skip deploying full build logs: not enabled in config 475s 2024-03-07 20:00:02,660 DEBUG: skip deploying full build logs: not enabled in config 475s 2024-03-07 20:00:02,660 INFO: Finished 475s + test -e repo/index.xml 475s + test -e repo/index.jar 475s + test -e repo/index-v1.jar 475s + grep -F '' archive/index.xml 484s ++ wc -l 484s + test 2 -eq 2 484s ++ wc -l 484s ++ grep '' repo/index.xml 484s + test 10 -eq 10 484s + use_apksigner 484s + python3 -c ' 484s import sys 484s sys.path.insert(0, '\''/tmp/autopkgtest.MqVFDp/build.8ZF/src'\'') 484s from fdroidserver import common 484s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 484s common.find_apksigner(c) 484s exit(c.get('\''apksigner'\'') is None) 484s ' 485s + echo_header 'test moving old APKs to and from the archive' 485s ============================================================================== 485s test moving old APKs to and from the archive 485s ++ create_test_dir 485s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 485s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 485s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.JS2O 485s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.JS2O 485s + fdroid_init_with_prebuilt_keystore 485s + '[' -z '' ']' 485s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 485s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 485s 2024-03-07 20:00:12,503 WARNING: 485s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 485s Now set these in config.yml: keystorepass, keypass, keydname 485s 485s 2024-03-07 20:00:12,503 INFO: 485s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.JS2O" with this config: 485s 485s Android SDK: /usr/lib/android-sdk 485s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 485s Alias for key in store: sova 485s 485s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.JS2O/repo" 485s then run "fdroid update -c; fdroid update". You might also want to edit 485s "config.yml" to set the URL, repo name, and more. You should also set up 485s a signing key (a temporary one might have been automatically generated). 485s 485s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 485s and https://f-droid.org/docs/Signing_Process 485s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 485s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 485s + test -d metadata 485s + mkdir metadata 485s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/com.politedroid.yml metadata/ 485s + sed -i.tmp /ArchivePolicy:/d metadata/com.politedroid.yml 485s + test -d repo 485s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk repo/ 485s + printf '\narchive_older: 3\n' 485s + /usr/bin/fdroid update --pretty --nosign 486s 2024-03-07 20:00:12,975 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 486s 2024-03-07 20:00:13,072 INFO: Starting analysis on AndroidManifest.xml 486s 2024-03-07 20:00:13,081 INFO: APK file was successfully validated! 486s 2024-03-07 20:00:13,449 INFO: Starting analysis on AndroidManifest.xml 486s 2024-03-07 20:00:13,449 INFO: APK file was successfully validated! 486s 2024-03-07 20:00:13,815 INFO: Starting analysis on AndroidManifest.xml 486s 2024-03-07 20:00:13,816 INFO: APK file was successfully validated! 487s 2024-03-07 20:00:14,177 INFO: Starting analysis on AndroidManifest.xml 487s 2024-03-07 20:00:14,178 INFO: APK file was successfully validated! 487s 2024-03-07 20:00:14,554 INFO: Moving com.politedroid_3.apk from repo to archive 488s 2024-03-07 20:00:15,163 INFO: Creating unsigned index in preparation for signing 488s 2024-03-07 20:00:15,468 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 489s 2024-03-07 20:00:16,702 INFO: Creating unsigned index in preparation for signing 490s 2024-03-07 20:00:17,007 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 490s 2024-03-07 20:00:17,633 INFO: Finished 490s ++ grep '' archive/index.xml 490s ++ wc -l 490s + test 1 -eq 1 490s ++ grep '' repo/index.xml 490s ++ wc -l 490s + test 3 -eq 3 490s + grep -F com.politedroid_3.apk archive/index.xml 490s com.politedroid_3.apk 490s + grep -F com.politedroid_4.apk repo/index.xml 490s com.politedroid_4.apk 490s com.politedroid_5.apk 490s com.politedroid_6.apk 490s + grep -F com.politedroid_5.apk repo/index.xml 490s + grep -F com.politedroid_6.apk repo/index.xml 490s + test -e archive/com.politedroid_3.apk 490s + test -e repo/com.politedroid_4.apk 490s + test -e repo/com.politedroid_5.apk 490s + test -e repo/com.politedroid_6.apk 490s + sed -i.tmp 's,archive_older: 3,archive_older: 1,' config.yml 490s + /usr/bin/fdroid update --pretty --nosign 491s 2024-03-07 20:00:18,142 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 491s 2024-03-07 20:00:18,146 INFO: Moving com.politedroid_5.apk from repo to archive 491s 2024-03-07 20:00:18,147 INFO: Moving com.politedroid_4.apk from repo to archive 491s 2024-03-07 20:00:18,755 INFO: Creating unsigned index in preparation for signing 492s 2024-03-07 20:00:19,060 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 493s 2024-03-07 20:00:20,293 INFO: Creating unsigned index in preparation for signing 493s 2024-03-07 20:00:20,595 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 494s 2024-03-07 20:00:21,222 INFO: Finished 494s ++ grep '' archive/index.xml 494s ++ wc -l 494s + test 3 -eq 3 494s ++ grep '' repo/index.xml 494s ++ wc -l 494s + test 1 -eq 1 494s + grep -F com.politedroid_3.apk archive/index.xml 494s com.politedroid_3.apk 494s + grep -F com.politedroid_4.apk archive/index.xml 494s com.politedroid_4.apk 494s com.politedroid_5.apk 494s com.politedroid_6.apk 494s + grep -F com.politedroid_5.apk archive/index.xml 494s + grep -F com.politedroid_6.apk repo/index.xml 494s + test -e archive/com.politedroid_3.apk 494s + test -e archive/com.politedroid_4.apk 494s + test -e archive/com.politedroid_5.apk 494s + test -e repo/com.politedroid_6.apk 494s + sed -i.tmp 's/\(versionCode: 4\)/\1\n disable: testing deletion/' metadata/com.politedroid.yml 494s + /usr/bin/fdroid update --pretty --nosign 494s 2024-03-07 20:00:21,694 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output repo/icons-640/com.politedroid.4.png 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output repo/icons-480/com.politedroid.4.png 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output archive/com.politedroid_4.apk 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output archive/icons/com.politedroid.4.png 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output archive/icons-320/com.politedroid.4.png 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output archive/icons-240/com.politedroid.4.png 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output archive/icons-160/com.politedroid.4.png 494s 2024-03-07 20:00:21,697 INFO: Deleting disabled build output archive/icons-120/com.politedroid.4.png 495s 2024-03-07 20:00:22,308 INFO: Creating unsigned index in preparation for signing 495s 2024-03-07 20:00:22,612 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 496s 2024-03-07 20:00:23,854 INFO: Creating unsigned index in preparation for signing 497s 2024-03-07 20:00:24,159 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 497s 2024-03-07 20:00:24,787 INFO: Finished 497s ++ grep '' archive/index.xml 497s ++ wc -l 497s + test 2 -eq 2 497s ++ grep '' repo/index.xml 497s ++ wc -l 497s + test 1 -eq 1 497s + grep -F com.politedroid_3.apk archive/index.xml 497s com.politedroid_3.apk 497s + grep -F com.politedroid_4.apk archive/index.xml 497s + grep -F com.politedroid_5.apk archive/index.xml 497s com.politedroid_5.apk 497s com.politedroid_6.apk 497s + grep -F com.politedroid_6.apk repo/index.xml 497s + test -e archive/com.politedroid_3.apk 497s + test -e archive/com.politedroid_4.apk 497s + test -e archive/com.politedroid_5.apk 497s + test -e repo/com.politedroid_6.apk 497s + sed -i.tmp 's/\(versionCode: 6\)/\1\n disable: testing deletion/' metadata/com.politedroid.yml 497s + /usr/bin/fdroid update --pretty --nosign 498s 2024-03-07 20:00:25,255 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 498s 2024-03-07 20:00:25,258 INFO: Deleting disabled build output repo/com.politedroid_6.apk 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons/com.politedroid.6.png 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons-640/com.politedroid.6.png 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons-480/com.politedroid.6.png 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons-320/com.politedroid.6.png 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons-240/com.politedroid.6.png 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons-160/com.politedroid.6.png 498s 2024-03-07 20:00:25,259 INFO: Deleting disabled build output repo/icons-120/com.politedroid.6.png 498s 2024-03-07 20:00:25,260 INFO: Moving com.politedroid_5.apk from archive to repo 498s 2024-03-07 20:00:25,872 INFO: Creating unsigned index in preparation for signing 499s 2024-03-07 20:00:26,175 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 500s 2024-03-07 20:00:27,414 INFO: Creating unsigned index in preparation for signing 500s 2024-03-07 20:00:27,619 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 501s 2024-03-07 20:00:28,247 INFO: Finished 501s ++ grep '' archive/index.xml 501s ++ wc -l 501s + test 1 -eq 1 501s ++ grep '' repo/index.xml 501s ++ wc -l 501s + test 1 -eq 1 501s + grep -F com.politedroid_3.apk archive/index.xml 501s com.politedroid_3.apk 501s + grep -F com.politedroid_5.apk repo/index.xml 501s com.politedroid_5.apk 501s ============================================================================== 501s test that verify can succeed and fail 501s + grep -F com.politedroid_6.apk repo/index.xml 501s + test -e archive/com.politedroid_3.apk 501s + test -e repo/com.politedroid_5.apk 501s + test -e repo/com.politedroid_6.apk 501s + echo_header 'test that verify can succeed and fail' 501s ++ create_test_dir 501s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 501s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 501s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.EOFY 501s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.EOFY 501s + test -d tmp 501s + mkdir tmp 501s + test -d unsigned 501s + mkdir unsigned 501s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk tmp/ 501s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk unsigned/ 501s + /usr/bin/fdroid verify --reuse-remote-apk --verbose com.politedroid 501s 2024-03-07 20:00:28,695 DEBUG: ipfs_cid not found, skipping CIDv1 generation 501s 2024-03-07 20:00:28,695 INFO: Processing com.politedroid_6.apk 502s 2024-03-07 20:00:29,050 DEBUG: tmp/com.politedroid_6.apk: Verifies 502s Verified using v1 scheme (JAR signing): true 502s Verified using v2 scheme (APK Signature Scheme v2): false 502s Verified using v3 scheme (APK Signature Scheme v3): false 502s Verified using v4 scheme (APK Signature Scheme v4): false 502s Verified for SourceStamp: false 502s Number of signers: 1 502s 502s 2024-03-07 20:00:29,401 DEBUG: tmp/sigcp_com.politedroid_6.apk: Verifies 502s Verified using v1 scheme (JAR signing): true 502s Verified using v2 scheme (APK Signature Scheme v2): false 502s Verified using v3 scheme (APK Signature Scheme v3): false 502s Verified using v4 scheme (APK Signature Scheme v4): false 502s Verified for SourceStamp: false 502s Number of signers: 1 502s 502s 2024-03-07 20:00:29,401 INFO: ...successfully verified 502s 2024-03-07 20:00:29,401 INFO: ...successfully verified 502s 2024-03-07 20:00:29,401 INFO: 1 successfully verified 502s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk unsigned/com.politedroid_6.apk 502s + /usr/bin/fdroid verify --reuse-remote-apk --verbose com.politedroid 502s 2024-03-07 20:00:29,853 DEBUG: ipfs_cid not found, skipping CIDv1 generation 502s 2024-03-07 20:00:29,853 INFO: Processing com.politedroid_6.apk 503s 2024-03-07 20:00:30,193 DEBUG: tmp/com.politedroid_6.apk: Verifies 503s Verified using v1 scheme (JAR signing): true 503s Verified using v2 scheme (APK Signature Scheme v2): false 503s Verified using v3 scheme (APK Signature Scheme v3): false 503s Verified using v4 scheme (APK Signature Scheme v4): false 503s Verified for SourceStamp: false 503s Number of signers: 1 503s 503s DOES NOT VERIFY 503s ERROR: res/drawable-ldpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 503s ERROR: res/drawable-mdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 503s ERROR: res/drawable-hdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 503s ERROR: res/drawable-xhdpi-v4/icon.png entry referenced by META-INF/MANIFEST.MF not found in the APK 503s 2024-03-07 20:00:30,386 ERROR: 503s tmp/sigcp_com.politedroid_6.apk: 503s 2024-03-07 20:00:30,386 INFO: ...NOT verified - tmp/sigcp_com.politedroid_6.apk 503s 2024-03-07 20:00:30,389 DEBUG: > diff -r tmp/tmp_com.politedroid_6 tmp/tmp_sigcp_com.politedroid_6 503s 2024-03-07 20:00:30,591 INFO: ...NOT verified - verification of APK with copied signature failed 503s Comparing reference APK to APK with copied signature... 503s Unexpected diff output: 503s Binary files tmp/tmp_com.politedroid_6/content/AndroidManifest.xml and tmp/tmp_sigcp_com.politedroid_6/content/AndroidManifest.xml differ 503s Binary files tmp/tmp_com.politedroid_6/content/classes.dex and tmp/tmp_sigcp_com.politedroid_6/content/classes.dex differ 503s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-hdpi 503s Only in tmp/tmp_com.politedroid_6/content/res: drawable-hdpi-v4 503s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-ldpi 503s Only in tmp/tmp_com.politedroid_6/content/res: drawable-ldpi-v4 503s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-mdpi 503s Only in tmp/tmp_com.politedroid_6/content/res: drawable-mdpi-v4 503s Only in tmp/tmp_sigcp_com.politedroid_6/content/res: drawable-xhdpi 503s Only in tmp/tmp_com.politedroid_6/content/res: drawable-xhdpi-v4 503s Binary files tmp/tmp_com.politedroid_6/content/res/xml/preferences.xml and tmp/tmp_sigcp_com.politedroid_6/content/res/xml/preferences.xml differ 503s Binary files tmp/tmp_com.politedroid_6/content/resources.arsc and tmp/tmp_sigcp_com.politedroid_6/content/resources.arsc differ 503s 503s 2024-03-07 20:00:30,592 INFO: 1 NOT verified 503s + echo_header 'test allowing disabled signatures in repo and archive' 503s ============================================================================== 503s test allowing disabled signatures in repo and archive 503s ++ create_test_dir 503s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 503s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 503s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HNWH 503s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HNWH 503s + fdroid_init_with_prebuilt_keystore 503s + '[' -z '' ']' 503s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 503s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 504s 2024-03-07 20:00:31,057 WARNING: 504s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 504s Now set these in config.yml: keystorepass, keypass, keydname 504s 504s 2024-03-07 20:00:31,058 INFO: 504s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HNWH" with this config: 504s 504s Android SDK: /usr/lib/android-sdk 504s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 504s Alias for key in store: sova 504s 504s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HNWH/repo" 504s then run "fdroid update -c; fdroid update". You might also want to edit 504s "config.yml" to set the URL, repo name, and more. You should also set up 504s a signing key (a temporary one might have been automatically generated). 504s 504s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 504s and https://f-droid.org/docs/Signing_Process 504s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 504s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 504s + echo 'allow_disabled_algorithms: true' 504s + printf '\narchive_older: 3\n' 504s + test -d metadata 504s + mkdir metadata 504s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/com.politedroid.yml metadata/ 504s + echo 'Summary: good test version of urzip' 504s + echo 'Summary: good MD5 sig, disabled algorithm' 504s + sed -i.tmp /ArchivePolicy:/d metadata/com.politedroid.yml metadata/info.guardianproject.urzip.yml metadata/org.bitbucket.tickytacky.mirrormirror.yml 504s + test -d repo 504s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-badsig.apk repo/ 504s + /usr/bin/fdroid update --pretty --nosign 504s 2024-03-07 20:00:31,522 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 504s 2024-03-07 20:00:31,617 INFO: Starting analysis on AndroidManifest.xml 504s 2024-03-07 20:00:31,626 INFO: APK file was successfully validated! 505s 2024-03-07 20:00:31,992 INFO: Starting analysis on AndroidManifest.xml 505s 2024-03-07 20:00:31,993 INFO: APK file was successfully validated! 505s 2024-03-07 20:00:32,353 INFO: Starting analysis on AndroidManifest.xml 505s 2024-03-07 20:00:32,354 INFO: APK file was successfully validated! 505s 2024-03-07 20:00:32,724 INFO: Starting analysis on AndroidManifest.xml 505s 2024-03-07 20:00:32,725 INFO: APK file was successfully validated! 506s 2024-03-07 20:00:33,084 INFO: Starting analysis on AndroidManifest.xml 506s 2024-03-07 20:00:33,085 INFO: APK file was successfully validated! 506s 2024-03-07 20:00:33,427 INFO: Starting analysis on AndroidManifest.xml 506s 2024-03-07 20:00:33,428 INFO: APK file was successfully validated! 506s 2024-03-07 20:00:33,774 INFO: Starting analysis on AndroidManifest.xml 506s 2024-03-07 20:00:33,775 INFO: APK file was successfully validated! 507s 2024-03-07 20:00:34,111 INFO: Starting analysis on AndroidManifest.xml 507s 2024-03-07 20:00:34,112 INFO: APK file was successfully validated! 507s 2024-03-07 20:00:34,455 INFO: Starting analysis on AndroidManifest.xml 507s 2024-03-07 20:00:34,456 INFO: APK file was successfully validated! 507s 2024-03-07 20:00:34,464 WARNING: repo/urzip-badsig.apk is set to android:debuggable="true" 507s DOES NOT VERIFY 507s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 507s 2024-03-07 20:00:34,788 ERROR: 507s repo/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 507s 508s 2024-03-07 20:00:35,267 WARNING: Archiving urzip-badsig.apk with invalid signature! 508s 2024-03-07 20:00:35,267 INFO: Moving urzip-badsig.apk from repo to archive 508s 2024-03-07 20:00:35,268 INFO: Starting analysis on AndroidManifest.xml 508s 2024-03-07 20:00:35,270 INFO: APK file was successfully validated! 508s 2024-03-07 20:00:35,278 WARNING: archive/urzip-badsig.apk is set to android:debuggable="true" 508s DOES NOT VERIFY 508s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 508s 2024-03-07 20:00:35,607 ERROR: 508s archive/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 508s 509s 2024-03-07 20:00:36,092 WARNING: Archiving urzip-badsig.apk with invalid signature! 509s 2024-03-07 20:00:36,093 INFO: Moving com.politedroid_3.apk from repo to archive 509s 2024-03-07 20:00:36,094 INFO: Moving org.bitbucket.tickytacky.mirrormirror_1.apk from repo to archive 509s 2024-03-07 20:00:36,704 INFO: Creating unsigned index in preparation for signing 510s 2024-03-07 20:00:37,007 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 511s 2024-03-07 20:00:38,237 INFO: Creating unsigned index in preparation for signing 511s 2024-03-07 20:00:38,541 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 512s 2024-03-07 20:00:39,165 INFO: Finished 512s ++ grep '' archive/index.xml 512s ++ wc -l 512s + test 2 -eq 2 512s ++ grep '' repo/index.xml 512s ++ wc -l 512s + test 6 -eq 6 512s + grep -F com.politedroid_3.apk archive/index.xml 512s com.politedroid_3.apk 512s + grep -F com.politedroid_4.apk repo/index.xml 512s com.politedroid_4.apk 512s com.politedroid_5.apk 512s com.politedroid_6.apk 512s org.bitbucket.tickytacky.mirrormirror_1.apk 512s org.bitbucket.tickytacky.mirrormirror_2.apk 512s org.bitbucket.tickytacky.mirrormirror_3.apk 512s org.bitbucket.tickytacky.mirrormirror_4.apk 512s + grep -F com.politedroid_5.apk repo/index.xml 512s + grep -F com.politedroid_6.apk repo/index.xml 512s + grep -F org.bitbucket.tickytacky.mirrormirror_1.apk archive/index.xml 512s + grep -F org.bitbucket.tickytacky.mirrormirror_2.apk repo/index.xml 512s + grep -F org.bitbucket.tickytacky.mirrormirror_3.apk repo/index.xml 512s + grep -F org.bitbucket.tickytacky.mirrormirror_4.apk repo/index.xml 512s + grep -F urzip-badsig.apk repo/index.xml 512s + grep -F urzip-badsig.apk archive/index.xml 512s + test -e archive/com.politedroid_3.apk 512s + test -e repo/com.politedroid_4.apk 512s + test -e repo/com.politedroid_5.apk 512s + test -e repo/com.politedroid_6.apk 512s + test -e archive/org.bitbucket.tickytacky.mirrormirror_1.apk 512s + test -e repo/org.bitbucket.tickytacky.mirrormirror_2.apk 512s + test -e repo/org.bitbucket.tickytacky.mirrormirror_3.apk 512s + test -e repo/org.bitbucket.tickytacky.mirrormirror_4.apk 512s + test -e archive/urzip-badsig.apk 512s + sed -i.tmp /apksigner:/d config.yml 512s + use_apksigner 512s + python3 -c ' 512s import sys 512s sys.path.insert(0, '\''/tmp/autopkgtest.MqVFDp/build.8ZF/src'\'') 512s from fdroidserver import common 512s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 512s common.find_apksigner(c) 512s exit(c.get('\''apksigner'\'') is None) 512s ' 512s + echo 'allow_disabled_algorithms: true' 512s + /usr/bin/fdroid update --pretty --nosign 513s 2024-03-07 20:00:40,057 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 513s 2024-03-07 20:00:40,154 INFO: Starting analysis on AndroidManifest.xml 513s 2024-03-07 20:00:40,163 INFO: APK file was successfully validated! 513s 2024-03-07 20:00:40,172 WARNING: archive/urzip-badsig.apk is set to android:debuggable="true" 513s DOES NOT VERIFY 513s ERROR: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF section for AndroidManifest.xml does not match the digest specified in META-INF/CERT.SF. Expected: , actual: 513s 2024-03-07 20:00:40,494 ERROR: 513s archive/urzip-badsig.apk: WARNING: JAR signer CERT.RSA: SHA-1 digest of META-INF/MANIFEST.MF does not match the digest specified in META-INF/CERT.SF. Expected: , actual: <5+8iqbzUfegBixjQUeg1++LwFe4=> 513s 513s 2024-03-07 20:00:40,966 WARNING: Archiving urzip-badsig.apk with invalid signature! 514s 2024-03-07 20:00:41,573 INFO: Creating unsigned index in preparation for signing 514s 2024-03-07 20:00:41,876 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 516s 2024-03-07 20:00:43,110 INFO: Creating unsigned index in preparation for signing 516s 2024-03-07 20:00:43,415 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 517s 2024-03-07 20:00:44,046 INFO: Finished 517s ++ grep '' archive/index.xml 517s ++ wc -l 517s + test 2 -eq 2 517s ++ grep '' repo/index.xml 517s ++ wc -l 517s + test 6 -eq 6 517s + grep -F com.politedroid_3.apk archive/index.xml 517s com.politedroid_3.apk 517s com.politedroid_4.apk 517s + grep -F com.politedroid_4.apk repo/index.xml 517s com.politedroid_5.apk 517s com.politedroid_6.apk 517s org.bitbucket.tickytacky.mirrormirror_1.apk 517s org.bitbucket.tickytacky.mirrormirror_2.apk 517s org.bitbucket.tickytacky.mirrormirror_3.apk 517s org.bitbucket.tickytacky.mirrormirror_4.apk 517s ============================================================================== 517s rename apks with `fdroid update --rename-apks`, --nosign for speed 517s + grep -F com.politedroid_5.apk repo/index.xml 517s + grep -F com.politedroid_6.apk repo/index.xml 517s + grep -F org.bitbucket.tickytacky.mirrormirror_1.apk archive/index.xml 517s + grep -F org.bitbucket.tickytacky.mirrormirror_2.apk repo/index.xml 517s + grep -F org.bitbucket.tickytacky.mirrormirror_3.apk repo/index.xml 517s + grep -F org.bitbucket.tickytacky.mirrormirror_4.apk repo/index.xml 517s + grep -F urzip-badsig.apk repo/index.xml 517s + grep -F urzip-badsig.apk archive/index.xml 517s + test -e archive/com.politedroid_3.apk 517s + test -e repo/com.politedroid_4.apk 517s + test -e repo/com.politedroid_5.apk 517s + test -e repo/com.politedroid_6.apk 517s + test -e archive/org.bitbucket.tickytacky.mirrormirror_1.apk 517s + test -e repo/org.bitbucket.tickytacky.mirrormirror_2.apk 517s + test -e repo/org.bitbucket.tickytacky.mirrormirror_3.apk 517s + test -e repo/org.bitbucket.tickytacky.mirrormirror_4.apk 517s + test -e archive/urzip-badsig.apk 517s + echo_header 'rename apks with `fdroid update --rename-apks`, --nosign for speed' 517s ++ create_test_dir 517s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 517s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 517s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HaV4 517s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HaV4 517s + fdroid_init_with_prebuilt_keystore 517s + '[' -z '' ']' 517s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 517s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 517s 2024-03-07 20:00:44,582 WARNING: 517s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 517s Now set these in config.yml: keystorepass, keypass, keydname 517s 517s 2024-03-07 20:00:44,582 INFO: 517s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HaV4" with this config: 517s 517s Android SDK: /usr/lib/android-sdk 517s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 517s Alias for key in store: sova 517s 517s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.HaV4/repo" 517s then run "fdroid update -c; fdroid update". You might also want to edit 517s "config.yml" to set the URL, repo name, and more. You should also set up 517s a signing key (a temporary one might have been automatically generated). 517s 517s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 517s and https://f-droid.org/docs/Signing_Process 517s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 517s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 517s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"' 517s + test -d metadata 517s + mkdir metadata 517s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/info.guardianproject.urzip.yml metadata/ 517s + test -d repo 517s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 'repo/asdfiuhk urzip-πÇÇπÇÇ现代汉语通用字-български-عربي1234 ö.apk' 517s + /usr/bin/fdroid update --rename-apks --pretty --nosign 518s 2024-03-07 20:00:45,060 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 518s 2024-03-07 20:00:45,160 INFO: Starting analysis on AndroidManifest.xml 518s 2024-03-07 20:00:45,169 INFO: APK file was successfully validated! 518s 2024-03-07 20:00:45,179 WARNING: repo/asdfiuhk urzip-πÇÇπÇÇ现代汉语通用字-български-عربي1234 ö.apk is set to android:debuggable="true" 519s 2024-03-07 20:00:46,163 INFO: Creating unsigned index in preparation for signing 519s 2024-03-07 20:00:46,468 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 520s 2024-03-07 20:00:47,197 INFO: Finished 520s + test -e repo/info.guardianproject.urzip_100.apk 520s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml 520s repo/index-v1.json: "apkName": "info.guardianproject.urzip_100.apk", 520s repo/index.xml: info.guardianproject.urzip_100.apk 520s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk repo/ 520s + /usr/bin/fdroid update --rename-apks --pretty --nosign 520s 2024-03-07 20:00:47,674 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 520s 2024-03-07 20:00:47,767 INFO: Starting analysis on AndroidManifest.xml 520s 2024-03-07 20:00:47,776 INFO: APK file was successfully validated! 520s 2024-03-07 20:00:47,785 WARNING: repo/info.guardianproject.urzip_100.apk is set to android:debuggable="true" 521s 2024-03-07 20:00:48,116 INFO: Starting analysis on AndroidManifest.xml 521s 2024-03-07 20:00:48,118 INFO: APK file was successfully validated! 522s 2024-03-07 20:00:49,077 INFO: Creating unsigned index in preparation for signing 522s 2024-03-07 20:00:49,382 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 523s 2024-03-07 20:00:50,011 INFO: Finished 523s + test -e repo/info.guardianproject.urzip_100.apk 523s + test -e repo/info.guardianproject.urzip_100_b4964fd.apk 523s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml 523s repo/index-v1.json: "apkName": "info.guardianproject.urzip_100.apk", 523s repo/index.xml: info.guardianproject.urzip_100.apk 523s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index-v1.json 523s "apkName": "info.guardianproject.urzip_100_b4964fd.apk", 523s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index.xml 523s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk repo/ 523s + /usr/bin/fdroid update --rename-apks --pretty --nosign 523s 2024-03-07 20:00:50,499 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 523s 2024-03-07 20:00:50,595 INFO: Starting analysis on AndroidManifest.xml 523s 2024-03-07 20:00:50,604 INFO: APK file was successfully validated! 523s 2024-03-07 20:00:50,614 WARNING: repo/info.guardianproject.urzip_100.apk is set to android:debuggable="true" 523s 2024-03-07 20:00:50,956 INFO: Starting analysis on AndroidManifest.xml 523s 2024-03-07 20:00:50,957 INFO: APK file was successfully validated! 524s 2024-03-07 20:00:51,306 INFO: Starting analysis on AndroidManifest.xml 524s 2024-03-07 20:00:51,308 INFO: APK file was successfully validated! 524s 2024-03-07 20:00:51,318 WARNING: Moving duplicate repo/info.guardianproject.urzip_100_b4964fd.apk to duplicates/repo/info.guardianproject.urzip_100_b4964fd.apk 524s 2024-03-07 20:00:51,925 INFO: Creating unsigned index in preparation for signing 525s 2024-03-07 20:00:52,127 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 525s 2024-03-07 20:00:52,756 INFO: Finished 525s repo/index-v1.json: "apkName": "info.guardianproject.urzip_100.apk", 525s repo/index.xml: info.guardianproject.urzip_100.apk 525s + test -e repo/info.guardianproject.urzip_100.apk 525s + test -e repo/info.guardianproject.urzip_100_b4964fd.apk 525s + test -e duplicates/repo/info.guardianproject.urzip_100_b4964fd.apk 525s + grep -F info.guardianproject.urzip_100.apk repo/index-v1.json repo/index.xml 525s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index-v1.json 525s + grep -F info.guardianproject.urzip_100_b4964fd.apk repo/index.xml 525s + echo_header 'test for added date being set correctly for repo and archive' 525s "apkName": "info.guardianproject.urzip_100_b4964fd.apk", 525s ============================================================================== 525s test for added date being set correctly for repo and archive 526s ++ create_test_dir 526s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 526s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 526s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.m3xL 526s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.m3xL 526s + fdroid_init_with_prebuilt_keystore 526s + '[' -z '' ']' 526s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 526s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 526s 2024-03-07 20:00:53,275 WARNING: 526s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 526s Now set these in config.yml: keystorepass, keypass, keydname 526s 526s 2024-03-07 20:00:53,275 INFO: 526s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.m3xL" with this config: 526s 526s Android SDK: /usr/lib/android-sdk 526s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 526s Alias for key in store: sova 526s 526s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.m3xL/repo" 526s then run "fdroid update -c; fdroid update". You might also want to edit 526s "config.yml" to set the URL, repo name, and more. You should also set up 526s a signing key (a temporary one might have been automatically generated). 526s 526s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 526s and https://f-droid.org/docs/Signing_Process 526s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 526s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 526s + printf '\narchive_older: 3\n' 526s + mkdir -p repo archive metadata stats 526s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk archive 526s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk repo 526s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/com.politedroid.yml metadata 526s + echo 'com.politedroid_4.apk com.politedroid 2016-01-01' 526s + echo 'com.politedroid_5.apk com.politedroid 2017-01-01' 526s + echo 'com.politedroid_6.apk com.politedroid 2018-01-01' 526s + sed -i -e 's/ArchivePolicy:.*/ArchivePolicy: 1 versions/' metadata/com.politedroid.yml 526s + timestamp=1483228800 526s + /usr/bin/fdroid update --pretty --nosign 526s 2024-03-07 20:00:53,748 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 526s 2024-03-07 20:00:53,843 INFO: Starting analysis on AndroidManifest.xml 526s 2024-03-07 20:00:53,852 INFO: APK file was successfully validated! 527s 2024-03-07 20:00:54,211 INFO: Starting analysis on AndroidManifest.xml 527s 2024-03-07 20:00:54,212 INFO: APK file was successfully validated! 528s 2024-03-07 20:00:55,181 INFO: Creating unsigned index in preparation for signing 528s 2024-03-07 20:00:55,484 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 529s 2024-03-07 20:00:56,713 INFO: Creating unsigned index in preparation for signing 530s 2024-03-07 20:00:57,016 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 530s 2024-03-07 20:00:57,644 INFO: Finished 530s + grep -F '"added": 1483228800' repo/index-v1.json 530s "added": 1483228800000, 530s ++ grep -F '"added": 1483228800' archive/index-v1.json 530s ++ wc -l 530s + '[' 2 == 2 ']' 530s + true 530s + echo_header 'test whatsnew from fastlane without CVC set' 530s ============================================================================== 530s test whatsnew from fastlane without CVC set 530s ++ create_test_dir 530s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 530s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 530s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.4Rxw 530s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.4Rxw 530s + fdroid_init_with_prebuilt_keystore 530s + '[' -z '' ']' 530s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 530s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 531s 2024-03-07 20:00:58,146 WARNING: 531s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 531s Now set these in config.yml: keystorepass, keypass, keydname 531s 531s 2024-03-07 20:00:58,147 INFO: 531s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.4Rxw" with this config: 531s 531s Android SDK: /usr/lib/android-sdk 531s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 531s Alias for key in store: sova 531s 531s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.4Rxw/repo" 531s then run "fdroid update -c; fdroid update". You might also want to edit 531s "config.yml" to set the URL, repo name, and more. You should also set up 531s a signing key (a temporary one might have been automatically generated). 531s 531s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 531s and https://f-droid.org/docs/Signing_Process 531s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 531s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 531s + mkdir -p metadata/com.politedroid/en-US/changelogs/ 531s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk repo 531s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/com.politedroid.yml metadata 531s + echo 'whatsnew test' 531s + sed -i -e /CurrentVersion/d metadata/com.politedroid.yml 531s + /usr/bin/fdroid update --pretty --nosign 531s 2024-03-07 20:00:58,606 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 531s 2024-03-07 20:00:58,700 INFO: Starting analysis on AndroidManifest.xml 531s 2024-03-07 20:00:58,709 INFO: APK file was successfully validated! 532s 2024-03-07 20:00:59,689 INFO: Creating unsigned index in preparation for signing 532s 2024-03-07 20:00:59,895 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 533s 2024-03-07 20:01:00,521 INFO: Finished 533s + grep -F whatsnew repo/index-v1.json 533s "whatsNew": "whatsnew test\n" 533s + echo_header 'test metadata checks' 533s ============================================================================== 533s test metadata checks 533s ++ create_test_dir 533s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 533s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 533s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.iLxK 533s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.iLxK 533s + mkdir repo 533s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.iLxK/repo/ 533s + set +e 533s + /usr/bin/fdroid build 534s 2024-03-07 20:01:01,087 CRITICAL: No app metadata found, nothing to process! 534s testing metadata checks passed 534s + '[' 1 -eq 0 ']' 534s + echo 'testing metadata checks passed' 534s + set -e 534s + mkdir /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.iLxK/metadata/ 534s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/org.smssecure.smssecure.yml /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.iLxK/metadata/ 534s + /usr/bin/fdroid readmeta 534s + echo_header 'ensure commands that don'\''t need the JDK work without a JDK configed' 534s ============================================================================== 534s ensure commands that don't need the JDK work without a JDK configed 534s ++ create_test_dir 534s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 534s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 534s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.BPMn 534s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.BPMn 534s + mkdir repo 534s + mkdir metadata 534s + echo 'License: GPL-2.0-only' 534s + echo 'Summary: Yup still fake' 534s + echo 'Categories: [Internet]' 534s + echo 'Description: |' 534s + echo ' this is fake' 534s + echo 'java_paths: {}' 534s ++ create_test_dir 534s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 534s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 534s + LOCAL_COPY_DIR=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.FmNq/fdroid 534s + mkdir -p /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.FmNq/fdroid/repo 534s + echo 'local_copy_dir: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.FmNq/fdroid' 534s + /usr/bin/fdroid checkupdates --allow-dirty 535s 2024-03-07 20:01:02,010 INFO: Processing fake 535s + which gpg 535s /usr/bin/gpg 535s + /usr/bin/fdroid gpgsign 535s + /usr/bin/fdroid lint 536s + /usr/bin/fdroid readmeta 536s + /usr/bin/fdroid rewritemeta fake 536s 2024-03-07 20:01:03,773 INFO: Rewriting 'fake' 536s + /usr/bin/fdroid deploy 537s + /usr/bin/fdroid deploy 537s + /usr/bin/fdroid scanner 538s + /usr/bin/fdroid build 538s usage: fdroid build [options] [APPID[:VERCODE] [APPID[:VERCODE] ...]] 538s fdroid build: error: option all: If you really want to build all the apps, use --all 538s + true 538s + /usr/bin/fdroid import 539s 2024-03-07 20:01:06,137 CRITICAL: Specify project url. 539s + true 539s + /usr/bin/fdroid install 539s usage: fdroid install [options] [APPID[:VERCODE] [APPID[:VERCODE] ...]] 539s fdroid install: error: option all: If you really want to install all the signed apps, use --all 539s + true 539s ============================================================================== 539s + '[' -e .git/config ']' 539s + echo_header 'test config checks of local_copy_dir' 539s test config checks of local_copy_dir 539s ++ create_test_dir 539s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 539s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 539s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.23ul 539s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.23ul 539s + /usr/bin/fdroid init 540s 2024-03-07 20:01:07,012 INFO: Generating a new key in "keystore.p12"... 549s 2024-03-07 20:01:16,048 INFO: Alias name: adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal 549s Creation date: Mar 7, 2024 549s Entry type: PrivateKeyEntry 549s Certificate chain length: 1 549s Certificate[1]: 549s Owner: CN=adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal, OU=F-Droid 549s Issuer: CN=adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal, OU=F-Droid 549s Serial number: a18e5eb6ffd696a4 549s Valid from: Thu Mar 07 20:01:14 UTC 2024 until: Mon Jul 24 20:01:14 UTC 2051 549s Certificate fingerprints: 549s SHA1: AF:2B:91:17:18:04:AC:1A:B4:C4:E0:EF:7D:9B:BE:0A:95:48:6C:9B 549s SHA256: 31:5B:66:6D:4A:26:29:C3:89:BC:5C:FE:B3:7C:38:7F:A7:A6:B1:98:A8:3A:52:09:36:99:A9:97:3C:76:E0:76 549s Signature algorithm name: SHA256withRSA 549s Subject Public Key Algorithm: 4096-bit RSA key 549s Version: 3 549s 549s Extensions: 549s 549s #1: ObjectId: 2.5.29.14 Criticality=false 549s SubjectKeyIdentifier [ 549s KeyIdentifier [ 549s 0000: DA E3 11 7A 59 39 B2 7E 7D 75 F5 B2 E7 DD C8 B5 ...zY9...u...... 549s 0010: 51 2F 64 BF Q/d. 549s ] 549s ] 549s 549s 549s 2024-03-07 20:01:16,957 INFO: 549s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.23ul" with this config: 549s 549s Android SDK: /usr/lib/android-sdk 549s Keystore for signing key: keystore.p12 549s 549s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.23ul/repo" 549s then run "fdroid update -c; fdroid update". You might also want to edit 549s "config.yml" to set the URL, repo name, and more. You should also set up 549s a signing key (a temporary one might have been automatically generated). 549s 549s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 549s and https://f-droid.org/docs/Signing_Process 550s + /usr/bin/fdroid update --create-metadata --verbose 550s 2024-03-07 20:01:17,383 DEBUG: Reading 'config.yml' 550s 2024-03-07 20:01:17,395 DEBUG: ipfs_cid not found, skipping CIDv1 generation 550s 2024-03-07 20:01:17,396 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 550s 2024-03-07 20:01:17,396 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 550s 2024-03-07 20:01:17,398 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 551s 2024-03-07 20:01:18,306 INFO: Creating signed index with this key (SHA256): 551s 2024-03-07 20:01:18,306 INFO: 31 5B 66 6D 4A 26 29 C3 89 BC 5C FE B3 7C 38 7F A7 A6 B1 98 A8 3A 52 09 36 99 A9 97 3C 76 E0 76 551s 2024-03-07 20:01:18,306 DEBUG: Directory: repo 551s 2024-03-07 20:01:18,306 DEBUG: > jar cf index.jar index.xml 551s 2024-03-07 20:01:18,611 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 552s jar signed. 552s 552s Warning: 552s The signer's certificate is self-signed. 552s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 552s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 553s 2024-03-07 20:01:20,024 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 553s 2024-03-07 20:01:20,034 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 554s jar signed. 554s 554s Warning: 554s The signer's certificate is self-signed. 554s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 554s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 554s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 554s 2024-03-07 20:01:21,747 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar 555s 2024-03-07 20:01:22,756 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 556s 2024-03-07 20:01:23,678 DEBUG: Outputting JSON 556s 2024-03-07 20:01:23,678 DEBUG: skip deploying full build logs: not enabled in config 556s 2024-03-07 20:01:23,678 DEBUG: skip deploying full build logs: not enabled in config 556s 2024-03-07 20:01:23,679 DEBUG: skip deploying full build logs: not enabled in config 556s 2024-03-07 20:01:23,679 INFO: Finished 556s + /usr/bin/fdroid readmeta 557s ++ create_test_dir 557s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 557s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 557s + LOCAL_COPY_DIR=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.nPMG/fdroid 557s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.nPMG/fdroid 557s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.nPMG/fdroid --verbose 557s 2024-03-07 20:01:24,967 DEBUG: Reading 'config.yml' 558s 2024-03-07 20:01:24,977 DEBUG: ipfs_cid not found, skipping CIDv1 generation 558s 2024-03-07 20:01:24,978 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.nPMG/fdroid/ 558s sending incremental file list 558s repo/status/ 558s repo/status/deploy.json 558s repo/status/running.json 558s 558s sent 1,582 bytes received 70 bytes 3,304.00 bytes/sec 558s total size is 26,111 speedup is 15.81 558s 2024-03-07 20:01:25,005 DEBUG: skip deploying full build logs: not enabled in config 558s 2024-03-07 20:01:25,007 DEBUG: skip deploying full build logs: not enabled in config 558s 2024-03-07 20:01:25,008 DEBUG: skip deploying full build logs: not enabled in config 558s + set +e 558s + /usr/bin/fdroid deploy --local-copy-dir=thisisnotanabsolutepath 558s 2024-03-07 20:01:25,425 ERROR: The root dir for local_copy_dir "" does not exist! 558s testing absolute path checker passed 558s + '[' 1 -eq 0 ']' 558s + echo 'testing absolute path checker passed' 558s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/IReallyDoubtThisPathExistsasdfasdf 558s 2024-03-07 20:01:25,857 ERROR: local_copy_dir does not end with "fdroid", perhaps you meant: "/tmp/IReallyDoubtThisPathExistsasdfasdf/fdroid" 558s testing dirname exists checker passed 558s + '[' 1 -eq 0 ']' 558s + echo 'testing dirname exists checker passed' 558s + /usr/bin/fdroid deploy --local-copy-dir=/tmp/IReallyDoubtThisPathExistsasdfasdf/fdroid 559s 2024-03-07 20:01:26,280 ERROR: The root dir for local_copy_dir "/tmp/IReallyDoubtThisPathExistsasdfasdf" does not exist! 559s testing dirname exists checker passed 559s ============================================================================== 559s setup a new repo from scratch using ANDROID_HOME and do a local sync 559s + '[' 1 -eq 0 ']' 559s + echo 'testing dirname exists checker passed' 559s + set -e 559s + echo_header 'setup a new repo from scratch using ANDROID_HOME and do a local sync' 559s ++ create_test_dir 559s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 559s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 559s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.itLO 559s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.itLO 559s + fdroid_init_with_prebuilt_keystore 559s + '[' -z '' ']' 559s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 559s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 559s 2024-03-07 20:01:26,710 WARNING: 559s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 559s Now set these in config.yml: keystorepass, keypass, keydname 559s 559s 2024-03-07 20:01:26,711 INFO: 559s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.itLO" with this config: 559s 559s Android SDK: /usr/lib/android-sdk 559s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 559s Alias for key in store: sova 559s 559s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.itLO/repo" 559s then run "fdroid update -c; fdroid update". You might also want to edit 559s "config.yml" to set the URL, repo name, and more. You should also set up 559s a signing key (a temporary one might have been automatically generated). 559s 559s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 559s and https://f-droid.org/docs/Signing_Process 559s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 559s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 559s + copy_apks_into_repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.itLO 559s + set +x 559s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.dyndns.fules.ck_20.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 560s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 561s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 562s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 563s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 564s Requested API level 30 is larger than maximum we have, returning API level 28 instead. 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk 564s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 564s + /usr/bin/fdroid update --create-metadata --verbose 565s 2024-03-07 20:01:32,230 DEBUG: Reading 'config.yml' 565s 2024-03-07 20:01:32,242 DEBUG: ipfs_cid not found, skipping CIDv1 generation 565s 2024-03-07 20:01:32,243 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 565s 2024-03-07 20:01:32,243 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 565s 2024-03-07 20:01:32,244 DEBUG: Processing SpeedoMeterApp.main_1.apk 565s 2024-03-07 20:01:32,329 INFO: Starting analysis on AndroidManifest.xml 565s 2024-03-07 20:01:32,337 INFO: APK file was successfully validated! 565s 2024-03-07 20:01:32,339 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 565s 2024-03-07 20:01:32,345 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 565s 2024-03-07 20:01:32,665 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 565s Verified using v1 scheme (JAR signing): true 565s Verified using v2 scheme (APK Signature Scheme v2): false 565s Verified using v3 scheme (APK Signature Scheme v3): false 565s Verified using v4 scheme (APK Signature Scheme v4): false 565s Verified for SourceStamp: false 565s Number of signers: 1 565s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 565s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 565s 565s 2024-03-07 20:01:32,666 DEBUG: Processing apk.embedded_1.apk 565s 2024-03-07 20:01:32,666 INFO: Starting analysis on AndroidManifest.xml 565s 2024-03-07 20:01:32,666 INFO: APK file was successfully validated! 565s 2024-03-07 20:01:32,668 DEBUG: Getting signature of apk.embedded_1.apk 566s 2024-03-07 20:01:33,031 DEBUG: repo/apk.embedded_1.apk: Verifies 566s Verified using v1 scheme (JAR signing): true 566s Verified using v2 scheme (APK Signature Scheme v2): true 566s Verified using v3 scheme (APK Signature Scheme v3): true 566s Verified using v4 scheme (APK Signature Scheme v4): false 566s Verified for SourceStamp: false 566s Number of signers: 1 566s 566s 2024-03-07 20:01:33,032 DEBUG: Processing com.example.test.helloworld_1.apk 566s 2024-03-07 20:01:33,032 INFO: Starting analysis on AndroidManifest.xml 566s 2024-03-07 20:01:33,033 INFO: APK file was successfully validated! 566s 2024-03-07 20:01:33,035 DEBUG: Getting signature of com.example.test.helloworld_1.apk 566s 2024-03-07 20:01:33,367 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 566s Verified using v1 scheme (JAR signing): true 566s Verified using v2 scheme (APK Signature Scheme v2): false 566s Verified using v3 scheme (APK Signature Scheme v3): false 566s Verified using v4 scheme (APK Signature Scheme v4): false 566s Verified for SourceStamp: false 566s Number of signers: 1 566s 566s 2024-03-07 20:01:33,368 DEBUG: Processing com.politedroid_3.apk 566s 2024-03-07 20:01:33,368 INFO: Starting analysis on AndroidManifest.xml 566s 2024-03-07 20:01:33,369 INFO: APK file was successfully validated! 566s 2024-03-07 20:01:33,371 DEBUG: Getting signature of com.politedroid_3.apk 566s 2024-03-07 20:01:33,719 DEBUG: repo/com.politedroid_3.apk: Verifies 566s Verified using v1 scheme (JAR signing): true 566s Verified using v2 scheme (APK Signature Scheme v2): false 566s Verified using v3 scheme (APK Signature Scheme v3): false 566s Verified using v4 scheme (APK Signature Scheme v4): false 566s Verified for SourceStamp: false 566s Number of signers: 1 566s 566s 2024-03-07 20:01:33,724 DEBUG: Processing com.politedroid_4.apk 566s 2024-03-07 20:01:33,724 INFO: Starting analysis on AndroidManifest.xml 566s 2024-03-07 20:01:33,725 INFO: APK file was successfully validated! 566s 2024-03-07 20:01:33,727 DEBUG: Getting signature of com.politedroid_4.apk 567s 2024-03-07 20:01:34,086 DEBUG: repo/com.politedroid_4.apk: Verifies 567s Verified using v1 scheme (JAR signing): true 567s Verified using v2 scheme (APK Signature Scheme v2): false 567s Verified using v3 scheme (APK Signature Scheme v3): false 567s Verified using v4 scheme (APK Signature Scheme v4): false 567s Verified for SourceStamp: false 567s Number of signers: 1 567s 567s 2024-03-07 20:01:34,088 DEBUG: Processing com.politedroid_5.apk 567s 2024-03-07 20:01:34,089 INFO: Starting analysis on AndroidManifest.xml 567s 2024-03-07 20:01:34,089 INFO: APK file was successfully validated! 567s 2024-03-07 20:01:34,091 DEBUG: Getting signature of com.politedroid_5.apk 567s 2024-03-07 20:01:34,442 DEBUG: repo/com.politedroid_5.apk: Verifies 567s Verified using v1 scheme (JAR signing): true 567s Verified using v2 scheme (APK Signature Scheme v2): false 567s Verified using v3 scheme (APK Signature Scheme v3): false 567s Verified using v4 scheme (APK Signature Scheme v4): false 567s Verified for SourceStamp: false 567s Number of signers: 1 567s 567s 2024-03-07 20:01:34,444 DEBUG: Processing com.politedroid_6.apk 567s 2024-03-07 20:01:34,444 INFO: Starting analysis on AndroidManifest.xml 567s 2024-03-07 20:01:34,445 INFO: APK file was successfully validated! 567s 2024-03-07 20:01:34,448 DEBUG: Getting signature of com.politedroid_6.apk 567s 2024-03-07 20:01:34,795 DEBUG: repo/com.politedroid_6.apk: Verifies 567s Verified using v1 scheme (JAR signing): true 567s Verified using v2 scheme (APK Signature Scheme v2): false 567s Verified using v3 scheme (APK Signature Scheme v3): false 567s Verified using v4 scheme (APK Signature Scheme v4): false 567s Verified for SourceStamp: false 567s Number of signers: 1 567s 567s 2024-03-07 20:01:34,797 DEBUG: Processing duplicate.permisssions_9999999.apk 567s 2024-03-07 20:01:34,798 INFO: Starting analysis on AndroidManifest.xml 567s 2024-03-07 20:01:34,799 INFO: APK file was successfully validated! 567s 2024-03-07 20:01:34,802 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 567s 2024-03-07 20:01:34,808 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 568s 2024-03-07 20:01:35,176 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 568s Verified using v1 scheme (JAR signing): true 568s Verified using v2 scheme (APK Signature Scheme v2): true 568s Verified using v3 scheme (APK Signature Scheme v3): false 568s Verified using v4 scheme (APK Signature Scheme v4): false 568s Verified for SourceStamp: false 568s Number of signers: 1 568s 568s 2024-03-07 20:01:35,177 DEBUG: Density 120 not available, resizing down from 160 568s 2024-03-07 20:01:35,178 DEBUG: Processing info.guardianproject.urzip_100.apk 568s 2024-03-07 20:01:35,179 INFO: Starting analysis on AndroidManifest.xml 568s 2024-03-07 20:01:35,180 INFO: APK file was successfully validated! 568s 2024-03-07 20:01:35,182 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 568s 2024-03-07 20:01:35,527 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 568s Verified using v1 scheme (JAR signing): true 568s Verified using v2 scheme (APK Signature Scheme v2): false 568s Verified using v3 scheme (APK Signature Scheme v3): false 568s Verified using v4 scheme (APK Signature Scheme v4): false 568s Verified for SourceStamp: false 568s Number of signers: 1 568s 568s 2024-03-07 20:01:35,528 DEBUG: Density 120 not available, resizing down from 160 568s 2024-03-07 20:01:35,529 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 568s 2024-03-07 20:01:35,530 INFO: Starting analysis on AndroidManifest.xml 568s 2024-03-07 20:01:35,530 INFO: APK file was successfully validated! 568s 2024-03-07 20:01:35,532 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 568s 2024-03-07 20:01:35,877 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 568s Verified using v1 scheme (JAR signing): true 568s Verified using v2 scheme (APK Signature Scheme v2): false 568s Verified using v3 scheme (APK Signature Scheme v3): false 568s Verified using v4 scheme (APK Signature Scheme v4): false 568s Verified for SourceStamp: false 568s Number of signers: 1 568s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 568s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 568s 568s 2024-03-07 20:01:35,877 DEBUG: Processing no.min.target.sdk_987.apk 568s 2024-03-07 20:01:35,878 INFO: Starting analysis on AndroidManifest.xml 568s 2024-03-07 20:01:35,879 INFO: APK file was successfully validated! 568s 2024-03-07 20:01:35,881 DEBUG: Getting signature of no.min.target.sdk_987.apk 568s 2024-03-07 20:01:35,889 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 569s 2024-03-07 20:01:36,271 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 569s Verified using v1 scheme (JAR signing): true 569s Verified using v2 scheme (APK Signature Scheme v2): true 569s Verified using v3 scheme (APK Signature Scheme v3): false 569s Verified using v4 scheme (APK Signature Scheme v4): false 569s Verified for SourceStamp: false 569s Number of signers: 1 569s 569s 2024-03-07 20:01:36,272 DEBUG: Density 120 not available, resizing down from 160 569s 2024-03-07 20:01:36,273 DEBUG: Processing obb.main.oldversion_1444412523.apk 569s 2024-03-07 20:01:36,273 INFO: Starting analysis on AndroidManifest.xml 569s 2024-03-07 20:01:36,276 INFO: APK file was successfully validated! 569s 2024-03-07 20:01:36,277 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 569s 2024-03-07 20:01:36,662 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 569s Verified using v1 scheme (JAR signing): true 569s Verified using v2 scheme (APK Signature Scheme v2): true 569s Verified using v3 scheme (APK Signature Scheme v3): false 569s Verified using v4 scheme (APK Signature Scheme v4): false 569s Verified for SourceStamp: false 569s Number of signers: 1 569s 569s 2024-03-07 20:01:36,663 DEBUG: Density 120 not available, resizing down from 160 569s 2024-03-07 20:01:36,664 DEBUG: Processing obb.main.twoversions_1101613.apk 569s 2024-03-07 20:01:36,665 INFO: Starting analysis on AndroidManifest.xml 569s 2024-03-07 20:01:36,666 INFO: APK file was successfully validated! 569s 2024-03-07 20:01:36,668 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 570s 2024-03-07 20:01:37,017 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 570s Verified using v1 scheme (JAR signing): true 570s Verified using v2 scheme (APK Signature Scheme v2): false 570s Verified using v3 scheme (APK Signature Scheme v3): false 570s Verified using v4 scheme (APK Signature Scheme v4): false 570s Verified for SourceStamp: false 570s Number of signers: 1 570s 570s 2024-03-07 20:01:37,018 DEBUG: Density 120 not available, resizing down from 160 570s 2024-03-07 20:01:37,020 DEBUG: Processing obb.main.twoversions_1101615.apk 570s 2024-03-07 20:01:37,020 INFO: Starting analysis on AndroidManifest.xml 570s 2024-03-07 20:01:37,021 INFO: APK file was successfully validated! 570s 2024-03-07 20:01:37,023 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 570s 2024-03-07 20:01:37,359 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 570s Verified using v1 scheme (JAR signing): true 570s Verified using v2 scheme (APK Signature Scheme v2): false 570s Verified using v3 scheme (APK Signature Scheme v3): false 570s Verified using v4 scheme (APK Signature Scheme v4): false 570s Verified for SourceStamp: false 570s Number of signers: 1 570s 570s 2024-03-07 20:01:37,360 DEBUG: Density 120 not available, resizing down from 160 570s 2024-03-07 20:01:37,362 DEBUG: Processing obb.main.twoversions_1101617.apk 570s 2024-03-07 20:01:37,362 INFO: Starting analysis on AndroidManifest.xml 570s 2024-03-07 20:01:37,363 INFO: APK file was successfully validated! 570s 2024-03-07 20:01:37,365 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 570s 2024-03-07 20:01:37,703 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 570s Verified using v1 scheme (JAR signing): true 570s Verified using v2 scheme (APK Signature Scheme v2): false 570s Verified using v3 scheme (APK Signature Scheme v3): false 570s Verified using v4 scheme (APK Signature Scheme v4): false 570s Verified for SourceStamp: false 570s Number of signers: 1 570s 570s 2024-03-07 20:01:37,704 DEBUG: Density 120 not available, resizing down from 160 570s 2024-03-07 20:01:37,706 DEBUG: Processing obb.mainpatch.current_1619.apk 570s 2024-03-07 20:01:37,706 INFO: Starting analysis on AndroidManifest.xml 570s 2024-03-07 20:01:37,707 INFO: APK file was successfully validated! 570s 2024-03-07 20:01:37,709 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 571s 2024-03-07 20:01:38,054 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 571s Verified using v1 scheme (JAR signing): true 571s Verified using v2 scheme (APK Signature Scheme v2): false 571s Verified using v3 scheme (APK Signature Scheme v3): false 571s Verified using v4 scheme (APK Signature Scheme v4): false 571s Verified for SourceStamp: false 571s Number of signers: 1 571s 571s 2024-03-07 20:01:38,055 DEBUG: Density 120 not available, resizing down from 160 571s 2024-03-07 20:01:38,056 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 571s 2024-03-07 20:01:38,057 INFO: Starting analysis on AndroidManifest.xml 571s 2024-03-07 20:01:38,057 INFO: APK file was successfully validated! 571s 2024-03-07 20:01:38,059 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 571s 2024-03-07 20:01:38,385 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 571s Verified using v1 scheme (JAR signing): true 571s Verified using v2 scheme (APK Signature Scheme v2): false 571s Verified using v3 scheme (APK Signature Scheme v3): false 571s Verified using v4 scheme (APK Signature Scheme v4): false 571s Verified for SourceStamp: false 571s Number of signers: 1 571s 571s 2024-03-07 20:01:38,386 DEBUG: Density 120 not available, resizing down from 160 571s 2024-03-07 20:01:38,387 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 571s 2024-03-07 20:01:38,388 INFO: Starting analysis on AndroidManifest.xml 571s 2024-03-07 20:01:38,389 INFO: APK file was successfully validated! 571s 2024-03-07 20:01:38,390 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 571s 2024-03-07 20:01:38,728 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 571s Verified using v1 scheme (JAR signing): true 571s Verified using v2 scheme (APK Signature Scheme v2): false 571s Verified using v3 scheme (APK Signature Scheme v3): false 571s Verified using v4 scheme (APK Signature Scheme v4): false 571s Verified for SourceStamp: false 571s Number of signers: 1 571s 571s 2024-03-07 20:01:38,729 DEBUG: Density 120 not available, resizing down from 160 571s 2024-03-07 20:01:38,730 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 571s 2024-03-07 20:01:38,731 INFO: Starting analysis on AndroidManifest.xml 571s 2024-03-07 20:01:38,732 INFO: APK file was successfully validated! 571s 2024-03-07 20:01:38,733 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 572s 2024-03-07 20:01:39,069 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 572s Verified using v1 scheme (JAR signing): true 572s Verified using v2 scheme (APK Signature Scheme v2): false 572s Verified using v3 scheme (APK Signature Scheme v3): false 572s Verified using v4 scheme (APK Signature Scheme v4): false 572s Verified for SourceStamp: false 572s Number of signers: 1 572s 572s 2024-03-07 20:01:39,070 DEBUG: Density 120 not available, resizing down from 160 572s 2024-03-07 20:01:39,071 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 572s 2024-03-07 20:01:39,072 INFO: Starting analysis on AndroidManifest.xml 572s 2024-03-07 20:01:39,072 INFO: APK file was successfully validated! 572s 2024-03-07 20:01:39,074 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 572s 2024-03-07 20:01:39,407 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 572s Verified using v1 scheme (JAR signing): true 572s Verified using v2 scheme (APK Signature Scheme v2): false 572s Verified using v3 scheme (APK Signature Scheme v3): false 572s Verified using v4 scheme (APK Signature Scheme v4): false 572s Verified for SourceStamp: false 572s Number of signers: 1 572s 572s 2024-03-07 20:01:39,408 DEBUG: Density 120 not available, resizing down from 160 572s 2024-03-07 20:01:39,409 DEBUG: Processing org.dyndns.fules.ck_20.apk 572s 2024-03-07 20:01:39,409 INFO: Starting analysis on AndroidManifest.xml 572s 2024-03-07 20:01:39,411 INFO: APK file was successfully validated! 572s 2024-03-07 20:01:39,413 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 572s 2024-03-07 20:01:39,818 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 572s Verified using v1 scheme (JAR signing): true 572s Verified using v2 scheme (APK Signature Scheme v2): false 572s Verified using v3 scheme (APK Signature Scheme v3): false 572s Verified using v4 scheme (APK Signature Scheme v4): false 572s Verified for SourceStamp: false 572s Number of signers: 1 572s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 572s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 572s 572s 2024-03-07 20:01:39,820 DEBUG: Processing souch.smsbypass_9.apk 572s 2024-03-07 20:01:39,821 INFO: Starting analysis on AndroidManifest.xml 572s 2024-03-07 20:01:39,822 INFO: APK file was successfully validated! 572s 2024-03-07 20:01:39,825 DEBUG: Getting signature of souch.smsbypass_9.apk 573s 2024-03-07 20:01:40,206 DEBUG: repo/souch.smsbypass_9.apk: Verifies 573s Verified using v1 scheme (JAR signing): true 573s Verified using v2 scheme (APK Signature Scheme v2): false 573s Verified using v3 scheme (APK Signature Scheme v3): false 573s Verified using v4 scheme (APK Signature Scheme v4): false 573s Verified for SourceStamp: false 573s Number of signers: 1 573s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 573s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 573s 573s 2024-03-07 20:01:40,207 DEBUG: Density 120 not available, resizing down from 160 573s 2024-03-07 20:01:40,209 DEBUG: Processing v1.v2.sig_1020.apk 573s 2024-03-07 20:01:40,209 INFO: Starting analysis on AndroidManifest.xml 573s 2024-03-07 20:01:40,210 INFO: APK file was successfully validated! 573s 2024-03-07 20:01:40,212 DEBUG: Getting signature of v1.v2.sig_1020.apk 573s 2024-03-07 20:01:40,590 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 573s Verified using v1 scheme (JAR signing): true 573s Verified using v2 scheme (APK Signature Scheme v2): true 573s Verified using v3 scheme (APK Signature Scheme v3): false 573s Verified using v4 scheme (APK Signature Scheme v4): false 573s Verified for SourceStamp: false 573s Number of signers: 1 573s 573s 2024-03-07 20:01:40,591 DEBUG: Density 120 not available, resizing down from 160 573s 2024-03-07 20:01:40,593 DEBUG: Processing v2.only.sig_2.apk 573s 2024-03-07 20:01:40,593 INFO: Starting analysis on AndroidManifest.xml 573s 2024-03-07 20:01:40,594 INFO: APK file was successfully validated! 573s 2024-03-07 20:01:40,596 DEBUG: Getting signature of v2.only.sig_2.apk 573s 2024-03-07 20:01:40,596 INFO: Starting analysis on AndroidManifest.xml 573s 2024-03-07 20:01:40,597 INFO: APK file was successfully validated! 573s 2024-03-07 20:01:40,598 DEBUG: Using APK Signature v2 573s 2024-03-07 20:01:40,599 INFO: Starting analysis on AndroidManifest.xml 573s 2024-03-07 20:01:40,600 INFO: APK file was successfully validated! 573s 2024-03-07 20:01:40,601 DEBUG: Using APK Signature v2 573s 2024-03-07 20:01:40,895 DEBUG: repo/v2.only.sig_2.apk: Verifies 573s Verified using v1 scheme (JAR signing): false 573s Verified using v2 scheme (APK Signature Scheme v2): true 573s Verified using v3 scheme (APK Signature Scheme v3): false 573s Verified using v4 scheme (APK Signature Scheme v4): false 573s Verified for SourceStamp: false 573s Number of signers: 1 573s 573s 2024-03-07 20:01:40,895 DEBUG: Density 120 not available, resizing down from 160 573s 2024-03-07 20:01:40,898 INFO: Generated skeleton metadata for SpeedoMeterApp.main 573s 2024-03-07 20:01:40,900 INFO: Generated skeleton metadata for apk.embedded 573s 2024-03-07 20:01:40,902 INFO: Generated skeleton metadata for com.example.test.helloworld 573s 2024-03-07 20:01:40,904 INFO: Generated skeleton metadata for com.politedroid 573s 2024-03-07 20:01:40,906 INFO: Generated skeleton metadata for duplicate.permisssions 573s 2024-03-07 20:01:40,909 INFO: Generated skeleton metadata for info.guardianproject.urzip 573s 2024-03-07 20:01:40,912 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 573s 2024-03-07 20:01:40,916 INFO: Generated skeleton metadata for no.min.target.sdk 573s 2024-03-07 20:01:40,920 INFO: Generated skeleton metadata for obb.main.oldversion 573s 2024-03-07 20:01:40,924 INFO: Generated skeleton metadata for obb.main.twoversions 573s 2024-03-07 20:01:40,929 INFO: Generated skeleton metadata for obb.mainpatch.current 573s 2024-03-07 20:01:40,935 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 573s 2024-03-07 20:01:40,940 INFO: Generated skeleton metadata for org.dyndns.fules.ck 573s 2024-03-07 20:01:40,946 INFO: Generated skeleton metadata for souch.smsbypass 573s 2024-03-07 20:01:40,953 INFO: Generated skeleton metadata for v1.v2.sig 573s 2024-03-07 20:01:40,959 INFO: Generated skeleton metadata for v2.only.sig 573s 2024-03-07 20:01:40,969 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 574s 574s Warning: 574s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 574s 2024-03-07 20:01:41,677 INFO: Creating signed index with this key (SHA256): 574s 2024-03-07 20:01:41,677 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 574s 2024-03-07 20:01:41,677 DEBUG: Directory: repo 574s 2024-03-07 20:01:41,677 DEBUG: > jar cf index.jar index.xml 574s 2024-03-07 20:01:41,879 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 575s jar signed. 575s 575s Warning: 575s The signer's certificate is self-signed. 575s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 575s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 576s 2024-03-07 20:01:42,987 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 576s 2024-03-07 20:01:42,997 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 576s jar signed. 576s 576s Warning: 576s The signer's certificate is self-signed. 576s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 576s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 576s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 577s 2024-03-07 20:01:44,010 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 577s 2024-03-07 20:01:44,615 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 578s 578s Warning: 578s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 578s 2024-03-07 20:01:45,332 DEBUG: Outputting JSON 578s 2024-03-07 20:01:45,333 DEBUG: skip deploying full build logs: not enabled in config 578s 2024-03-07 20:01:45,333 DEBUG: skip deploying full build logs: not enabled in config 578s 2024-03-07 20:01:45,334 DEBUG: skip deploying full build logs: not enabled in config 578s 2024-03-07 20:01:45,334 INFO: Finished 578s + /usr/bin/fdroid readmeta 578s + grep -F ' repo/org.dyndns.fules.ck_20.apk 607s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk 607s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 607s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 608s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 609s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 610s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 611s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 612s Requested API level 30 is larger than maximum we have, returning API level 28 instead. 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk 612s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 612s + /usr/bin/fdroid update --create-metadata --verbose 613s 2024-03-07 20:02:20,074 DEBUG: Reading 'config.yml' 613s 2024-03-07 20:02:20,087 DEBUG: ipfs_cid not found, skipping CIDv1 generation 613s 2024-03-07 20:02:20,087 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 613s 2024-03-07 20:02:20,087 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 613s 2024-03-07 20:02:20,088 DEBUG: Processing SpeedoMeterApp.main_1.apk 613s 2024-03-07 20:02:20,176 INFO: Starting analysis on AndroidManifest.xml 613s 2024-03-07 20:02:20,185 INFO: APK file was successfully validated! 613s 2024-03-07 20:02:20,187 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 613s 2024-03-07 20:02:20,193 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 613s 2024-03-07 20:02:20,515 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 613s Verified using v1 scheme (JAR signing): true 613s Verified using v2 scheme (APK Signature Scheme v2): false 613s Verified using v3 scheme (APK Signature Scheme v3): false 613s Verified using v4 scheme (APK Signature Scheme v4): false 613s Verified for SourceStamp: false 613s Number of signers: 1 613s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 613s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 613s 613s 2024-03-07 20:02:20,516 DEBUG: Processing apk.embedded_1.apk 613s 2024-03-07 20:02:20,516 INFO: Starting analysis on AndroidManifest.xml 613s 2024-03-07 20:02:20,517 INFO: APK file was successfully validated! 613s 2024-03-07 20:02:20,518 DEBUG: Getting signature of apk.embedded_1.apk 613s 2024-03-07 20:02:20,877 DEBUG: repo/apk.embedded_1.apk: Verifies 613s Verified using v1 scheme (JAR signing): true 613s Verified using v2 scheme (APK Signature Scheme v2): true 613s Verified using v3 scheme (APK Signature Scheme v3): true 613s Verified using v4 scheme (APK Signature Scheme v4): false 613s Verified for SourceStamp: false 613s Number of signers: 1 613s 613s 2024-03-07 20:02:20,877 DEBUG: Processing com.example.test.helloworld_1.apk 613s 2024-03-07 20:02:20,877 INFO: Starting analysis on AndroidManifest.xml 613s 2024-03-07 20:02:20,878 INFO: APK file was successfully validated! 613s 2024-03-07 20:02:20,880 DEBUG: Getting signature of com.example.test.helloworld_1.apk 614s 2024-03-07 20:02:21,217 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 614s Verified using v1 scheme (JAR signing): true 614s Verified using v2 scheme (APK Signature Scheme v2): false 614s Verified using v3 scheme (APK Signature Scheme v3): false 614s Verified using v4 scheme (APK Signature Scheme v4): false 614s Verified for SourceStamp: false 614s Number of signers: 1 614s 614s 2024-03-07 20:02:21,217 DEBUG: Processing com.politedroid_3.apk 614s 2024-03-07 20:02:21,218 INFO: Starting analysis on AndroidManifest.xml 614s 2024-03-07 20:02:21,218 INFO: APK file was successfully validated! 614s 2024-03-07 20:02:21,220 DEBUG: Getting signature of com.politedroid_3.apk 614s 2024-03-07 20:02:21,561 DEBUG: repo/com.politedroid_3.apk: Verifies 614s Verified using v1 scheme (JAR signing): true 614s Verified using v2 scheme (APK Signature Scheme v2): false 614s Verified using v3 scheme (APK Signature Scheme v3): false 614s Verified using v4 scheme (APK Signature Scheme v4): false 614s Verified for SourceStamp: false 614s Number of signers: 1 614s 614s 2024-03-07 20:02:21,566 DEBUG: Processing com.politedroid_4.apk 614s 2024-03-07 20:02:21,566 INFO: Starting analysis on AndroidManifest.xml 614s 2024-03-07 20:02:21,567 INFO: APK file was successfully validated! 614s 2024-03-07 20:02:21,569 DEBUG: Getting signature of com.politedroid_4.apk 614s 2024-03-07 20:02:21,910 DEBUG: repo/com.politedroid_4.apk: Verifies 614s Verified using v1 scheme (JAR signing): true 614s Verified using v2 scheme (APK Signature Scheme v2): false 614s Verified using v3 scheme (APK Signature Scheme v3): false 614s Verified using v4 scheme (APK Signature Scheme v4): false 614s Verified for SourceStamp: false 614s Number of signers: 1 614s 614s 2024-03-07 20:02:21,912 DEBUG: Processing com.politedroid_5.apk 614s 2024-03-07 20:02:21,913 INFO: Starting analysis on AndroidManifest.xml 614s 2024-03-07 20:02:21,913 INFO: APK file was successfully validated! 614s 2024-03-07 20:02:21,915 DEBUG: Getting signature of com.politedroid_5.apk 615s 2024-03-07 20:02:22,260 DEBUG: repo/com.politedroid_5.apk: Verifies 615s Verified using v1 scheme (JAR signing): true 615s Verified using v2 scheme (APK Signature Scheme v2): false 615s Verified using v3 scheme (APK Signature Scheme v3): false 615s Verified using v4 scheme (APK Signature Scheme v4): false 615s Verified for SourceStamp: false 615s Number of signers: 1 615s 615s 2024-03-07 20:02:22,262 DEBUG: Processing com.politedroid_6.apk 615s 2024-03-07 20:02:22,262 INFO: Starting analysis on AndroidManifest.xml 615s 2024-03-07 20:02:22,263 INFO: APK file was successfully validated! 615s 2024-03-07 20:02:22,266 DEBUG: Getting signature of com.politedroid_6.apk 615s 2024-03-07 20:02:22,610 DEBUG: repo/com.politedroid_6.apk: Verifies 615s Verified using v1 scheme (JAR signing): true 615s Verified using v2 scheme (APK Signature Scheme v2): false 615s Verified using v3 scheme (APK Signature Scheme v3): false 615s Verified using v4 scheme (APK Signature Scheme v4): false 615s Verified for SourceStamp: false 615s Number of signers: 1 615s 615s 2024-03-07 20:02:22,612 DEBUG: Processing duplicate.permisssions_9999999.apk 615s 2024-03-07 20:02:22,613 INFO: Starting analysis on AndroidManifest.xml 615s 2024-03-07 20:02:22,615 INFO: APK file was successfully validated! 615s 2024-03-07 20:02:22,617 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 615s 2024-03-07 20:02:22,623 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 615s 2024-03-07 20:02:22,972 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 615s Verified using v1 scheme (JAR signing): true 615s Verified using v2 scheme (APK Signature Scheme v2): true 615s Verified using v3 scheme (APK Signature Scheme v3): false 615s Verified using v4 scheme (APK Signature Scheme v4): false 615s Verified for SourceStamp: false 615s Number of signers: 1 615s 616s 2024-03-07 20:02:22,973 DEBUG: Density 120 not available, resizing down from 160 616s 2024-03-07 20:02:22,975 DEBUG: Processing info.guardianproject.urzip_100.apk 616s 2024-03-07 20:02:22,975 INFO: Starting analysis on AndroidManifest.xml 616s 2024-03-07 20:02:22,976 INFO: APK file was successfully validated! 616s 2024-03-07 20:02:22,978 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 616s 2024-03-07 20:02:23,325 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 616s Verified using v1 scheme (JAR signing): true 616s Verified using v2 scheme (APK Signature Scheme v2): false 616s Verified using v3 scheme (APK Signature Scheme v3): false 616s Verified using v4 scheme (APK Signature Scheme v4): false 616s Verified for SourceStamp: false 616s Number of signers: 1 616s 616s 2024-03-07 20:02:23,326 DEBUG: Density 120 not available, resizing down from 160 616s 2024-03-07 20:02:23,327 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 616s 2024-03-07 20:02:23,328 INFO: Starting analysis on AndroidManifest.xml 616s 2024-03-07 20:02:23,329 INFO: APK file was successfully validated! 616s 2024-03-07 20:02:23,331 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 616s 2024-03-07 20:02:23,676 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 616s Verified using v1 scheme (JAR signing): true 616s Verified using v2 scheme (APK Signature Scheme v2): false 616s Verified using v3 scheme (APK Signature Scheme v3): false 616s Verified using v4 scheme (APK Signature Scheme v4): false 616s Verified for SourceStamp: false 616s Number of signers: 1 616s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 616s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 616s 616s 2024-03-07 20:02:23,677 DEBUG: Processing no.min.target.sdk_987.apk 616s 2024-03-07 20:02:23,677 INFO: Starting analysis on AndroidManifest.xml 616s 2024-03-07 20:02:23,679 INFO: APK file was successfully validated! 616s 2024-03-07 20:02:23,680 DEBUG: Getting signature of no.min.target.sdk_987.apk 616s 2024-03-07 20:02:23,688 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 617s 2024-03-07 20:02:24,051 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 617s Verified using v1 scheme (JAR signing): true 617s Verified using v2 scheme (APK Signature Scheme v2): true 617s Verified using v3 scheme (APK Signature Scheme v3): false 617s Verified using v4 scheme (APK Signature Scheme v4): false 617s Verified for SourceStamp: false 617s Number of signers: 1 617s 617s 2024-03-07 20:02:24,051 DEBUG: Density 120 not available, resizing down from 160 617s 2024-03-07 20:02:24,053 DEBUG: Processing obb.main.oldversion_1444412523.apk 617s 2024-03-07 20:02:24,053 INFO: Starting analysis on AndroidManifest.xml 617s 2024-03-07 20:02:24,055 INFO: APK file was successfully validated! 617s 2024-03-07 20:02:24,057 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 617s 2024-03-07 20:02:24,430 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 617s Verified using v1 scheme (JAR signing): true 617s Verified using v2 scheme (APK Signature Scheme v2): true 617s Verified using v3 scheme (APK Signature Scheme v3): false 617s Verified using v4 scheme (APK Signature Scheme v4): false 617s Verified for SourceStamp: false 617s Number of signers: 1 617s 617s 2024-03-07 20:02:24,431 DEBUG: Density 120 not available, resizing down from 160 617s 2024-03-07 20:02:24,433 DEBUG: Processing obb.main.twoversions_1101613.apk 617s 2024-03-07 20:02:24,433 INFO: Starting analysis on AndroidManifest.xml 617s 2024-03-07 20:02:24,434 INFO: APK file was successfully validated! 617s 2024-03-07 20:02:24,436 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 617s 2024-03-07 20:02:24,777 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 617s Verified using v1 scheme (JAR signing): true 617s Verified using v2 scheme (APK Signature Scheme v2): false 617s Verified using v3 scheme (APK Signature Scheme v3): false 617s Verified using v4 scheme (APK Signature Scheme v4): false 617s Verified for SourceStamp: false 617s Number of signers: 1 617s 617s 2024-03-07 20:02:24,778 DEBUG: Density 120 not available, resizing down from 160 617s 2024-03-07 20:02:24,780 DEBUG: Processing obb.main.twoversions_1101615.apk 617s 2024-03-07 20:02:24,780 INFO: Starting analysis on AndroidManifest.xml 617s 2024-03-07 20:02:24,781 INFO: APK file was successfully validated! 617s 2024-03-07 20:02:24,783 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 618s 2024-03-07 20:02:25,133 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 618s Verified using v1 scheme (JAR signing): true 618s Verified using v2 scheme (APK Signature Scheme v2): false 618s Verified using v3 scheme (APK Signature Scheme v3): false 618s Verified using v4 scheme (APK Signature Scheme v4): false 618s Verified for SourceStamp: false 618s Number of signers: 1 618s 618s 2024-03-07 20:02:25,133 DEBUG: Density 120 not available, resizing down from 160 618s 2024-03-07 20:02:25,135 DEBUG: Processing obb.main.twoversions_1101617.apk 618s 2024-03-07 20:02:25,135 INFO: Starting analysis on AndroidManifest.xml 618s 2024-03-07 20:02:25,137 INFO: APK file was successfully validated! 618s 2024-03-07 20:02:25,138 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 618s 2024-03-07 20:02:25,489 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 618s Verified using v1 scheme (JAR signing): true 618s Verified using v2 scheme (APK Signature Scheme v2): false 618s Verified using v3 scheme (APK Signature Scheme v3): false 618s Verified using v4 scheme (APK Signature Scheme v4): false 618s Verified for SourceStamp: false 618s Number of signers: 1 618s 618s 2024-03-07 20:02:25,490 DEBUG: Density 120 not available, resizing down from 160 618s 2024-03-07 20:02:25,492 DEBUG: Processing obb.mainpatch.current_1619.apk 618s 2024-03-07 20:02:25,492 INFO: Starting analysis on AndroidManifest.xml 618s 2024-03-07 20:02:25,493 INFO: APK file was successfully validated! 618s 2024-03-07 20:02:25,495 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 618s 2024-03-07 20:02:25,842 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 618s Verified using v1 scheme (JAR signing): true 618s Verified using v2 scheme (APK Signature Scheme v2): false 618s Verified using v3 scheme (APK Signature Scheme v3): false 618s Verified using v4 scheme (APK Signature Scheme v4): false 618s Verified for SourceStamp: false 618s Number of signers: 1 618s 618s 2024-03-07 20:02:25,843 DEBUG: Density 120 not available, resizing down from 160 618s 2024-03-07 20:02:25,844 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 618s 2024-03-07 20:02:25,845 INFO: Starting analysis on AndroidManifest.xml 618s 2024-03-07 20:02:25,845 INFO: APK file was successfully validated! 618s 2024-03-07 20:02:25,847 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 619s 2024-03-07 20:02:26,184 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 619s Verified using v1 scheme (JAR signing): true 619s Verified using v2 scheme (APK Signature Scheme v2): false 619s Verified using v3 scheme (APK Signature Scheme v3): false 619s Verified using v4 scheme (APK Signature Scheme v4): false 619s Verified for SourceStamp: false 619s Number of signers: 1 619s 619s 2024-03-07 20:02:26,185 DEBUG: Density 120 not available, resizing down from 160 619s 2024-03-07 20:02:26,186 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 619s 2024-03-07 20:02:26,187 INFO: Starting analysis on AndroidManifest.xml 619s 2024-03-07 20:02:26,187 INFO: APK file was successfully validated! 619s 2024-03-07 20:02:26,189 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 619s 2024-03-07 20:02:26,520 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 619s Verified using v1 scheme (JAR signing): true 619s Verified using v2 scheme (APK Signature Scheme v2): false 619s Verified using v3 scheme (APK Signature Scheme v3): false 619s Verified using v4 scheme (APK Signature Scheme v4): false 619s Verified for SourceStamp: false 619s Number of signers: 1 619s 619s 2024-03-07 20:02:26,521 DEBUG: Density 120 not available, resizing down from 160 619s 2024-03-07 20:02:26,522 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 619s 2024-03-07 20:02:26,523 INFO: Starting analysis on AndroidManifest.xml 619s 2024-03-07 20:02:26,524 INFO: APK file was successfully validated! 619s 2024-03-07 20:02:26,525 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 619s 2024-03-07 20:02:26,864 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 619s Verified using v1 scheme (JAR signing): true 619s Verified using v2 scheme (APK Signature Scheme v2): false 619s Verified using v3 scheme (APK Signature Scheme v3): false 619s Verified using v4 scheme (APK Signature Scheme v4): false 619s Verified for SourceStamp: false 619s Number of signers: 1 619s 619s 2024-03-07 20:02:26,865 DEBUG: Density 120 not available, resizing down from 160 619s 2024-03-07 20:02:26,867 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 619s 2024-03-07 20:02:26,867 INFO: Starting analysis on AndroidManifest.xml 619s 2024-03-07 20:02:26,868 INFO: APK file was successfully validated! 619s 2024-03-07 20:02:26,869 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 620s 2024-03-07 20:02:27,204 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 620s Verified using v1 scheme (JAR signing): true 620s Verified using v2 scheme (APK Signature Scheme v2): false 620s Verified using v3 scheme (APK Signature Scheme v3): false 620s Verified using v4 scheme (APK Signature Scheme v4): false 620s Verified for SourceStamp: false 620s Number of signers: 1 620s 620s 2024-03-07 20:02:27,205 DEBUG: Density 120 not available, resizing down from 160 620s 2024-03-07 20:02:27,206 DEBUG: Processing org.dyndns.fules.ck_20.apk 620s 2024-03-07 20:02:27,206 INFO: Starting analysis on AndroidManifest.xml 620s 2024-03-07 20:02:27,207 INFO: APK file was successfully validated! 620s 2024-03-07 20:02:27,210 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 620s 2024-03-07 20:02:27,622 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 620s Verified using v1 scheme (JAR signing): true 620s Verified using v2 scheme (APK Signature Scheme v2): false 620s Verified using v3 scheme (APK Signature Scheme v3): false 620s Verified using v4 scheme (APK Signature Scheme v4): false 620s Verified for SourceStamp: false 620s Number of signers: 1 620s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 620s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 620s 620s 2024-03-07 20:02:27,624 DEBUG: Processing souch.smsbypass_9.apk 620s 2024-03-07 20:02:27,624 INFO: Starting analysis on AndroidManifest.xml 620s 2024-03-07 20:02:27,626 INFO: APK file was successfully validated! 620s 2024-03-07 20:02:27,629 DEBUG: Getting signature of souch.smsbypass_9.apk 621s 2024-03-07 20:02:27,999 DEBUG: repo/souch.smsbypass_9.apk: Verifies 621s Verified using v1 scheme (JAR signing): true 621s Verified using v2 scheme (APK Signature Scheme v2): false 621s Verified using v3 scheme (APK Signature Scheme v3): false 621s Verified using v4 scheme (APK Signature Scheme v4): false 621s Verified for SourceStamp: false 621s Number of signers: 1 621s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 621s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 621s 621s 2024-03-07 20:02:28,000 DEBUG: Density 120 not available, resizing down from 160 621s 2024-03-07 20:02:28,002 DEBUG: Processing v1.v2.sig_1020.apk 621s 2024-03-07 20:02:28,003 INFO: Starting analysis on AndroidManifest.xml 621s 2024-03-07 20:02:28,004 INFO: APK file was successfully validated! 621s 2024-03-07 20:02:28,006 DEBUG: Getting signature of v1.v2.sig_1020.apk 621s 2024-03-07 20:02:28,375 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 621s Verified using v1 scheme (JAR signing): true 621s Verified using v2 scheme (APK Signature Scheme v2): true 621s Verified using v3 scheme (APK Signature Scheme v3): false 621s Verified using v4 scheme (APK Signature Scheme v4): false 621s Verified for SourceStamp: false 621s Number of signers: 1 621s 621s 2024-03-07 20:02:28,376 DEBUG: Density 120 not available, resizing down from 160 621s 2024-03-07 20:02:28,378 DEBUG: Processing v2.only.sig_2.apk 621s 2024-03-07 20:02:28,378 INFO: Starting analysis on AndroidManifest.xml 621s 2024-03-07 20:02:28,379 INFO: APK file was successfully validated! 621s 2024-03-07 20:02:28,381 DEBUG: Getting signature of v2.only.sig_2.apk 621s 2024-03-07 20:02:28,381 INFO: Starting analysis on AndroidManifest.xml 621s 2024-03-07 20:02:28,382 INFO: APK file was successfully validated! 621s 2024-03-07 20:02:28,383 DEBUG: Using APK Signature v2 621s 2024-03-07 20:02:28,384 INFO: Starting analysis on AndroidManifest.xml 621s 2024-03-07 20:02:28,385 INFO: APK file was successfully validated! 621s 2024-03-07 20:02:28,386 DEBUG: Using APK Signature v2 621s 2024-03-07 20:02:28,690 DEBUG: repo/v2.only.sig_2.apk: Verifies 621s Verified using v1 scheme (JAR signing): false 621s Verified using v2 scheme (APK Signature Scheme v2): true 621s Verified using v3 scheme (APK Signature Scheme v3): false 621s Verified using v4 scheme (APK Signature Scheme v4): false 621s Verified for SourceStamp: false 621s Number of signers: 1 621s 621s 2024-03-07 20:02:28,691 DEBUG: Density 120 not available, resizing down from 160 621s 2024-03-07 20:02:28,693 INFO: Generated skeleton metadata for SpeedoMeterApp.main 621s 2024-03-07 20:02:28,695 INFO: Generated skeleton metadata for apk.embedded 621s 2024-03-07 20:02:28,697 INFO: Generated skeleton metadata for com.example.test.helloworld 621s 2024-03-07 20:02:28,699 INFO: Generated skeleton metadata for com.politedroid 621s 2024-03-07 20:02:28,702 INFO: Generated skeleton metadata for duplicate.permisssions 621s 2024-03-07 20:02:28,704 INFO: Generated skeleton metadata for info.guardianproject.urzip 621s 2024-03-07 20:02:28,708 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 621s 2024-03-07 20:02:28,711 INFO: Generated skeleton metadata for no.min.target.sdk 621s 2024-03-07 20:02:28,715 INFO: Generated skeleton metadata for obb.main.oldversion 621s 2024-03-07 20:02:28,720 INFO: Generated skeleton metadata for obb.main.twoversions 621s 2024-03-07 20:02:28,724 INFO: Generated skeleton metadata for obb.mainpatch.current 621s 2024-03-07 20:02:28,730 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 621s 2024-03-07 20:02:28,735 INFO: Generated skeleton metadata for org.dyndns.fules.ck 621s 2024-03-07 20:02:28,741 INFO: Generated skeleton metadata for souch.smsbypass 621s 2024-03-07 20:02:28,747 INFO: Generated skeleton metadata for v1.v2.sig 621s 2024-03-07 20:02:28,754 INFO: Generated skeleton metadata for v2.only.sig 621s 2024-03-07 20:02:28,763 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.olvD/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 622s 2024-03-07 20:02:29,773 INFO: Creating signed index with this key (SHA256): 622s 2024-03-07 20:02:29,773 INFO: 78 84 06 52 E3 35 D4 6E 06 85 98 92 38 CF 35 46 6A 49 34 EB F3 85 88 75 43 97 87 A4 95 7B 1D 3A 622s 2024-03-07 20:02:29,773 DEBUG: Directory: repo 622s 2024-03-07 20:02:29,773 DEBUG: > jar cf index.jar index.xml 623s 2024-03-07 20:02:30,075 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.olvD/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 624s jar signed. 624s 624s Warning: 624s The signer's certificate is self-signed. 624s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 624s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 624s 2024-03-07 20:02:31,789 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 624s 2024-03-07 20:02:31,799 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.olvD/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 626s jar signed. 626s 626s Warning: 626s The signer's certificate is self-signed. 626s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 626s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 626s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 626s 2024-03-07 20:02:33,316 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.olvD/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar 627s 2024-03-07 20:02:34,328 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.olvD/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 628s 2024-03-07 20:02:35,251 DEBUG: Outputting JSON 628s 2024-03-07 20:02:35,251 DEBUG: skip deploying full build logs: not enabled in config 628s 2024-03-07 20:02:35,252 DEBUG: skip deploying full build logs: not enabled in config 628s 2024-03-07 20:02:35,252 DEBUG: skip deploying full build logs: not enabled in config 628s 2024-03-07 20:02:35,252 INFO: Finished 628s + /usr/bin/fdroid readmeta 628s + grep -F ' repo/org.dyndns.fules.ck_20.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 640s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 641s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 642s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 643s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 644s Requested API level 30 is larger than maximum we have, returning API level 28 instead. 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 644s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk 645s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk 645s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 645s + fdroid_init_with_prebuilt_keystore 645s + '[' -z '' ']' 645s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 645s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 645s 2024-03-07 20:02:52,580 WARNING: 645s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 645s Now set these in config.yml: keystorepass, keypass, keydname 645s 645s 2024-03-07 20:02:52,580 INFO: 645s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.gbz8" with this config: 645s 645s Android SDK: /usr/lib/android-sdk 645s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 645s Alias for key in store: sova 645s 645s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.gbz8/repo" 645s then run "fdroid update -c; fdroid update". You might also want to edit 645s "config.yml" to set the URL, repo name, and more. You should also set up 645s a signing key (a temporary one might have been automatically generated). 645s 645s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 645s and https://f-droid.org/docs/Signing_Process 645s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 645s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 645s + /usr/bin/fdroid update --create-metadata --verbose 646s 2024-03-07 20:02:52,992 DEBUG: Reading 'config.yml' 646s 2024-03-07 20:02:53,004 DEBUG: ipfs_cid not found, skipping CIDv1 generation 646s 2024-03-07 20:02:53,005 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 646s 2024-03-07 20:02:53,005 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 646s 2024-03-07 20:02:53,006 DEBUG: Processing SpeedoMeterApp.main_1.apk 646s 2024-03-07 20:02:53,096 INFO: Starting analysis on AndroidManifest.xml 646s 2024-03-07 20:02:53,104 INFO: APK file was successfully validated! 646s 2024-03-07 20:02:53,106 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 646s 2024-03-07 20:02:53,112 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 646s 2024-03-07 20:02:53,428 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 646s Verified using v1 scheme (JAR signing): true 646s Verified using v2 scheme (APK Signature Scheme v2): false 646s Verified using v3 scheme (APK Signature Scheme v3): false 646s Verified using v4 scheme (APK Signature Scheme v4): false 646s Verified for SourceStamp: false 646s Number of signers: 1 646s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 646s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 646s 646s 2024-03-07 20:02:53,429 DEBUG: Processing apk.embedded_1.apk 646s 2024-03-07 20:02:53,429 INFO: Starting analysis on AndroidManifest.xml 646s 2024-03-07 20:02:53,430 INFO: APK file was successfully validated! 646s 2024-03-07 20:02:53,432 DEBUG: Getting signature of apk.embedded_1.apk 646s 2024-03-07 20:02:53,798 DEBUG: repo/apk.embedded_1.apk: Verifies 646s Verified using v1 scheme (JAR signing): true 646s Verified using v2 scheme (APK Signature Scheme v2): true 646s Verified using v3 scheme (APK Signature Scheme v3): true 646s Verified using v4 scheme (APK Signature Scheme v4): false 646s Verified for SourceStamp: false 646s Number of signers: 1 646s 646s 2024-03-07 20:02:53,799 DEBUG: Processing com.example.test.helloworld_1.apk 646s 2024-03-07 20:02:53,799 INFO: Starting analysis on AndroidManifest.xml 646s 2024-03-07 20:02:53,800 INFO: APK file was successfully validated! 646s 2024-03-07 20:02:53,802 DEBUG: Getting signature of com.example.test.helloworld_1.apk 647s 2024-03-07 20:02:54,132 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 647s Verified using v1 scheme (JAR signing): true 647s Verified using v2 scheme (APK Signature Scheme v2): false 647s Verified using v3 scheme (APK Signature Scheme v3): false 647s Verified using v4 scheme (APK Signature Scheme v4): false 647s Verified for SourceStamp: false 647s Number of signers: 1 647s 647s 2024-03-07 20:02:54,132 DEBUG: Processing com.politedroid_3.apk 647s 2024-03-07 20:02:54,133 INFO: Starting analysis on AndroidManifest.xml 647s 2024-03-07 20:02:54,134 INFO: APK file was successfully validated! 647s 2024-03-07 20:02:54,135 DEBUG: Getting signature of com.politedroid_3.apk 647s 2024-03-07 20:02:54,476 DEBUG: repo/com.politedroid_3.apk: Verifies 647s Verified using v1 scheme (JAR signing): true 647s Verified using v2 scheme (APK Signature Scheme v2): false 647s Verified using v3 scheme (APK Signature Scheme v3): false 647s Verified using v4 scheme (APK Signature Scheme v4): false 647s Verified for SourceStamp: false 647s Number of signers: 1 647s 647s 2024-03-07 20:02:54,480 DEBUG: Processing com.politedroid_4.apk 647s 2024-03-07 20:02:54,480 INFO: Starting analysis on AndroidManifest.xml 647s 2024-03-07 20:02:54,481 INFO: APK file was successfully validated! 647s 2024-03-07 20:02:54,483 DEBUG: Getting signature of com.politedroid_4.apk 647s 2024-03-07 20:02:54,818 DEBUG: repo/com.politedroid_4.apk: Verifies 647s Verified using v1 scheme (JAR signing): true 647s Verified using v2 scheme (APK Signature Scheme v2): false 647s Verified using v3 scheme (APK Signature Scheme v3): false 647s Verified using v4 scheme (APK Signature Scheme v4): false 647s Verified for SourceStamp: false 647s Number of signers: 1 647s 647s 2024-03-07 20:02:54,819 DEBUG: Processing com.politedroid_5.apk 647s 2024-03-07 20:02:54,820 INFO: Starting analysis on AndroidManifest.xml 647s 2024-03-07 20:02:54,821 INFO: APK file was successfully validated! 647s 2024-03-07 20:02:54,822 DEBUG: Getting signature of com.politedroid_5.apk 648s 2024-03-07 20:02:55,158 DEBUG: repo/com.politedroid_5.apk: Verifies 648s Verified using v1 scheme (JAR signing): true 648s Verified using v2 scheme (APK Signature Scheme v2): false 648s Verified using v3 scheme (APK Signature Scheme v3): false 648s Verified using v4 scheme (APK Signature Scheme v4): false 648s Verified for SourceStamp: false 648s Number of signers: 1 648s 648s 2024-03-07 20:02:55,160 DEBUG: Processing com.politedroid_6.apk 648s 2024-03-07 20:02:55,161 INFO: Starting analysis on AndroidManifest.xml 648s 2024-03-07 20:02:55,162 INFO: APK file was successfully validated! 648s 2024-03-07 20:02:55,164 DEBUG: Getting signature of com.politedroid_6.apk 648s 2024-03-07 20:02:55,506 DEBUG: repo/com.politedroid_6.apk: Verifies 648s Verified using v1 scheme (JAR signing): true 648s Verified using v2 scheme (APK Signature Scheme v2): false 648s Verified using v3 scheme (APK Signature Scheme v3): false 648s Verified using v4 scheme (APK Signature Scheme v4): false 648s Verified for SourceStamp: false 648s Number of signers: 1 648s 648s 2024-03-07 20:02:55,508 DEBUG: Processing duplicate.permisssions_9999999.apk 648s 2024-03-07 20:02:55,509 INFO: Starting analysis on AndroidManifest.xml 648s 2024-03-07 20:02:55,511 INFO: APK file was successfully validated! 648s 2024-03-07 20:02:55,513 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 648s 2024-03-07 20:02:55,519 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 648s 2024-03-07 20:02:55,869 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 648s Verified using v1 scheme (JAR signing): true 648s Verified using v2 scheme (APK Signature Scheme v2): true 648s Verified using v3 scheme (APK Signature Scheme v3): false 648s Verified using v4 scheme (APK Signature Scheme v4): false 648s Verified for SourceStamp: false 648s Number of signers: 1 648s 648s 2024-03-07 20:02:55,869 DEBUG: Density 120 not available, resizing down from 160 648s 2024-03-07 20:02:55,871 DEBUG: Processing info.guardianproject.urzip_100.apk 648s 2024-03-07 20:02:55,871 INFO: Starting analysis on AndroidManifest.xml 648s 2024-03-07 20:02:55,873 INFO: APK file was successfully validated! 648s 2024-03-07 20:02:55,874 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 649s 2024-03-07 20:02:56,213 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 649s Verified using v1 scheme (JAR signing): true 649s Verified using v2 scheme (APK Signature Scheme v2): false 649s Verified using v3 scheme (APK Signature Scheme v3): false 649s Verified using v4 scheme (APK Signature Scheme v4): false 649s Verified for SourceStamp: false 649s Number of signers: 1 649s 649s 2024-03-07 20:02:56,213 DEBUG: Density 120 not available, resizing down from 160 649s 2024-03-07 20:02:56,215 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 649s 2024-03-07 20:02:56,216 INFO: Starting analysis on AndroidManifest.xml 649s 2024-03-07 20:02:56,216 INFO: APK file was successfully validated! 649s 2024-03-07 20:02:56,218 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 649s 2024-03-07 20:02:56,548 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 649s Verified using v1 scheme (JAR signing): true 649s Verified using v2 scheme (APK Signature Scheme v2): false 649s Verified using v3 scheme (APK Signature Scheme v3): false 649s Verified using v4 scheme (APK Signature Scheme v4): false 649s Verified for SourceStamp: false 649s Number of signers: 1 649s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 649s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 649s 649s 2024-03-07 20:02:56,549 DEBUG: Processing no.min.target.sdk_987.apk 649s 2024-03-07 20:02:56,549 INFO: Starting analysis on AndroidManifest.xml 649s 2024-03-07 20:02:56,550 INFO: APK file was successfully validated! 649s 2024-03-07 20:02:56,552 DEBUG: Getting signature of no.min.target.sdk_987.apk 649s 2024-03-07 20:02:56,560 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 649s 2024-03-07 20:02:56,919 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 649s Verified using v1 scheme (JAR signing): true 649s Verified using v2 scheme (APK Signature Scheme v2): true 649s Verified using v3 scheme (APK Signature Scheme v3): false 649s Verified using v4 scheme (APK Signature Scheme v4): false 649s Verified for SourceStamp: false 649s Number of signers: 1 649s 649s 2024-03-07 20:02:56,920 DEBUG: Density 120 not available, resizing down from 160 649s 2024-03-07 20:02:56,921 DEBUG: Processing obb.main.oldversion_1444412523.apk 649s 2024-03-07 20:02:56,921 INFO: Starting analysis on AndroidManifest.xml 649s 2024-03-07 20:02:56,923 INFO: APK file was successfully validated! 649s 2024-03-07 20:02:56,925 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 650s 2024-03-07 20:02:57,297 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 650s Verified using v1 scheme (JAR signing): true 650s Verified using v2 scheme (APK Signature Scheme v2): true 650s Verified using v3 scheme (APK Signature Scheme v3): false 650s Verified using v4 scheme (APK Signature Scheme v4): false 650s Verified for SourceStamp: false 650s Number of signers: 1 650s 650s 2024-03-07 20:02:57,297 DEBUG: Density 120 not available, resizing down from 160 650s 2024-03-07 20:02:57,299 DEBUG: Processing obb.main.twoversions_1101613.apk 650s 2024-03-07 20:02:57,299 INFO: Starting analysis on AndroidManifest.xml 650s 2024-03-07 20:02:57,300 INFO: APK file was successfully validated! 650s 2024-03-07 20:02:57,302 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 650s 2024-03-07 20:02:57,638 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 650s Verified using v1 scheme (JAR signing): true 650s Verified using v2 scheme (APK Signature Scheme v2): false 650s Verified using v3 scheme (APK Signature Scheme v3): false 650s Verified using v4 scheme (APK Signature Scheme v4): false 650s Verified for SourceStamp: false 650s Number of signers: 1 650s 650s 2024-03-07 20:02:57,639 DEBUG: Density 120 not available, resizing down from 160 650s 2024-03-07 20:02:57,640 DEBUG: Processing obb.main.twoversions_1101615.apk 650s 2024-03-07 20:02:57,641 INFO: Starting analysis on AndroidManifest.xml 650s 2024-03-07 20:02:57,642 INFO: APK file was successfully validated! 650s 2024-03-07 20:02:57,644 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 651s 2024-03-07 20:02:57,986 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 651s Verified using v1 scheme (JAR signing): true 651s Verified using v2 scheme (APK Signature Scheme v2): false 651s Verified using v3 scheme (APK Signature Scheme v3): false 651s Verified using v4 scheme (APK Signature Scheme v4): false 651s Verified for SourceStamp: false 651s Number of signers: 1 651s 651s 2024-03-07 20:02:57,987 DEBUG: Density 120 not available, resizing down from 160 651s 2024-03-07 20:02:57,988 DEBUG: Processing obb.main.twoversions_1101617.apk 651s 2024-03-07 20:02:57,988 INFO: Starting analysis on AndroidManifest.xml 651s 2024-03-07 20:02:57,990 INFO: APK file was successfully validated! 651s 2024-03-07 20:02:57,992 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 651s 2024-03-07 20:02:58,331 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 651s Verified using v1 scheme (JAR signing): true 651s Verified using v2 scheme (APK Signature Scheme v2): false 651s Verified using v3 scheme (APK Signature Scheme v3): false 651s Verified using v4 scheme (APK Signature Scheme v4): false 651s Verified for SourceStamp: false 651s Number of signers: 1 651s 651s 2024-03-07 20:02:58,331 DEBUG: Density 120 not available, resizing down from 160 651s 2024-03-07 20:02:58,333 DEBUG: Processing obb.mainpatch.current_1619.apk 651s 2024-03-07 20:02:58,333 INFO: Starting analysis on AndroidManifest.xml 651s 2024-03-07 20:02:58,335 INFO: APK file was successfully validated! 651s 2024-03-07 20:02:58,336 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 651s 2024-03-07 20:02:58,673 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 651s Verified using v1 scheme (JAR signing): true 651s Verified using v2 scheme (APK Signature Scheme v2): false 651s Verified using v3 scheme (APK Signature Scheme v3): false 651s Verified using v4 scheme (APK Signature Scheme v4): false 651s Verified for SourceStamp: false 651s Number of signers: 1 651s 651s 2024-03-07 20:02:58,674 DEBUG: Density 120 not available, resizing down from 160 651s 2024-03-07 20:02:58,676 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 651s 2024-03-07 20:02:58,676 INFO: Starting analysis on AndroidManifest.xml 651s 2024-03-07 20:02:58,677 INFO: APK file was successfully validated! 651s 2024-03-07 20:02:58,678 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 652s 2024-03-07 20:02:59,013 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 652s Verified using v1 scheme (JAR signing): true 652s Verified using v2 scheme (APK Signature Scheme v2): false 652s Verified using v3 scheme (APK Signature Scheme v3): false 652s Verified using v4 scheme (APK Signature Scheme v4): false 652s Verified for SourceStamp: false 652s Number of signers: 1 652s 652s 2024-03-07 20:02:59,014 DEBUG: Density 120 not available, resizing down from 160 652s 2024-03-07 20:02:59,015 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 652s 2024-03-07 20:02:59,015 INFO: Starting analysis on AndroidManifest.xml 652s 2024-03-07 20:02:59,016 INFO: APK file was successfully validated! 652s 2024-03-07 20:02:59,018 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 652s 2024-03-07 20:02:59,347 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 652s Verified using v1 scheme (JAR signing): true 652s Verified using v2 scheme (APK Signature Scheme v2): false 652s Verified using v3 scheme (APK Signature Scheme v3): false 652s Verified using v4 scheme (APK Signature Scheme v4): false 652s Verified for SourceStamp: false 652s Number of signers: 1 652s 652s 2024-03-07 20:02:59,348 DEBUG: Density 120 not available, resizing down from 160 652s 2024-03-07 20:02:59,349 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 652s 2024-03-07 20:02:59,349 INFO: Starting analysis on AndroidManifest.xml 652s 2024-03-07 20:02:59,350 INFO: APK file was successfully validated! 652s 2024-03-07 20:02:59,352 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 652s 2024-03-07 20:02:59,667 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 652s Verified using v1 scheme (JAR signing): true 652s Verified using v2 scheme (APK Signature Scheme v2): false 652s Verified using v3 scheme (APK Signature Scheme v3): false 652s Verified using v4 scheme (APK Signature Scheme v4): false 652s Verified for SourceStamp: false 652s Number of signers: 1 652s 652s 2024-03-07 20:02:59,668 DEBUG: Density 120 not available, resizing down from 160 652s 2024-03-07 20:02:59,669 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 652s 2024-03-07 20:02:59,669 INFO: Starting analysis on AndroidManifest.xml 652s 2024-03-07 20:02:59,670 INFO: APK file was successfully validated! 652s 2024-03-07 20:02:59,672 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 653s 2024-03-07 20:03:00,003 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 653s Verified using v1 scheme (JAR signing): true 653s Verified using v2 scheme (APK Signature Scheme v2): false 653s Verified using v3 scheme (APK Signature Scheme v3): false 653s Verified using v4 scheme (APK Signature Scheme v4): false 653s Verified for SourceStamp: false 653s Number of signers: 1 653s 653s 2024-03-07 20:03:00,003 DEBUG: Density 120 not available, resizing down from 160 653s 2024-03-07 20:03:00,005 DEBUG: Processing org.dyndns.fules.ck_20.apk 653s 2024-03-07 20:03:00,005 INFO: Starting analysis on AndroidManifest.xml 653s 2024-03-07 20:03:00,006 INFO: APK file was successfully validated! 653s 2024-03-07 20:03:00,009 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 653s 2024-03-07 20:03:00,418 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 653s Verified using v1 scheme (JAR signing): true 653s Verified using v2 scheme (APK Signature Scheme v2): false 653s Verified using v3 scheme (APK Signature Scheme v3): false 653s Verified using v4 scheme (APK Signature Scheme v4): false 653s Verified for SourceStamp: false 653s Number of signers: 1 653s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 653s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 653s 653s 2024-03-07 20:03:00,420 DEBUG: Processing souch.smsbypass_9.apk 653s 2024-03-07 20:03:00,420 INFO: Starting analysis on AndroidManifest.xml 653s 2024-03-07 20:03:00,421 INFO: APK file was successfully validated! 653s 2024-03-07 20:03:00,425 DEBUG: Getting signature of souch.smsbypass_9.apk 653s 2024-03-07 20:03:00,814 DEBUG: repo/souch.smsbypass_9.apk: Verifies 653s Verified using v1 scheme (JAR signing): true 653s Verified using v2 scheme (APK Signature Scheme v2): false 653s Verified using v3 scheme (APK Signature Scheme v3): false 653s Verified using v4 scheme (APK Signature Scheme v4): false 653s Verified for SourceStamp: false 653s Number of signers: 1 653s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 653s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 653s 653s 2024-03-07 20:03:00,815 DEBUG: Density 120 not available, resizing down from 160 653s 2024-03-07 20:03:00,817 DEBUG: Processing v1.v2.sig_1020.apk 653s 2024-03-07 20:03:00,817 INFO: Starting analysis on AndroidManifest.xml 653s 2024-03-07 20:03:00,818 INFO: APK file was successfully validated! 653s 2024-03-07 20:03:00,820 DEBUG: Getting signature of v1.v2.sig_1020.apk 654s 2024-03-07 20:03:01,186 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 654s Verified using v1 scheme (JAR signing): true 654s Verified using v2 scheme (APK Signature Scheme v2): true 654s Verified using v3 scheme (APK Signature Scheme v3): false 654s Verified using v4 scheme (APK Signature Scheme v4): false 654s Verified for SourceStamp: false 654s Number of signers: 1 654s 654s 2024-03-07 20:03:01,187 DEBUG: Density 120 not available, resizing down from 160 654s 2024-03-07 20:03:01,188 DEBUG: Processing v2.only.sig_2.apk 654s 2024-03-07 20:03:01,189 INFO: Starting analysis on AndroidManifest.xml 654s 2024-03-07 20:03:01,190 INFO: APK file was successfully validated! 654s 2024-03-07 20:03:01,192 DEBUG: Getting signature of v2.only.sig_2.apk 654s 2024-03-07 20:03:01,192 INFO: Starting analysis on AndroidManifest.xml 654s 2024-03-07 20:03:01,193 INFO: APK file was successfully validated! 654s 2024-03-07 20:03:01,194 DEBUG: Using APK Signature v2 654s 2024-03-07 20:03:01,194 INFO: Starting analysis on AndroidManifest.xml 654s 2024-03-07 20:03:01,196 INFO: APK file was successfully validated! 654s 2024-03-07 20:03:01,197 DEBUG: Using APK Signature v2 654s 2024-03-07 20:03:01,490 DEBUG: repo/v2.only.sig_2.apk: Verifies 654s Verified using v1 scheme (JAR signing): false 654s Verified using v2 scheme (APK Signature Scheme v2): true 654s Verified using v3 scheme (APK Signature Scheme v3): false 654s Verified using v4 scheme (APK Signature Scheme v4): false 654s Verified for SourceStamp: false 654s Number of signers: 1 654s 654s 2024-03-07 20:03:01,490 DEBUG: Density 120 not available, resizing down from 160 654s 2024-03-07 20:03:01,492 INFO: Generated skeleton metadata for SpeedoMeterApp.main 654s 2024-03-07 20:03:01,495 INFO: Generated skeleton metadata for apk.embedded 654s 2024-03-07 20:03:01,496 INFO: Generated skeleton metadata for com.example.test.helloworld 654s 2024-03-07 20:03:01,498 INFO: Generated skeleton metadata for com.politedroid 654s 2024-03-07 20:03:01,501 INFO: Generated skeleton metadata for duplicate.permisssions 654s 2024-03-07 20:03:01,503 INFO: Generated skeleton metadata for info.guardianproject.urzip 654s 2024-03-07 20:03:01,506 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 654s 2024-03-07 20:03:01,510 INFO: Generated skeleton metadata for no.min.target.sdk 654s 2024-03-07 20:03:01,514 INFO: Generated skeleton metadata for obb.main.oldversion 654s 2024-03-07 20:03:01,518 INFO: Generated skeleton metadata for obb.main.twoversions 654s 2024-03-07 20:03:01,522 INFO: Generated skeleton metadata for obb.mainpatch.current 654s 2024-03-07 20:03:01,528 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 654s 2024-03-07 20:03:01,533 INFO: Generated skeleton metadata for org.dyndns.fules.ck 654s 2024-03-07 20:03:01,539 INFO: Generated skeleton metadata for souch.smsbypass 654s 2024-03-07 20:03:01,545 INFO: Generated skeleton metadata for v1.v2.sig 654s 2024-03-07 20:03:01,551 INFO: Generated skeleton metadata for v2.only.sig 654s 2024-03-07 20:03:01,560 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 654s 654s Warning: 654s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 655s 2024-03-07 20:03:02,174 INFO: Creating signed index with this key (SHA256): 655s 2024-03-07 20:03:02,175 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 655s 2024-03-07 20:03:02,175 DEBUG: Directory: repo 655s 2024-03-07 20:03:02,175 DEBUG: > jar cf index.jar index.xml 655s 2024-03-07 20:03:02,480 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 656s jar signed. 656s 656s Warning: 656s The signer's certificate is self-signed. 656s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 656s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 656s 2024-03-07 20:03:03,488 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 656s 2024-03-07 20:03:03,497 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 657s jar signed. 657s 657s Warning: 657s The signer's certificate is self-signed. 657s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 657s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 657s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 657s 2024-03-07 20:03:04,512 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 658s 2024-03-07 20:03:05,120 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 658s 658s Warning: 658s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 658s 2024-03-07 20:03:05,837 DEBUG: Outputting JSON 658s 2024-03-07 20:03:05,837 DEBUG: skip deploying full build logs: not enabled in config 658s 2024-03-07 20:03:05,838 DEBUG: skip deploying full build logs: not enabled in config 658s 2024-03-07 20:03:05,838 DEBUG: skip deploying full build logs: not enabled in config 658s 2024-03-07 20:03:05,838 INFO: Finished 658s + /usr/bin/fdroid readmeta 659s + grep -F ' repo/org.dyndns.fules.ck_20.apk 670s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 671s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 672s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 673s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 674s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 675s Requested API level 30 is larger than maximum we have, returning API level 28 instead. 675s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 675s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 675s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk 675s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk 675s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 675s + /usr/bin/fdroid update --create-metadata --verbose 676s 2024-03-07 20:03:23,025 DEBUG: Reading 'config.yml' 676s 2024-03-07 20:03:23,037 DEBUG: ipfs_cid not found, skipping CIDv1 generation 676s 2024-03-07 20:03:23,038 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 676s 2024-03-07 20:03:23,038 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 676s 2024-03-07 20:03:23,039 DEBUG: Processing SpeedoMeterApp.main_1.apk 676s 2024-03-07 20:03:23,126 INFO: Starting analysis on AndroidManifest.xml 676s 2024-03-07 20:03:23,135 INFO: APK file was successfully validated! 676s 2024-03-07 20:03:23,137 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 676s 2024-03-07 20:03:23,143 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 676s 2024-03-07 20:03:23,471 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 676s Verified using v1 scheme (JAR signing): true 676s Verified using v2 scheme (APK Signature Scheme v2): false 676s Verified using v3 scheme (APK Signature Scheme v3): false 676s Verified using v4 scheme (APK Signature Scheme v4): false 676s Verified for SourceStamp: false 676s Number of signers: 1 676s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 676s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 676s 676s 2024-03-07 20:03:23,472 DEBUG: Processing apk.embedded_1.apk 676s 2024-03-07 20:03:23,472 INFO: Starting analysis on AndroidManifest.xml 676s 2024-03-07 20:03:23,473 INFO: APK file was successfully validated! 676s 2024-03-07 20:03:23,475 DEBUG: Getting signature of apk.embedded_1.apk 676s 2024-03-07 20:03:23,829 DEBUG: repo/apk.embedded_1.apk: Verifies 676s Verified using v1 scheme (JAR signing): true 676s Verified using v2 scheme (APK Signature Scheme v2): true 676s Verified using v3 scheme (APK Signature Scheme v3): true 676s Verified using v4 scheme (APK Signature Scheme v4): false 676s Verified for SourceStamp: false 676s Number of signers: 1 676s 676s 2024-03-07 20:03:23,829 DEBUG: Processing com.example.test.helloworld_1.apk 676s 2024-03-07 20:03:23,830 INFO: Starting analysis on AndroidManifest.xml 676s 2024-03-07 20:03:23,830 INFO: APK file was successfully validated! 676s 2024-03-07 20:03:23,833 DEBUG: Getting signature of com.example.test.helloworld_1.apk 677s 2024-03-07 20:03:24,170 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 677s Verified using v1 scheme (JAR signing): true 677s Verified using v2 scheme (APK Signature Scheme v2): false 677s Verified using v3 scheme (APK Signature Scheme v3): false 677s Verified using v4 scheme (APK Signature Scheme v4): false 677s Verified for SourceStamp: false 677s Number of signers: 1 677s 677s 2024-03-07 20:03:24,170 DEBUG: Processing com.politedroid_3.apk 677s 2024-03-07 20:03:24,171 INFO: Starting analysis on AndroidManifest.xml 677s 2024-03-07 20:03:24,171 INFO: APK file was successfully validated! 677s 2024-03-07 20:03:24,173 DEBUG: Getting signature of com.politedroid_3.apk 677s 2024-03-07 20:03:24,514 DEBUG: repo/com.politedroid_3.apk: Verifies 677s Verified using v1 scheme (JAR signing): true 677s Verified using v2 scheme (APK Signature Scheme v2): false 677s Verified using v3 scheme (APK Signature Scheme v3): false 677s Verified using v4 scheme (APK Signature Scheme v4): false 677s Verified for SourceStamp: false 677s Number of signers: 1 677s 677s 2024-03-07 20:03:24,519 DEBUG: Processing com.politedroid_4.apk 677s 2024-03-07 20:03:24,519 INFO: Starting analysis on AndroidManifest.xml 677s 2024-03-07 20:03:24,520 INFO: APK file was successfully validated! 677s 2024-03-07 20:03:24,522 DEBUG: Getting signature of com.politedroid_4.apk 677s 2024-03-07 20:03:24,851 DEBUG: repo/com.politedroid_4.apk: Verifies 677s Verified using v1 scheme (JAR signing): true 677s Verified using v2 scheme (APK Signature Scheme v2): false 677s Verified using v3 scheme (APK Signature Scheme v3): false 677s Verified using v4 scheme (APK Signature Scheme v4): false 677s Verified for SourceStamp: false 677s Number of signers: 1 677s 677s 2024-03-07 20:03:24,853 DEBUG: Processing com.politedroid_5.apk 677s 2024-03-07 20:03:24,853 INFO: Starting analysis on AndroidManifest.xml 677s 2024-03-07 20:03:24,854 INFO: APK file was successfully validated! 677s 2024-03-07 20:03:24,856 DEBUG: Getting signature of com.politedroid_5.apk 678s 2024-03-07 20:03:25,193 DEBUG: repo/com.politedroid_5.apk: Verifies 678s Verified using v1 scheme (JAR signing): true 678s Verified using v2 scheme (APK Signature Scheme v2): false 678s Verified using v3 scheme (APK Signature Scheme v3): false 678s Verified using v4 scheme (APK Signature Scheme v4): false 678s Verified for SourceStamp: false 678s Number of signers: 1 678s 678s 2024-03-07 20:03:25,195 DEBUG: Processing com.politedroid_6.apk 678s 2024-03-07 20:03:25,195 INFO: Starting analysis on AndroidManifest.xml 678s 2024-03-07 20:03:25,196 INFO: APK file was successfully validated! 678s 2024-03-07 20:03:25,199 DEBUG: Getting signature of com.politedroid_6.apk 678s 2024-03-07 20:03:25,534 DEBUG: repo/com.politedroid_6.apk: Verifies 678s Verified using v1 scheme (JAR signing): true 678s Verified using v2 scheme (APK Signature Scheme v2): false 678s Verified using v3 scheme (APK Signature Scheme v3): false 678s Verified using v4 scheme (APK Signature Scheme v4): false 678s Verified for SourceStamp: false 678s Number of signers: 1 678s 678s 2024-03-07 20:03:25,536 DEBUG: Processing duplicate.permisssions_9999999.apk 678s 2024-03-07 20:03:25,536 INFO: Starting analysis on AndroidManifest.xml 678s 2024-03-07 20:03:25,538 INFO: APK file was successfully validated! 678s 2024-03-07 20:03:25,540 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 678s 2024-03-07 20:03:25,546 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 678s 2024-03-07 20:03:25,898 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 678s Verified using v1 scheme (JAR signing): true 678s Verified using v2 scheme (APK Signature Scheme v2): true 678s Verified using v3 scheme (APK Signature Scheme v3): false 678s Verified using v4 scheme (APK Signature Scheme v4): false 678s Verified for SourceStamp: false 678s Number of signers: 1 678s 678s 2024-03-07 20:03:25,899 DEBUG: Density 120 not available, resizing down from 160 678s 2024-03-07 20:03:25,901 DEBUG: Processing info.guardianproject.urzip_100.apk 678s 2024-03-07 20:03:25,901 INFO: Starting analysis on AndroidManifest.xml 678s 2024-03-07 20:03:25,902 INFO: APK file was successfully validated! 678s 2024-03-07 20:03:25,904 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 679s 2024-03-07 20:03:26,236 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 679s Verified using v1 scheme (JAR signing): true 679s Verified using v2 scheme (APK Signature Scheme v2): false 679s Verified using v3 scheme (APK Signature Scheme v3): false 679s Verified using v4 scheme (APK Signature Scheme v4): false 679s Verified for SourceStamp: false 679s Number of signers: 1 679s 679s 2024-03-07 20:03:26,237 DEBUG: Density 120 not available, resizing down from 160 679s 2024-03-07 20:03:26,239 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 679s 2024-03-07 20:03:26,239 INFO: Starting analysis on AndroidManifest.xml 679s 2024-03-07 20:03:26,240 INFO: APK file was successfully validated! 679s 2024-03-07 20:03:26,242 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 679s 2024-03-07 20:03:26,571 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 679s Verified using v1 scheme (JAR signing): true 679s Verified using v2 scheme (APK Signature Scheme v2): false 679s Verified using v3 scheme (APK Signature Scheme v3): false 679s Verified using v4 scheme (APK Signature Scheme v4): false 679s Verified for SourceStamp: false 679s Number of signers: 1 679s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 679s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 679s 679s 2024-03-07 20:03:26,571 DEBUG: Processing no.min.target.sdk_987.apk 679s 2024-03-07 20:03:26,572 INFO: Starting analysis on AndroidManifest.xml 679s 2024-03-07 20:03:26,573 INFO: APK file was successfully validated! 679s 2024-03-07 20:03:26,574 DEBUG: Getting signature of no.min.target.sdk_987.apk 679s 2024-03-07 20:03:26,582 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 679s 2024-03-07 20:03:26,938 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 679s Verified using v1 scheme (JAR signing): true 679s Verified using v2 scheme (APK Signature Scheme v2): true 679s Verified using v3 scheme (APK Signature Scheme v3): false 679s Verified using v4 scheme (APK Signature Scheme v4): false 679s Verified for SourceStamp: false 679s Number of signers: 1 679s 679s 2024-03-07 20:03:26,939 DEBUG: Density 120 not available, resizing down from 160 679s 2024-03-07 20:03:26,941 DEBUG: Processing obb.main.oldversion_1444412523.apk 679s 2024-03-07 20:03:26,941 INFO: Starting analysis on AndroidManifest.xml 679s 2024-03-07 20:03:26,943 INFO: APK file was successfully validated! 679s 2024-03-07 20:03:26,945 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 680s 2024-03-07 20:03:27,308 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 680s Verified using v1 scheme (JAR signing): true 680s Verified using v2 scheme (APK Signature Scheme v2): true 680s Verified using v3 scheme (APK Signature Scheme v3): false 680s Verified using v4 scheme (APK Signature Scheme v4): false 680s Verified for SourceStamp: false 680s Number of signers: 1 680s 680s 2024-03-07 20:03:27,309 DEBUG: Density 120 not available, resizing down from 160 680s 2024-03-07 20:03:27,310 DEBUG: Processing obb.main.twoversions_1101613.apk 680s 2024-03-07 20:03:27,311 INFO: Starting analysis on AndroidManifest.xml 680s 2024-03-07 20:03:27,312 INFO: APK file was successfully validated! 680s 2024-03-07 20:03:27,313 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 680s 2024-03-07 20:03:27,640 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 680s Verified using v1 scheme (JAR signing): true 680s Verified using v2 scheme (APK Signature Scheme v2): false 680s Verified using v3 scheme (APK Signature Scheme v3): false 680s Verified using v4 scheme (APK Signature Scheme v4): false 680s Verified for SourceStamp: false 680s Number of signers: 1 680s 680s 2024-03-07 20:03:27,641 DEBUG: Density 120 not available, resizing down from 160 680s 2024-03-07 20:03:27,643 DEBUG: Processing obb.main.twoversions_1101615.apk 680s 2024-03-07 20:03:27,643 INFO: Starting analysis on AndroidManifest.xml 680s 2024-03-07 20:03:27,644 INFO: APK file was successfully validated! 680s 2024-03-07 20:03:27,646 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 681s 2024-03-07 20:03:27,994 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 681s Verified using v1 scheme (JAR signing): true 681s Verified using v2 scheme (APK Signature Scheme v2): false 681s Verified using v3 scheme (APK Signature Scheme v3): false 681s Verified using v4 scheme (APK Signature Scheme v4): false 681s Verified for SourceStamp: false 681s Number of signers: 1 681s 681s 2024-03-07 20:03:27,994 DEBUG: Density 120 not available, resizing down from 160 681s 2024-03-07 20:03:27,996 DEBUG: Processing obb.main.twoversions_1101617.apk 681s 2024-03-07 20:03:27,996 INFO: Starting analysis on AndroidManifest.xml 681s 2024-03-07 20:03:27,998 INFO: APK file was successfully validated! 681s 2024-03-07 20:03:27,999 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 681s 2024-03-07 20:03:28,338 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 681s Verified using v1 scheme (JAR signing): true 681s Verified using v2 scheme (APK Signature Scheme v2): false 681s Verified using v3 scheme (APK Signature Scheme v3): false 681s Verified using v4 scheme (APK Signature Scheme v4): false 681s Verified for SourceStamp: false 681s Number of signers: 1 681s 681s 2024-03-07 20:03:28,339 DEBUG: Density 120 not available, resizing down from 160 681s 2024-03-07 20:03:28,340 DEBUG: Processing obb.mainpatch.current_1619.apk 681s 2024-03-07 20:03:28,340 INFO: Starting analysis on AndroidManifest.xml 681s 2024-03-07 20:03:28,342 INFO: APK file was successfully validated! 681s 2024-03-07 20:03:28,343 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 681s 2024-03-07 20:03:28,680 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 681s Verified using v1 scheme (JAR signing): true 681s Verified using v2 scheme (APK Signature Scheme v2): false 681s Verified using v3 scheme (APK Signature Scheme v3): false 681s Verified using v4 scheme (APK Signature Scheme v4): false 681s Verified for SourceStamp: false 681s Number of signers: 1 681s 681s 2024-03-07 20:03:28,681 DEBUG: Density 120 not available, resizing down from 160 681s 2024-03-07 20:03:28,683 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 681s 2024-03-07 20:03:28,683 INFO: Starting analysis on AndroidManifest.xml 681s 2024-03-07 20:03:28,684 INFO: APK file was successfully validated! 681s 2024-03-07 20:03:28,685 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 682s 2024-03-07 20:03:29,008 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 682s Verified using v1 scheme (JAR signing): true 682s Verified using v2 scheme (APK Signature Scheme v2): false 682s Verified using v3 scheme (APK Signature Scheme v3): false 682s Verified using v4 scheme (APK Signature Scheme v4): false 682s Verified for SourceStamp: false 682s Number of signers: 1 682s 682s 2024-03-07 20:03:29,009 DEBUG: Density 120 not available, resizing down from 160 682s 2024-03-07 20:03:29,010 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 682s 2024-03-07 20:03:29,011 INFO: Starting analysis on AndroidManifest.xml 682s 2024-03-07 20:03:29,012 INFO: APK file was successfully validated! 682s 2024-03-07 20:03:29,014 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 682s 2024-03-07 20:03:29,328 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 682s Verified using v1 scheme (JAR signing): true 682s Verified using v2 scheme (APK Signature Scheme v2): false 682s Verified using v3 scheme (APK Signature Scheme v3): false 682s Verified using v4 scheme (APK Signature Scheme v4): false 682s Verified for SourceStamp: false 682s Number of signers: 1 682s 682s 2024-03-07 20:03:29,328 DEBUG: Density 120 not available, resizing down from 160 682s 2024-03-07 20:03:29,330 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 682s 2024-03-07 20:03:29,330 INFO: Starting analysis on AndroidManifest.xml 682s 2024-03-07 20:03:29,331 INFO: APK file was successfully validated! 682s 2024-03-07 20:03:29,332 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 682s 2024-03-07 20:03:29,654 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 682s Verified using v1 scheme (JAR signing): true 682s Verified using v2 scheme (APK Signature Scheme v2): false 682s Verified using v3 scheme (APK Signature Scheme v3): false 682s Verified using v4 scheme (APK Signature Scheme v4): false 682s Verified for SourceStamp: false 682s Number of signers: 1 682s 682s 2024-03-07 20:03:29,655 DEBUG: Density 120 not available, resizing down from 160 682s 2024-03-07 20:03:29,656 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 682s 2024-03-07 20:03:29,656 INFO: Starting analysis on AndroidManifest.xml 682s 2024-03-07 20:03:29,657 INFO: APK file was successfully validated! 682s 2024-03-07 20:03:29,659 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 683s 2024-03-07 20:03:29,983 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 683s Verified using v1 scheme (JAR signing): true 683s Verified using v2 scheme (APK Signature Scheme v2): false 683s Verified using v3 scheme (APK Signature Scheme v3): false 683s Verified using v4 scheme (APK Signature Scheme v4): false 683s Verified for SourceStamp: false 683s Number of signers: 1 683s 683s 2024-03-07 20:03:29,984 DEBUG: Density 120 not available, resizing down from 160 683s 2024-03-07 20:03:29,985 DEBUG: Processing org.dyndns.fules.ck_20.apk 683s 2024-03-07 20:03:29,986 INFO: Starting analysis on AndroidManifest.xml 683s 2024-03-07 20:03:29,987 INFO: APK file was successfully validated! 683s 2024-03-07 20:03:29,990 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 683s 2024-03-07 20:03:30,395 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 683s Verified using v1 scheme (JAR signing): true 683s Verified using v2 scheme (APK Signature Scheme v2): false 683s Verified using v3 scheme (APK Signature Scheme v3): false 683s Verified using v4 scheme (APK Signature Scheme v4): false 683s Verified for SourceStamp: false 683s Number of signers: 1 683s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 683s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 683s 683s 2024-03-07 20:03:30,397 DEBUG: Processing souch.smsbypass_9.apk 683s 2024-03-07 20:03:30,397 INFO: Starting analysis on AndroidManifest.xml 683s 2024-03-07 20:03:30,399 INFO: APK file was successfully validated! 683s 2024-03-07 20:03:30,402 DEBUG: Getting signature of souch.smsbypass_9.apk 683s 2024-03-07 20:03:30,775 DEBUG: repo/souch.smsbypass_9.apk: Verifies 683s Verified using v1 scheme (JAR signing): true 683s Verified using v2 scheme (APK Signature Scheme v2): false 683s Verified using v3 scheme (APK Signature Scheme v3): false 683s Verified using v4 scheme (APK Signature Scheme v4): false 683s Verified for SourceStamp: false 683s Number of signers: 1 683s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 683s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 683s 683s 2024-03-07 20:03:30,776 DEBUG: Density 120 not available, resizing down from 160 683s 2024-03-07 20:03:30,778 DEBUG: Processing v1.v2.sig_1020.apk 683s 2024-03-07 20:03:30,778 INFO: Starting analysis on AndroidManifest.xml 683s 2024-03-07 20:03:30,779 INFO: APK file was successfully validated! 683s 2024-03-07 20:03:30,781 DEBUG: Getting signature of v1.v2.sig_1020.apk 684s 2024-03-07 20:03:31,150 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 684s Verified using v1 scheme (JAR signing): true 684s Verified using v2 scheme (APK Signature Scheme v2): true 684s Verified using v3 scheme (APK Signature Scheme v3): false 684s Verified using v4 scheme (APK Signature Scheme v4): false 684s Verified for SourceStamp: false 684s Number of signers: 1 684s 684s 2024-03-07 20:03:31,150 DEBUG: Density 120 not available, resizing down from 160 684s 2024-03-07 20:03:31,152 DEBUG: Processing v2.only.sig_2.apk 684s 2024-03-07 20:03:31,152 INFO: Starting analysis on AndroidManifest.xml 684s 2024-03-07 20:03:31,153 INFO: APK file was successfully validated! 684s 2024-03-07 20:03:31,155 DEBUG: Getting signature of v2.only.sig_2.apk 684s 2024-03-07 20:03:31,155 INFO: Starting analysis on AndroidManifest.xml 684s 2024-03-07 20:03:31,157 INFO: APK file was successfully validated! 684s 2024-03-07 20:03:31,157 DEBUG: Using APK Signature v2 684s 2024-03-07 20:03:31,158 INFO: Starting analysis on AndroidManifest.xml 684s 2024-03-07 20:03:31,159 INFO: APK file was successfully validated! 684s 2024-03-07 20:03:31,160 DEBUG: Using APK Signature v2 684s 2024-03-07 20:03:31,456 DEBUG: repo/v2.only.sig_2.apk: Verifies 684s Verified using v1 scheme (JAR signing): false 684s Verified using v2 scheme (APK Signature Scheme v2): true 684s Verified using v3 scheme (APK Signature Scheme v3): false 684s Verified using v4 scheme (APK Signature Scheme v4): false 684s Verified for SourceStamp: false 684s Number of signers: 1 684s 684s 2024-03-07 20:03:31,457 DEBUG: Density 120 not available, resizing down from 160 684s 2024-03-07 20:03:31,459 INFO: Generated skeleton metadata for SpeedoMeterApp.main 684s 2024-03-07 20:03:31,461 INFO: Generated skeleton metadata for apk.embedded 684s 2024-03-07 20:03:31,463 INFO: Generated skeleton metadata for com.example.test.helloworld 684s 2024-03-07 20:03:31,465 INFO: Generated skeleton metadata for com.politedroid 684s 2024-03-07 20:03:31,468 INFO: Generated skeleton metadata for duplicate.permisssions 684s 2024-03-07 20:03:31,470 INFO: Generated skeleton metadata for info.guardianproject.urzip 684s 2024-03-07 20:03:31,474 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 684s 2024-03-07 20:03:31,477 INFO: Generated skeleton metadata for no.min.target.sdk 684s 2024-03-07 20:03:31,481 INFO: Generated skeleton metadata for obb.main.oldversion 684s 2024-03-07 20:03:31,485 INFO: Generated skeleton metadata for obb.main.twoversions 684s 2024-03-07 20:03:31,490 INFO: Generated skeleton metadata for obb.mainpatch.current 684s 2024-03-07 20:03:31,495 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 684s 2024-03-07 20:03:31,501 INFO: Generated skeleton metadata for org.dyndns.fules.ck 684s 2024-03-07 20:03:31,506 INFO: Generated skeleton metadata for souch.smsbypass 684s 2024-03-07 20:03:31,512 INFO: Generated skeleton metadata for v1.v2.sig 684s 2024-03-07 20:03:31,519 INFO: Generated skeleton metadata for v2.only.sig 684s 2024-03-07 20:03:31,528 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.g311/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 685s 2024-03-07 20:03:32,437 INFO: Creating signed index with this key (SHA256): 685s 2024-03-07 20:03:32,437 INFO: 02 0F 0E 7F 16 F3 EC 4E F4 26 02 B8 6C 55 F1 D6 B5 A9 90 8A EE 52 D6 3D 51 0E 78 57 D1 8E 82 30 685s 2024-03-07 20:03:32,437 DEBUG: Directory: repo 685s 2024-03-07 20:03:32,437 DEBUG: > jar cf index.jar index.xml 685s 2024-03-07 20:03:32,741 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.g311/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 686s jar signed. 686s 686s Warning: 686s The signer's certificate is self-signed. 686s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 686s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 687s 2024-03-07 20:03:34,051 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 687s 2024-03-07 20:03:34,060 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.g311/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 688s jar signed. 688s 688s Warning: 688s The signer's certificate is self-signed. 688s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 688s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 688s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 688s 2024-03-07 20:03:35,773 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.g311/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar 690s 2024-03-07 20:03:37,083 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.g311/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 691s 2024-03-07 20:03:38,104 DEBUG: Outputting JSON 691s 2024-03-07 20:03:38,105 DEBUG: skip deploying full build logs: not enabled in config 691s 2024-03-07 20:03:38,105 DEBUG: skip deploying full build logs: not enabled in config 691s 2024-03-07 20:03:38,106 DEBUG: skip deploying full build logs: not enabled in config 691s 2024-03-07 20:03:38,106 INFO: Finished 691s + /usr/bin/fdroid readmeta 691s ============================================================================== 691s setup a new repo manually and generate a keystore 691s + test -e repo/index.xml 691s + test -e repo/index.jar 691s + test -e repo/index-v1.jar 691s + test -e tmp/apkcache.json 691s + test -z tmp/apkcache.json 691s + grep -F '. 700s ] 700s ] 700s 700s 702s 2024-03-07 20:03:49,465 INFO: Creating signed index with this key (SHA256): 702s 2024-03-07 20:03:49,465 INFO: D8 75 88 FB D3 96 2E E5 FF 65 1D 16 79 1D 32 16 C9 1D 24 6D C5 82 09 1B 7D FC 12 34 71 37 5C 04 704s 2024-03-07 20:03:51,073 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 708s 2024-03-07 20:03:55,027 INFO: Finished 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.dyndns.fules.ck_20.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.dyndns.fules.ck_20.apk --> repo/org.dyndns.fules.ck_20.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk 708s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.dUcx/keystore.p12 708s + copy_apks_into_repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.dUcx 708s + set +x 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 708s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 709s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 710s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 711s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 712s Requested API level 30 is larger than maximum we have, returning API level 28 instead. 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 712s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk 713s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk 713s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 713s + /usr/bin/fdroid update --create-metadata --verbose 713s 2024-03-07 20:04:00,491 DEBUG: Reading 'config.yml' 713s 2024-03-07 20:04:00,492 WARNING: unsafe permissions on 'config.yml' (should be 0600)! 713s 2024-03-07 20:04:00,496 DEBUG: ipfs_cid not found, skipping CIDv1 generation 713s 2024-03-07 20:04:00,496 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 713s 2024-03-07 20:04:00,496 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 713s 2024-03-07 20:04:00,497 DEBUG: Processing SpeedoMeterApp.main_1.apk 713s 2024-03-07 20:04:00,583 INFO: Starting analysis on AndroidManifest.xml 713s 2024-03-07 20:04:00,591 INFO: APK file was successfully validated! 713s 2024-03-07 20:04:00,593 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 713s 2024-03-07 20:04:00,599 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 713s 2024-03-07 20:04:00,930 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 713s Verified using v1 scheme (JAR signing): true 713s Verified using v2 scheme (APK Signature Scheme v2): false 713s Verified using v3 scheme (APK Signature Scheme v3): false 713s Verified using v4 scheme (APK Signature Scheme v4): false 713s Verified for SourceStamp: false 713s Number of signers: 1 713s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 713s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 713s 713s 2024-03-07 20:04:00,931 DEBUG: Processing apk.embedded_1.apk 713s 2024-03-07 20:04:00,932 INFO: Starting analysis on AndroidManifest.xml 713s 2024-03-07 20:04:00,932 INFO: APK file was successfully validated! 713s 2024-03-07 20:04:00,934 DEBUG: Getting signature of apk.embedded_1.apk 714s 2024-03-07 20:04:01,292 DEBUG: repo/apk.embedded_1.apk: Verifies 714s Verified using v1 scheme (JAR signing): true 714s Verified using v2 scheme (APK Signature Scheme v2): true 714s Verified using v3 scheme (APK Signature Scheme v3): true 714s Verified using v4 scheme (APK Signature Scheme v4): false 714s Verified for SourceStamp: false 714s Number of signers: 1 714s 714s 2024-03-07 20:04:01,293 DEBUG: Processing com.example.test.helloworld_1.apk 714s 2024-03-07 20:04:01,293 INFO: Starting analysis on AndroidManifest.xml 714s 2024-03-07 20:04:01,294 INFO: APK file was successfully validated! 714s 2024-03-07 20:04:01,296 DEBUG: Getting signature of com.example.test.helloworld_1.apk 714s 2024-03-07 20:04:01,625 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 714s Verified using v1 scheme (JAR signing): true 714s Verified using v2 scheme (APK Signature Scheme v2): false 714s Verified using v3 scheme (APK Signature Scheme v3): false 714s Verified using v4 scheme (APK Signature Scheme v4): false 714s Verified for SourceStamp: false 714s Number of signers: 1 714s 714s 2024-03-07 20:04:01,626 DEBUG: Processing com.politedroid_3.apk 714s 2024-03-07 20:04:01,626 INFO: Starting analysis on AndroidManifest.xml 714s 2024-03-07 20:04:01,627 INFO: APK file was successfully validated! 714s 2024-03-07 20:04:01,629 DEBUG: Getting signature of com.politedroid_3.apk 714s 2024-03-07 20:04:01,971 DEBUG: repo/com.politedroid_3.apk: Verifies 714s Verified using v1 scheme (JAR signing): true 714s Verified using v2 scheme (APK Signature Scheme v2): false 714s Verified using v3 scheme (APK Signature Scheme v3): false 714s Verified using v4 scheme (APK Signature Scheme v4): false 714s Verified for SourceStamp: false 714s Number of signers: 1 714s 715s 2024-03-07 20:04:01,975 DEBUG: Processing com.politedroid_4.apk 715s 2024-03-07 20:04:01,976 INFO: Starting analysis on AndroidManifest.xml 715s 2024-03-07 20:04:01,977 INFO: APK file was successfully validated! 715s 2024-03-07 20:04:01,978 DEBUG: Getting signature of com.politedroid_4.apk 715s 2024-03-07 20:04:02,318 DEBUG: repo/com.politedroid_4.apk: Verifies 715s Verified using v1 scheme (JAR signing): true 715s Verified using v2 scheme (APK Signature Scheme v2): false 715s Verified using v3 scheme (APK Signature Scheme v3): false 715s Verified using v4 scheme (APK Signature Scheme v4): false 715s Verified for SourceStamp: false 715s Number of signers: 1 715s 715s 2024-03-07 20:04:02,320 DEBUG: Processing com.politedroid_5.apk 715s 2024-03-07 20:04:02,320 INFO: Starting analysis on AndroidManifest.xml 715s 2024-03-07 20:04:02,321 INFO: APK file was successfully validated! 715s 2024-03-07 20:04:02,322 DEBUG: Getting signature of com.politedroid_5.apk 715s 2024-03-07 20:04:02,663 DEBUG: repo/com.politedroid_5.apk: Verifies 715s Verified using v1 scheme (JAR signing): true 715s Verified using v2 scheme (APK Signature Scheme v2): false 715s Verified using v3 scheme (APK Signature Scheme v3): false 715s Verified using v4 scheme (APK Signature Scheme v4): false 715s Verified for SourceStamp: false 715s Number of signers: 1 715s 715s 2024-03-07 20:04:02,665 DEBUG: Processing com.politedroid_6.apk 715s 2024-03-07 20:04:02,665 INFO: Starting analysis on AndroidManifest.xml 715s 2024-03-07 20:04:02,666 INFO: APK file was successfully validated! 715s 2024-03-07 20:04:02,668 DEBUG: Getting signature of com.politedroid_6.apk 716s 2024-03-07 20:04:03,010 DEBUG: repo/com.politedroid_6.apk: Verifies 716s Verified using v1 scheme (JAR signing): true 716s Verified using v2 scheme (APK Signature Scheme v2): false 716s Verified using v3 scheme (APK Signature Scheme v3): false 716s Verified using v4 scheme (APK Signature Scheme v4): false 716s Verified for SourceStamp: false 716s Number of signers: 1 716s 716s 2024-03-07 20:04:03,012 DEBUG: Processing duplicate.permisssions_9999999.apk 716s 2024-03-07 20:04:03,013 INFO: Starting analysis on AndroidManifest.xml 716s 2024-03-07 20:04:03,015 INFO: APK file was successfully validated! 716s 2024-03-07 20:04:03,017 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 716s 2024-03-07 20:04:03,023 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 716s 2024-03-07 20:04:03,380 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 716s Verified using v1 scheme (JAR signing): true 716s Verified using v2 scheme (APK Signature Scheme v2): true 716s Verified using v3 scheme (APK Signature Scheme v3): false 716s Verified using v4 scheme (APK Signature Scheme v4): false 716s Verified for SourceStamp: false 716s Number of signers: 1 716s 716s 2024-03-07 20:04:03,381 DEBUG: Density 120 not available, resizing down from 160 716s 2024-03-07 20:04:03,383 DEBUG: Processing info.guardianproject.urzip_100.apk 716s 2024-03-07 20:04:03,383 INFO: Starting analysis on AndroidManifest.xml 716s 2024-03-07 20:04:03,385 INFO: APK file was successfully validated! 716s 2024-03-07 20:04:03,386 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 716s 2024-03-07 20:04:03,733 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 716s Verified using v1 scheme (JAR signing): true 716s Verified using v2 scheme (APK Signature Scheme v2): false 716s Verified using v3 scheme (APK Signature Scheme v3): false 716s Verified using v4 scheme (APK Signature Scheme v4): false 716s Verified for SourceStamp: false 716s Number of signers: 1 716s 716s 2024-03-07 20:04:03,734 DEBUG: Density 120 not available, resizing down from 160 716s 2024-03-07 20:04:03,735 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 716s 2024-03-07 20:04:03,736 INFO: Starting analysis on AndroidManifest.xml 716s 2024-03-07 20:04:03,737 INFO: APK file was successfully validated! 716s 2024-03-07 20:04:03,739 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 717s 2024-03-07 20:04:04,071 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 717s Verified using v1 scheme (JAR signing): true 717s Verified using v2 scheme (APK Signature Scheme v2): false 717s Verified using v3 scheme (APK Signature Scheme v3): false 717s Verified using v4 scheme (APK Signature Scheme v4): false 717s Verified for SourceStamp: false 717s Number of signers: 1 717s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 717s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 717s 717s 2024-03-07 20:04:04,071 DEBUG: Processing no.min.target.sdk_987.apk 717s 2024-03-07 20:04:04,072 INFO: Starting analysis on AndroidManifest.xml 717s 2024-03-07 20:04:04,073 INFO: APK file was successfully validated! 717s 2024-03-07 20:04:04,074 DEBUG: Getting signature of no.min.target.sdk_987.apk 717s 2024-03-07 20:04:04,082 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 717s 2024-03-07 20:04:04,444 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 717s Verified using v1 scheme (JAR signing): true 717s Verified using v2 scheme (APK Signature Scheme v2): true 717s Verified using v3 scheme (APK Signature Scheme v3): false 717s Verified using v4 scheme (APK Signature Scheme v4): false 717s Verified for SourceStamp: false 717s Number of signers: 1 717s 717s 2024-03-07 20:04:04,444 DEBUG: Density 120 not available, resizing down from 160 717s 2024-03-07 20:04:04,446 DEBUG: Processing obb.main.oldversion_1444412523.apk 717s 2024-03-07 20:04:04,446 INFO: Starting analysis on AndroidManifest.xml 717s 2024-03-07 20:04:04,448 INFO: APK file was successfully validated! 717s 2024-03-07 20:04:04,450 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 717s 2024-03-07 20:04:04,825 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 717s Verified using v1 scheme (JAR signing): true 717s Verified using v2 scheme (APK Signature Scheme v2): true 717s Verified using v3 scheme (APK Signature Scheme v3): false 717s Verified using v4 scheme (APK Signature Scheme v4): false 717s Verified for SourceStamp: false 717s Number of signers: 1 717s 717s 2024-03-07 20:04:04,826 DEBUG: Density 120 not available, resizing down from 160 717s 2024-03-07 20:04:04,827 DEBUG: Processing obb.main.twoversions_1101613.apk 717s 2024-03-07 20:04:04,828 INFO: Starting analysis on AndroidManifest.xml 717s 2024-03-07 20:04:04,829 INFO: APK file was successfully validated! 717s 2024-03-07 20:04:04,831 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 718s 2024-03-07 20:04:05,163 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 718s Verified using v1 scheme (JAR signing): true 718s Verified using v2 scheme (APK Signature Scheme v2): false 718s Verified using v3 scheme (APK Signature Scheme v3): false 718s Verified using v4 scheme (APK Signature Scheme v4): false 718s Verified for SourceStamp: false 718s Number of signers: 1 718s 718s 2024-03-07 20:04:05,164 DEBUG: Density 120 not available, resizing down from 160 718s 2024-03-07 20:04:05,166 DEBUG: Processing obb.main.twoversions_1101615.apk 718s 2024-03-07 20:04:05,166 INFO: Starting analysis on AndroidManifest.xml 718s 2024-03-07 20:04:05,167 INFO: APK file was successfully validated! 718s 2024-03-07 20:04:05,169 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 718s 2024-03-07 20:04:05,515 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 718s Verified using v1 scheme (JAR signing): true 718s Verified using v2 scheme (APK Signature Scheme v2): false 718s Verified using v3 scheme (APK Signature Scheme v3): false 718s Verified using v4 scheme (APK Signature Scheme v4): false 718s Verified for SourceStamp: false 718s Number of signers: 1 718s 718s 2024-03-07 20:04:05,516 DEBUG: Density 120 not available, resizing down from 160 718s 2024-03-07 20:04:05,517 DEBUG: Processing obb.main.twoversions_1101617.apk 718s 2024-03-07 20:04:05,517 INFO: Starting analysis on AndroidManifest.xml 718s 2024-03-07 20:04:05,519 INFO: APK file was successfully validated! 718s 2024-03-07 20:04:05,520 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 718s 2024-03-07 20:04:05,866 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 718s Verified using v1 scheme (JAR signing): true 718s Verified using v2 scheme (APK Signature Scheme v2): false 718s Verified using v3 scheme (APK Signature Scheme v3): false 718s Verified using v4 scheme (APK Signature Scheme v4): false 718s Verified for SourceStamp: false 718s Number of signers: 1 718s 718s 2024-03-07 20:04:05,866 DEBUG: Density 120 not available, resizing down from 160 718s 2024-03-07 20:04:05,868 DEBUG: Processing obb.mainpatch.current_1619.apk 718s 2024-03-07 20:04:05,868 INFO: Starting analysis on AndroidManifest.xml 718s 2024-03-07 20:04:05,870 INFO: APK file was successfully validated! 718s 2024-03-07 20:04:05,871 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 719s 2024-03-07 20:04:06,212 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 719s Verified using v1 scheme (JAR signing): true 719s Verified using v2 scheme (APK Signature Scheme v2): false 719s Verified using v3 scheme (APK Signature Scheme v3): false 719s Verified using v4 scheme (APK Signature Scheme v4): false 719s Verified for SourceStamp: false 719s Number of signers: 1 719s 719s 2024-03-07 20:04:06,213 DEBUG: Density 120 not available, resizing down from 160 719s 2024-03-07 20:04:06,215 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 719s 2024-03-07 20:04:06,215 INFO: Starting analysis on AndroidManifest.xml 719s 2024-03-07 20:04:06,216 INFO: APK file was successfully validated! 719s 2024-03-07 20:04:06,218 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 719s 2024-03-07 20:04:06,554 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 719s Verified using v1 scheme (JAR signing): true 719s Verified using v2 scheme (APK Signature Scheme v2): false 719s Verified using v3 scheme (APK Signature Scheme v3): false 719s Verified using v4 scheme (APK Signature Scheme v4): false 719s Verified for SourceStamp: false 719s Number of signers: 1 719s 719s 2024-03-07 20:04:06,554 DEBUG: Density 120 not available, resizing down from 160 719s 2024-03-07 20:04:06,556 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 719s 2024-03-07 20:04:06,556 INFO: Starting analysis on AndroidManifest.xml 719s 2024-03-07 20:04:06,557 INFO: APK file was successfully validated! 719s 2024-03-07 20:04:06,559 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 719s 2024-03-07 20:04:06,889 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 719s Verified using v1 scheme (JAR signing): true 719s Verified using v2 scheme (APK Signature Scheme v2): false 719s Verified using v3 scheme (APK Signature Scheme v3): false 719s Verified using v4 scheme (APK Signature Scheme v4): false 719s Verified for SourceStamp: false 719s Number of signers: 1 719s 719s 2024-03-07 20:04:06,890 DEBUG: Density 120 not available, resizing down from 160 719s 2024-03-07 20:04:06,892 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 719s 2024-03-07 20:04:06,892 INFO: Starting analysis on AndroidManifest.xml 719s 2024-03-07 20:04:06,893 INFO: APK file was successfully validated! 719s 2024-03-07 20:04:06,894 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 720s 2024-03-07 20:04:07,232 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 720s Verified using v1 scheme (JAR signing): true 720s Verified using v2 scheme (APK Signature Scheme v2): false 720s Verified using v3 scheme (APK Signature Scheme v3): false 720s Verified using v4 scheme (APK Signature Scheme v4): false 720s Verified for SourceStamp: false 720s Number of signers: 1 720s 720s 2024-03-07 20:04:07,232 DEBUG: Density 120 not available, resizing down from 160 720s 2024-03-07 20:04:07,234 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 720s 2024-03-07 20:04:07,234 INFO: Starting analysis on AndroidManifest.xml 720s 2024-03-07 20:04:07,235 INFO: APK file was successfully validated! 720s 2024-03-07 20:04:07,237 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 720s 2024-03-07 20:04:07,562 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 720s Verified using v1 scheme (JAR signing): true 720s Verified using v2 scheme (APK Signature Scheme v2): false 720s Verified using v3 scheme (APK Signature Scheme v3): false 720s Verified using v4 scheme (APK Signature Scheme v4): false 720s Verified for SourceStamp: false 720s Number of signers: 1 720s 720s 2024-03-07 20:04:07,563 DEBUG: Density 120 not available, resizing down from 160 720s 2024-03-07 20:04:07,565 DEBUG: Processing org.dyndns.fules.ck_20.apk 720s 2024-03-07 20:04:07,565 INFO: Starting analysis on AndroidManifest.xml 720s 2024-03-07 20:04:07,566 INFO: APK file was successfully validated! 720s 2024-03-07 20:04:07,569 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 721s 2024-03-07 20:04:07,992 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 721s Verified using v1 scheme (JAR signing): true 721s Verified using v2 scheme (APK Signature Scheme v2): false 721s Verified using v3 scheme (APK Signature Scheme v3): false 721s Verified using v4 scheme (APK Signature Scheme v4): false 721s Verified for SourceStamp: false 721s Number of signers: 1 721s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 721s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 721s 721s 2024-03-07 20:04:07,994 DEBUG: Processing souch.smsbypass_9.apk 721s 2024-03-07 20:04:07,995 INFO: Starting analysis on AndroidManifest.xml 721s 2024-03-07 20:04:07,996 INFO: APK file was successfully validated! 721s 2024-03-07 20:04:08,000 DEBUG: Getting signature of souch.smsbypass_9.apk 721s 2024-03-07 20:04:08,401 DEBUG: repo/souch.smsbypass_9.apk: Verifies 721s Verified using v1 scheme (JAR signing): true 721s Verified using v2 scheme (APK Signature Scheme v2): false 721s Verified using v3 scheme (APK Signature Scheme v3): false 721s Verified using v4 scheme (APK Signature Scheme v4): false 721s Verified for SourceStamp: false 721s Number of signers: 1 721s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 721s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 721s 721s 2024-03-07 20:04:08,402 DEBUG: Density 120 not available, resizing down from 160 721s 2024-03-07 20:04:08,404 DEBUG: Processing v1.v2.sig_1020.apk 721s 2024-03-07 20:04:08,404 INFO: Starting analysis on AndroidManifest.xml 721s 2024-03-07 20:04:08,406 INFO: APK file was successfully validated! 721s 2024-03-07 20:04:08,408 DEBUG: Getting signature of v1.v2.sig_1020.apk 721s 2024-03-07 20:04:08,795 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 721s Verified using v1 scheme (JAR signing): true 721s Verified using v2 scheme (APK Signature Scheme v2): true 721s Verified using v3 scheme (APK Signature Scheme v3): false 721s Verified using v4 scheme (APK Signature Scheme v4): false 721s Verified for SourceStamp: false 721s Number of signers: 1 721s 721s 2024-03-07 20:04:08,795 DEBUG: Density 120 not available, resizing down from 160 721s 2024-03-07 20:04:08,797 DEBUG: Processing v2.only.sig_2.apk 721s 2024-03-07 20:04:08,797 INFO: Starting analysis on AndroidManifest.xml 721s 2024-03-07 20:04:08,799 INFO: APK file was successfully validated! 721s 2024-03-07 20:04:08,800 DEBUG: Getting signature of v2.only.sig_2.apk 721s 2024-03-07 20:04:08,801 INFO: Starting analysis on AndroidManifest.xml 721s 2024-03-07 20:04:08,802 INFO: APK file was successfully validated! 721s 2024-03-07 20:04:08,803 DEBUG: Using APK Signature v2 721s 2024-03-07 20:04:08,803 INFO: Starting analysis on AndroidManifest.xml 721s 2024-03-07 20:04:08,805 INFO: APK file was successfully validated! 721s 2024-03-07 20:04:08,806 DEBUG: Using APK Signature v2 722s 2024-03-07 20:04:09,121 DEBUG: repo/v2.only.sig_2.apk: Verifies 722s Verified using v1 scheme (JAR signing): false 722s Verified using v2 scheme (APK Signature Scheme v2): true 722s Verified using v3 scheme (APK Signature Scheme v3): false 722s Verified using v4 scheme (APK Signature Scheme v4): false 722s Verified for SourceStamp: false 722s Number of signers: 1 722s 722s 2024-03-07 20:04:09,122 DEBUG: Density 120 not available, resizing down from 160 722s 2024-03-07 20:04:09,124 INFO: Generated skeleton metadata for SpeedoMeterApp.main 722s 2024-03-07 20:04:09,126 INFO: Generated skeleton metadata for apk.embedded 722s 2024-03-07 20:04:09,128 INFO: Generated skeleton metadata for com.example.test.helloworld 722s 2024-03-07 20:04:09,130 INFO: Generated skeleton metadata for com.politedroid 722s 2024-03-07 20:04:09,133 INFO: Generated skeleton metadata for duplicate.permisssions 722s 2024-03-07 20:04:09,135 INFO: Generated skeleton metadata for info.guardianproject.urzip 722s 2024-03-07 20:04:09,139 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 722s 2024-03-07 20:04:09,142 INFO: Generated skeleton metadata for no.min.target.sdk 722s 2024-03-07 20:04:09,146 INFO: Generated skeleton metadata for obb.main.oldversion 722s 2024-03-07 20:04:09,151 INFO: Generated skeleton metadata for obb.main.twoversions 722s 2024-03-07 20:04:09,156 INFO: Generated skeleton metadata for obb.mainpatch.current 722s 2024-03-07 20:04:09,161 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 722s 2024-03-07 20:04:09,167 INFO: Generated skeleton metadata for org.dyndns.fules.ck 722s 2024-03-07 20:04:09,173 INFO: Generated skeleton metadata for souch.smsbypass 722s 2024-03-07 20:04:09,179 INFO: Generated skeleton metadata for v1.v2.sig 722s 2024-03-07 20:04:09,186 INFO: Generated skeleton metadata for v2.only.sig 722s 2024-03-07 20:04:09,196 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 723s 2024-03-07 20:04:10,207 INFO: Creating signed index with this key (SHA256): 723s 2024-03-07 20:04:10,207 INFO: D8 75 88 FB D3 96 2E E5 FF 65 1D 16 79 1D 32 16 C9 1D 24 6D C5 82 09 1B 7D FC 12 34 71 37 5C 04 723s 2024-03-07 20:04:10,207 DEBUG: Directory: repo 723s 2024-03-07 20:04:10,207 DEBUG: > jar cf index.jar index.xml 723s 2024-03-07 20:04:10,511 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 724s jar signed. 724s 724s Warning: 724s The signer's certificate is self-signed. 724s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 724s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 724s 2024-03-07 20:04:11,919 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 724s 2024-03-07 20:04:11,928 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 726s jar signed. 726s 726s Warning: 726s The signer's certificate is self-signed. 726s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 726s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 726s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 726s 2024-03-07 20:04:13,645 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar 727s 2024-03-07 20:04:14,759 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 728s 2024-03-07 20:04:15,777 DEBUG: Outputting JSON 728s 2024-03-07 20:04:15,778 DEBUG: skip deploying full build logs: not enabled in config 728s 2024-03-07 20:04:15,778 DEBUG: skip deploying full build logs: not enabled in config 728s 2024-03-07 20:04:15,779 DEBUG: skip deploying full build logs: not enabled in config 728s 2024-03-07 20:04:15,779 INFO: Finished 728s + /usr/bin/fdroid readmeta 729s 2024-03-07 20:04:16,260 WARNING: unsafe permissions on 'config.yml' (should be 0600)! 729s + test -e repo/index.xml 729s + test -e repo/index.jar 729s + test -e repo/index-v1.jar 729s + test -e tmp/apkcache.json 729s + test -z tmp/apkcache.json 729s + grep -F ' repo/org.dyndns.fules.ck_20.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101615.apk --> repo/obb.main.twoversions_1101615.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.example.test.helloworld_1.apk --> repo/com.example.test.helloworld_1.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/souch.smsbypass_9.apk --> repo/souch.smsbypass_9.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/no.min.target.sdk_987.apk --> repo/no.min.target.sdk_987.apk 735s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101613.apk --> repo/obb.main.twoversions_1101613.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.twoversions_1101617.apk --> repo/obb.main.twoversions_1101617.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.main.oldversion_1444412523.apk --> repo/obb.main.oldversion_1444412523.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk --> repo/com.politedroid_6.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619.apk --> repo/obb.mainpatch.current_1619.apk 736s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/info.zwanenburg.caffeinetile_4.apk --> repo/info.zwanenburg.caffeinetile_4.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/duplicate.permisssions_9999999.apk --> repo/duplicate.permisssions_9999999.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk --> repo/info.guardianproject.urzip_100.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/obb.mainpatch.current_1619_another-release-key.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk --> repo/com.politedroid_4.apk 737s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk --> repo/com.politedroid_3.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/v1.v2.sig_1020.apk --> repo/v1.v2.sig_1020.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk --> repo/com.politedroid_5.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/SpeedoMeterApp.main_1.apk --> repo/SpeedoMeterApp.main_1.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_4.apk --> repo/org.bitbucket.tickytacky.mirrormirror_4.apk 738s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_2.apk --> repo/org.bitbucket.tickytacky.mirrormirror_2.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_3.apk --> repo/org.bitbucket.tickytacky.mirrormirror_3.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/org.bitbucket.tickytacky.mirrormirror_1.apk --> repo/org.bitbucket.tickytacky.mirrormirror_1.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk 739s Requested API level 30 is larger than maximum we have, returning API level 28 instead. 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/apk.embedded_1.apk --> repo/apk.embedded_1.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release.apk 739s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk 740s /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/v2.only.sig_2.apk --> repo/v2.only.sig_2.apk 740s + /usr/bin/fdroid update --create-metadata --verbose 740s 2024-03-07 20:04:27,494 DEBUG: Reading 'config.yml' 740s 2024-03-07 20:04:27,506 DEBUG: ipfs_cid not found, skipping CIDv1 generation 740s 2024-03-07 20:04:27,506 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 740s 2024-03-07 20:04:27,507 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 740s 2024-03-07 20:04:27,508 DEBUG: Processing SpeedoMeterApp.main_1.apk 740s 2024-03-07 20:04:27,594 INFO: Starting analysis on AndroidManifest.xml 740s 2024-03-07 20:04:27,603 INFO: APK file was successfully validated! 740s 2024-03-07 20:04:27,605 DEBUG: Getting signature of SpeedoMeterApp.main_1.apk 740s 2024-03-07 20:04:27,611 WARNING: No minimum SDK version found in repo/SpeedoMeterApp.main_1.apk, using default (3). 740s 2024-03-07 20:04:27,928 DEBUG: repo/SpeedoMeterApp.main_1.apk: Verifies 740s Verified using v1 scheme (JAR signing): true 740s Verified using v2 scheme (APK Signature Scheme v2): false 740s Verified using v3 scheme (APK Signature Scheme v3): false 740s Verified using v4 scheme (APK Signature Scheme v4): false 740s Verified for SourceStamp: false 740s Number of signers: 1 740s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 740s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 740s 740s 2024-03-07 20:04:27,929 DEBUG: Processing apk.embedded_1.apk 740s 2024-03-07 20:04:27,929 INFO: Starting analysis on AndroidManifest.xml 740s 2024-03-07 20:04:27,930 INFO: APK file was successfully validated! 740s 2024-03-07 20:04:27,932 DEBUG: Getting signature of apk.embedded_1.apk 741s 2024-03-07 20:04:28,294 DEBUG: repo/apk.embedded_1.apk: Verifies 741s Verified using v1 scheme (JAR signing): true 741s Verified using v2 scheme (APK Signature Scheme v2): true 741s Verified using v3 scheme (APK Signature Scheme v3): true 741s Verified using v4 scheme (APK Signature Scheme v4): false 741s Verified for SourceStamp: false 741s Number of signers: 1 741s 741s 2024-03-07 20:04:28,294 DEBUG: Processing com.example.test.helloworld_1.apk 741s 2024-03-07 20:04:28,295 INFO: Starting analysis on AndroidManifest.xml 741s 2024-03-07 20:04:28,296 INFO: APK file was successfully validated! 741s 2024-03-07 20:04:28,298 DEBUG: Getting signature of com.example.test.helloworld_1.apk 741s 2024-03-07 20:04:28,641 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 741s Verified using v1 scheme (JAR signing): true 741s Verified using v2 scheme (APK Signature Scheme v2): false 741s Verified using v3 scheme (APK Signature Scheme v3): false 741s Verified using v4 scheme (APK Signature Scheme v4): false 741s Verified for SourceStamp: false 741s Number of signers: 1 741s 741s 2024-03-07 20:04:28,642 DEBUG: Processing com.politedroid_3.apk 741s 2024-03-07 20:04:28,642 INFO: Starting analysis on AndroidManifest.xml 741s 2024-03-07 20:04:28,643 INFO: APK file was successfully validated! 741s 2024-03-07 20:04:28,645 DEBUG: Getting signature of com.politedroid_3.apk 742s 2024-03-07 20:04:28,988 DEBUG: repo/com.politedroid_3.apk: Verifies 742s Verified using v1 scheme (JAR signing): true 742s Verified using v2 scheme (APK Signature Scheme v2): false 742s Verified using v3 scheme (APK Signature Scheme v3): false 742s Verified using v4 scheme (APK Signature Scheme v4): false 742s Verified for SourceStamp: false 742s Number of signers: 1 742s 742s 2024-03-07 20:04:28,992 DEBUG: Processing com.politedroid_4.apk 742s 2024-03-07 20:04:28,993 INFO: Starting analysis on AndroidManifest.xml 742s 2024-03-07 20:04:28,993 INFO: APK file was successfully validated! 742s 2024-03-07 20:04:28,995 DEBUG: Getting signature of com.politedroid_4.apk 742s 2024-03-07 20:04:29,334 DEBUG: repo/com.politedroid_4.apk: Verifies 742s Verified using v1 scheme (JAR signing): true 742s Verified using v2 scheme (APK Signature Scheme v2): false 742s Verified using v3 scheme (APK Signature Scheme v3): false 742s Verified using v4 scheme (APK Signature Scheme v4): false 742s Verified for SourceStamp: false 742s Number of signers: 1 742s 742s 2024-03-07 20:04:29,336 DEBUG: Processing com.politedroid_5.apk 742s 2024-03-07 20:04:29,336 INFO: Starting analysis on AndroidManifest.xml 742s 2024-03-07 20:04:29,337 INFO: APK file was successfully validated! 742s 2024-03-07 20:04:29,339 DEBUG: Getting signature of com.politedroid_5.apk 742s 2024-03-07 20:04:29,688 DEBUG: repo/com.politedroid_5.apk: Verifies 742s Verified using v1 scheme (JAR signing): true 742s Verified using v2 scheme (APK Signature Scheme v2): false 742s Verified using v3 scheme (APK Signature Scheme v3): false 742s Verified using v4 scheme (APK Signature Scheme v4): false 742s Verified for SourceStamp: false 742s Number of signers: 1 742s 742s 2024-03-07 20:04:29,690 DEBUG: Processing com.politedroid_6.apk 742s 2024-03-07 20:04:29,690 INFO: Starting analysis on AndroidManifest.xml 742s 2024-03-07 20:04:29,691 INFO: APK file was successfully validated! 742s 2024-03-07 20:04:29,693 DEBUG: Getting signature of com.politedroid_6.apk 743s 2024-03-07 20:04:30,031 DEBUG: repo/com.politedroid_6.apk: Verifies 743s Verified using v1 scheme (JAR signing): true 743s Verified using v2 scheme (APK Signature Scheme v2): false 743s Verified using v3 scheme (APK Signature Scheme v3): false 743s Verified using v4 scheme (APK Signature Scheme v4): false 743s Verified for SourceStamp: false 743s Number of signers: 1 743s 743s 2024-03-07 20:04:30,033 DEBUG: Processing duplicate.permisssions_9999999.apk 743s 2024-03-07 20:04:30,033 INFO: Starting analysis on AndroidManifest.xml 743s 2024-03-07 20:04:30,035 INFO: APK file was successfully validated! 743s 2024-03-07 20:04:30,037 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 743s 2024-03-07 20:04:30,043 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 743s 2024-03-07 20:04:30,392 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 743s Verified using v1 scheme (JAR signing): true 743s Verified using v2 scheme (APK Signature Scheme v2): true 743s Verified using v3 scheme (APK Signature Scheme v3): false 743s Verified using v4 scheme (APK Signature Scheme v4): false 743s Verified for SourceStamp: false 743s Number of signers: 1 743s 743s 2024-03-07 20:04:30,393 DEBUG: Density 120 not available, resizing down from 160 743s 2024-03-07 20:04:30,394 DEBUG: Processing info.guardianproject.urzip_100.apk 743s 2024-03-07 20:04:30,394 INFO: Starting analysis on AndroidManifest.xml 743s 2024-03-07 20:04:30,396 INFO: APK file was successfully validated! 743s 2024-03-07 20:04:30,397 DEBUG: Getting signature of info.guardianproject.urzip_100.apk 743s 2024-03-07 20:04:30,754 DEBUG: repo/info.guardianproject.urzip_100.apk: Verifies 743s Verified using v1 scheme (JAR signing): true 743s Verified using v2 scheme (APK Signature Scheme v2): false 743s Verified using v3 scheme (APK Signature Scheme v3): false 743s Verified using v4 scheme (APK Signature Scheme v4): false 743s Verified for SourceStamp: false 743s Number of signers: 1 743s 743s 2024-03-07 20:04:30,755 DEBUG: Density 120 not available, resizing down from 160 743s 2024-03-07 20:04:30,757 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 743s 2024-03-07 20:04:30,757 INFO: Starting analysis on AndroidManifest.xml 743s 2024-03-07 20:04:30,758 INFO: APK file was successfully validated! 743s 2024-03-07 20:04:30,760 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 744s 2024-03-07 20:04:31,100 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 744s Verified using v1 scheme (JAR signing): true 744s Verified using v2 scheme (APK Signature Scheme v2): false 744s Verified using v3 scheme (APK Signature Scheme v3): false 744s Verified using v4 scheme (APK Signature Scheme v4): false 744s Verified for SourceStamp: false 744s Number of signers: 1 744s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 744s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 744s 744s 2024-03-07 20:04:31,101 DEBUG: Processing no.min.target.sdk_987.apk 744s 2024-03-07 20:04:31,101 INFO: Starting analysis on AndroidManifest.xml 744s 2024-03-07 20:04:31,103 INFO: APK file was successfully validated! 744s 2024-03-07 20:04:31,104 DEBUG: Getting signature of no.min.target.sdk_987.apk 744s 2024-03-07 20:04:31,112 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 744s 2024-03-07 20:04:31,486 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 744s Verified using v1 scheme (JAR signing): true 744s Verified using v2 scheme (APK Signature Scheme v2): true 744s Verified using v3 scheme (APK Signature Scheme v3): false 744s Verified using v4 scheme (APK Signature Scheme v4): false 744s Verified for SourceStamp: false 744s Number of signers: 1 744s 744s 2024-03-07 20:04:31,486 DEBUG: Density 120 not available, resizing down from 160 744s 2024-03-07 20:04:31,488 DEBUG: Processing obb.main.oldversion_1444412523.apk 744s 2024-03-07 20:04:31,488 INFO: Starting analysis on AndroidManifest.xml 744s 2024-03-07 20:04:31,490 INFO: APK file was successfully validated! 744s 2024-03-07 20:04:31,492 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 744s 2024-03-07 20:04:31,873 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 744s Verified using v1 scheme (JAR signing): true 744s Verified using v2 scheme (APK Signature Scheme v2): true 744s Verified using v3 scheme (APK Signature Scheme v3): false 744s Verified using v4 scheme (APK Signature Scheme v4): false 744s Verified for SourceStamp: false 744s Number of signers: 1 744s 744s 2024-03-07 20:04:31,873 DEBUG: Density 120 not available, resizing down from 160 744s 2024-03-07 20:04:31,875 DEBUG: Processing obb.main.twoversions_1101613.apk 744s 2024-03-07 20:04:31,875 INFO: Starting analysis on AndroidManifest.xml 744s 2024-03-07 20:04:31,877 INFO: APK file was successfully validated! 744s 2024-03-07 20:04:31,878 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 745s 2024-03-07 20:04:32,220 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 745s Verified using v1 scheme (JAR signing): true 745s Verified using v2 scheme (APK Signature Scheme v2): false 745s Verified using v3 scheme (APK Signature Scheme v3): false 745s Verified using v4 scheme (APK Signature Scheme v4): false 745s Verified for SourceStamp: false 745s Number of signers: 1 745s 745s 2024-03-07 20:04:32,220 DEBUG: Density 120 not available, resizing down from 160 745s 2024-03-07 20:04:32,222 DEBUG: Processing obb.main.twoversions_1101615.apk 745s 2024-03-07 20:04:32,222 INFO: Starting analysis on AndroidManifest.xml 745s 2024-03-07 20:04:32,224 INFO: APK file was successfully validated! 745s 2024-03-07 20:04:32,225 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 745s 2024-03-07 20:04:32,574 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 745s Verified using v1 scheme (JAR signing): true 745s Verified using v2 scheme (APK Signature Scheme v2): false 745s Verified using v3 scheme (APK Signature Scheme v3): false 745s Verified using v4 scheme (APK Signature Scheme v4): false 745s Verified for SourceStamp: false 745s Number of signers: 1 745s 745s 2024-03-07 20:04:32,575 DEBUG: Density 120 not available, resizing down from 160 745s 2024-03-07 20:04:32,576 DEBUG: Processing obb.main.twoversions_1101617.apk 745s 2024-03-07 20:04:32,577 INFO: Starting analysis on AndroidManifest.xml 745s 2024-03-07 20:04:32,578 INFO: APK file was successfully validated! 745s 2024-03-07 20:04:32,580 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 745s 2024-03-07 20:04:32,921 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 745s Verified using v1 scheme (JAR signing): true 745s Verified using v2 scheme (APK Signature Scheme v2): false 745s Verified using v3 scheme (APK Signature Scheme v3): false 745s Verified using v4 scheme (APK Signature Scheme v4): false 745s Verified for SourceStamp: false 745s Number of signers: 1 745s 745s 2024-03-07 20:04:32,922 DEBUG: Density 120 not available, resizing down from 160 745s 2024-03-07 20:04:32,923 DEBUG: Processing obb.mainpatch.current_1619.apk 745s 2024-03-07 20:04:32,924 INFO: Starting analysis on AndroidManifest.xml 745s 2024-03-07 20:04:32,925 INFO: APK file was successfully validated! 745s 2024-03-07 20:04:32,927 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 746s 2024-03-07 20:04:33,265 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 746s Verified using v1 scheme (JAR signing): true 746s Verified using v2 scheme (APK Signature Scheme v2): false 746s Verified using v3 scheme (APK Signature Scheme v3): false 746s Verified using v4 scheme (APK Signature Scheme v4): false 746s Verified for SourceStamp: false 746s Number of signers: 1 746s 746s 2024-03-07 20:04:33,265 DEBUG: Density 120 not available, resizing down from 160 746s 2024-03-07 20:04:33,267 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_1.apk 746s 2024-03-07 20:04:33,267 INFO: Starting analysis on AndroidManifest.xml 746s 2024-03-07 20:04:33,268 INFO: APK file was successfully validated! 746s 2024-03-07 20:04:33,270 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_1.apk 746s 2024-03-07 20:04:33,606 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_1.apk: Verifies 746s Verified using v1 scheme (JAR signing): true 746s Verified using v2 scheme (APK Signature Scheme v2): false 746s Verified using v3 scheme (APK Signature Scheme v3): false 746s Verified using v4 scheme (APK Signature Scheme v4): false 746s Verified for SourceStamp: false 746s Number of signers: 1 746s 746s 2024-03-07 20:04:33,607 DEBUG: Density 120 not available, resizing down from 160 746s 2024-03-07 20:04:33,608 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_2.apk 746s 2024-03-07 20:04:33,608 INFO: Starting analysis on AndroidManifest.xml 746s 2024-03-07 20:04:33,609 INFO: APK file was successfully validated! 746s 2024-03-07 20:04:33,611 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_2.apk 746s 2024-03-07 20:04:33,950 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_2.apk: Verifies 746s Verified using v1 scheme (JAR signing): true 746s Verified using v2 scheme (APK Signature Scheme v2): false 746s Verified using v3 scheme (APK Signature Scheme v3): false 746s Verified using v4 scheme (APK Signature Scheme v4): false 746s Verified for SourceStamp: false 746s Number of signers: 1 746s 746s 2024-03-07 20:04:33,950 DEBUG: Density 120 not available, resizing down from 160 746s 2024-03-07 20:04:33,952 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_3.apk 746s 2024-03-07 20:04:33,952 INFO: Starting analysis on AndroidManifest.xml 746s 2024-03-07 20:04:33,953 INFO: APK file was successfully validated! 746s 2024-03-07 20:04:33,955 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_3.apk 747s 2024-03-07 20:04:34,289 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_3.apk: Verifies 747s Verified using v1 scheme (JAR signing): true 747s Verified using v2 scheme (APK Signature Scheme v2): false 747s Verified using v3 scheme (APK Signature Scheme v3): false 747s Verified using v4 scheme (APK Signature Scheme v4): false 747s Verified for SourceStamp: false 747s Number of signers: 1 747s 747s 2024-03-07 20:04:34,290 DEBUG: Density 120 not available, resizing down from 160 747s 2024-03-07 20:04:34,292 DEBUG: Processing org.bitbucket.tickytacky.mirrormirror_4.apk 747s 2024-03-07 20:04:34,292 INFO: Starting analysis on AndroidManifest.xml 747s 2024-03-07 20:04:34,293 INFO: APK file was successfully validated! 747s 2024-03-07 20:04:34,294 DEBUG: Getting signature of org.bitbucket.tickytacky.mirrormirror_4.apk 747s 2024-03-07 20:04:34,637 DEBUG: repo/org.bitbucket.tickytacky.mirrormirror_4.apk: Verifies 747s Verified using v1 scheme (JAR signing): true 747s Verified using v2 scheme (APK Signature Scheme v2): false 747s Verified using v3 scheme (APK Signature Scheme v3): false 747s Verified using v4 scheme (APK Signature Scheme v4): false 747s Verified for SourceStamp: false 747s Number of signers: 1 747s 747s 2024-03-07 20:04:34,637 DEBUG: Density 120 not available, resizing down from 160 747s 2024-03-07 20:04:34,639 DEBUG: Processing org.dyndns.fules.ck_20.apk 747s 2024-03-07 20:04:34,639 INFO: Starting analysis on AndroidManifest.xml 747s 2024-03-07 20:04:34,640 INFO: APK file was successfully validated! 747s 2024-03-07 20:04:34,643 DEBUG: Getting signature of org.dyndns.fules.ck_20.apk 748s 2024-03-07 20:04:35,055 DEBUG: repo/org.dyndns.fules.ck_20.apk: Verifies 748s Verified using v1 scheme (JAR signing): true 748s Verified using v2 scheme (APK Signature Scheme v2): false 748s Verified using v3 scheme (APK Signature Scheme v3): false 748s Verified using v4 scheme (APK Signature Scheme v4): false 748s Verified for SourceStamp: false 748s Number of signers: 1 748s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 748s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 748s 748s 2024-03-07 20:04:35,057 DEBUG: Processing souch.smsbypass_9.apk 748s 2024-03-07 20:04:35,057 INFO: Starting analysis on AndroidManifest.xml 748s 2024-03-07 20:04:35,059 INFO: APK file was successfully validated! 748s 2024-03-07 20:04:35,062 DEBUG: Getting signature of souch.smsbypass_9.apk 748s 2024-03-07 20:04:35,442 DEBUG: repo/souch.smsbypass_9.apk: Verifies 748s Verified using v1 scheme (JAR signing): true 748s Verified using v2 scheme (APK Signature Scheme v2): false 748s Verified using v3 scheme (APK Signature Scheme v3): false 748s Verified using v4 scheme (APK Signature Scheme v4): false 748s Verified for SourceStamp: false 748s Number of signers: 1 748s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 748s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 748s 748s 2024-03-07 20:04:35,443 DEBUG: Density 120 not available, resizing down from 160 748s 2024-03-07 20:04:35,445 DEBUG: Processing v1.v2.sig_1020.apk 748s 2024-03-07 20:04:35,446 INFO: Starting analysis on AndroidManifest.xml 748s 2024-03-07 20:04:35,447 INFO: APK file was successfully validated! 748s 2024-03-07 20:04:35,449 DEBUG: Getting signature of v1.v2.sig_1020.apk 748s 2024-03-07 20:04:35,824 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 748s Verified using v1 scheme (JAR signing): true 748s Verified using v2 scheme (APK Signature Scheme v2): true 748s Verified using v3 scheme (APK Signature Scheme v3): false 748s Verified using v4 scheme (APK Signature Scheme v4): false 748s Verified for SourceStamp: false 748s Number of signers: 1 748s 748s 2024-03-07 20:04:35,825 DEBUG: Density 120 not available, resizing down from 160 748s 2024-03-07 20:04:35,826 DEBUG: Processing v2.only.sig_2.apk 748s 2024-03-07 20:04:35,827 INFO: Starting analysis on AndroidManifest.xml 748s 2024-03-07 20:04:35,828 INFO: APK file was successfully validated! 748s 2024-03-07 20:04:35,830 DEBUG: Getting signature of v2.only.sig_2.apk 748s 2024-03-07 20:04:35,830 INFO: Starting analysis on AndroidManifest.xml 748s 2024-03-07 20:04:35,831 INFO: APK file was successfully validated! 748s 2024-03-07 20:04:35,832 DEBUG: Using APK Signature v2 748s 2024-03-07 20:04:35,833 INFO: Starting analysis on AndroidManifest.xml 748s 2024-03-07 20:04:35,834 INFO: APK file was successfully validated! 748s 2024-03-07 20:04:35,835 DEBUG: Using APK Signature v2 749s 2024-03-07 20:04:36,149 DEBUG: repo/v2.only.sig_2.apk: Verifies 749s Verified using v1 scheme (JAR signing): false 749s Verified using v2 scheme (APK Signature Scheme v2): true 749s Verified using v3 scheme (APK Signature Scheme v3): false 749s Verified using v4 scheme (APK Signature Scheme v4): false 749s Verified for SourceStamp: false 749s Number of signers: 1 749s 749s 2024-03-07 20:04:36,150 DEBUG: Density 120 not available, resizing down from 160 749s 2024-03-07 20:04:36,153 INFO: Generated skeleton metadata for SpeedoMeterApp.main 749s 2024-03-07 20:04:36,155 INFO: Generated skeleton metadata for apk.embedded 749s 2024-03-07 20:04:36,157 INFO: Generated skeleton metadata for com.example.test.helloworld 749s 2024-03-07 20:04:36,159 INFO: Generated skeleton metadata for com.politedroid 749s 2024-03-07 20:04:36,162 INFO: Generated skeleton metadata for duplicate.permisssions 749s 2024-03-07 20:04:36,164 INFO: Generated skeleton metadata for info.guardianproject.urzip 749s 2024-03-07 20:04:36,168 INFO: Generated skeleton metadata for info.zwanenburg.caffeinetile 749s 2024-03-07 20:04:36,172 INFO: Generated skeleton metadata for no.min.target.sdk 749s 2024-03-07 20:04:36,176 INFO: Generated skeleton metadata for obb.main.oldversion 749s 2024-03-07 20:04:36,181 INFO: Generated skeleton metadata for obb.main.twoversions 749s 2024-03-07 20:04:36,185 INFO: Generated skeleton metadata for obb.mainpatch.current 749s 2024-03-07 20:04:36,191 INFO: Generated skeleton metadata for org.bitbucket.tickytacky.mirrormirror 749s 2024-03-07 20:04:36,197 INFO: Generated skeleton metadata for org.dyndns.fules.ck 749s 2024-03-07 20:04:36,203 INFO: Generated skeleton metadata for souch.smsbypass 749s 2024-03-07 20:04:36,210 INFO: Generated skeleton metadata for v1.v2.sig 749s 2024-03-07 20:04:36,217 INFO: Generated skeleton metadata for v2.only.sig 749s 2024-03-07 20:04:36,227 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 750s 2024-03-07 20:04:37,248 INFO: Creating signed index with this key (SHA256): 750s 2024-03-07 20:04:37,248 INFO: 4A F9 7B 0F 92 48 D4 5B BC 28 4C 1A FB 9F AF 02 14 F7 BD 78 A0 B5 B3 7A F9 9E 75 33 44 57 72 3A 750s 2024-03-07 20:04:37,248 DEBUG: Directory: repo 750s 2024-03-07 20:04:37,248 DEBUG: > jar cf index.jar index.xml 750s 2024-03-07 20:04:37,553 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 752s jar signed. 752s 752s Warning: 752s The signer's certificate is self-signed. 752s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 752s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 752s 2024-03-07 20:04:39,263 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 752s 2024-03-07 20:04:39,272 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 753s jar signed. 753s 753s Warning: 753s The signer's certificate is self-signed. 753s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 753s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 753s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 753s 2024-03-07 20:04:40,687 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar 754s 2024-03-07 20:04:41,699 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 755s 2024-03-07 20:04:42,619 DEBUG: Outputting JSON 755s 2024-03-07 20:04:42,620 DEBUG: skip deploying full build logs: not enabled in config 755s 2024-03-07 20:04:42,620 DEBUG: skip deploying full build logs: not enabled in config 755s 2024-03-07 20:04:42,621 DEBUG: skip deploying full build logs: not enabled in config 755s 2024-03-07 20:04:42,621 INFO: Finished 755s + /usr/bin/fdroid readmeta 756s + test -e repo/index.xml 756s + test -e repo/index.jar 756s + test -e repo/index-v1.jar 756s + grep -F ' /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 757s 2024-03-07 20:04:44,562 INFO: Creating signed index with this key (SHA256): 757s 2024-03-07 20:04:44,562 INFO: 4A F9 7B 0F 92 48 D4 5B BC 28 4C 1A FB 9F AF 02 14 F7 BD 78 A0 B5 B3 7A F9 9E 75 33 44 57 72 3A 757s 2024-03-07 20:04:44,562 DEBUG: Directory: repo 757s 2024-03-07 20:04:44,562 DEBUG: > jar cf index.jar index.xml 757s 2024-03-07 20:04:44,867 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 759s jar signed. 759s 759s Warning: 759s The signer's certificate is self-signed. 759s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 759s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 759s 2024-03-07 20:04:46,277 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 759s 2024-03-07 20:04:46,289 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keypass:env FDROID_KEY_PASS 760s jar signed. 760s 760s Warning: 760s The signer's certificate is self-signed. 760s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 760s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 760s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 760s 2024-03-07 20:04:47,703 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal --key-pass env:FDROID_KEY_PASS repo/entry.jar 762s 2024-03-07 20:04:49,014 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-p.novalocal -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.9X5X/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 762s 2024-03-07 20:04:49,934 DEBUG: Outputting JSON 762s 2024-03-07 20:04:49,934 DEBUG: skip deploying full build logs: not enabled in config 762s 2024-03-07 20:04:49,935 DEBUG: skip deploying full build logs: not enabled in config 762s 2024-03-07 20:04:49,935 DEBUG: skip deploying full build logs: not enabled in config 762s 2024-03-07 20:04:49,935 INFO: Finished 763s + /usr/bin/fdroid readmeta 763s + test -e repo/index.xml 763s + test -e repo/index.jar 763s + test -e repo/index-v1.jar 763s + test -e tmp/apkcache.json 763s + test -z tmp/apkcache.json 763s + grep -F ' 767s sys.exit(load_entry_point('fdroidserver==2.2.1', 'console_scripts', 'fdroid')()) 767s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 767s File "/usr/lib/python3/dist-packages/fdroidserver/__main__.py", line 211, in main 767s mod.main() 767s File "/usr/lib/python3/dist-packages/fdroidserver/update.py", line 2347, in main 767s index.make(repoapps, apks, repodirs[0], False) 767s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 71, in make 767s common.assert_config_keystore(common.config) 767s File "/usr/lib/python3/dist-packages/fdroidserver/common.py", line 555, in assert_config_keystore 767s raise FDroidException("This command requires a signing key, " 767s fdroidserver.exception.FDroidException: This command requires a signing key, you can create one using: fdroid update --create-key 767s + '[' 1 -eq 0 ']' 767s + echo '`fdroid update` prompted to add keystore' 767s + set -e 767s + touch /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.OVDx/keystore.p12 767s `fdroid update` prompted to add keystore 767s + echo 'keystore: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.OVDx/keystore.p12' 767s + echo 'repo_keyalias: foo' 767s + echo 'keystorepass: foo' 767s + echo 'keypass: foo' 767s + set +e 767s + /usr/bin/fdroid update --create-metadata --verbose 767s 2024-03-07 20:04:54,704 DEBUG: Reading 'config.yml' 767s 2024-03-07 20:04:54,705 WARNING: unsafe permissions on 'config.yml' (should be 0600)! 767s 2024-03-07 20:04:54,708 DEBUG: ipfs_cid not found, skipping CIDv1 generation 767s 2024-03-07 20:04:54,709 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 767s 2024-03-07 20:04:54,709 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 767s 2024-03-07 20:04:54,711 DEBUG: Reading urzip.apk from cache 767s 2024-03-07 20:04:54,712 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias foo -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.OVDx/keystore.p12 -storepass:env FDROID_KEY_STORE_PASS 770s Traceback (most recent call last): 770s File "/usr/bin/fdroid", line 33, in 770s sys.exit(load_entry_point('fdroidserver==2.2.1', 'console_scripts', 'fdroid')()) 770s ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 770s File "/usr/lib/python3/dist-packages/fdroidserver/__main__.py", line 211, in main 770s mod.main() 770s File "/usr/lib/python3/dist-packages/fdroidserver/update.py", line 2347, in main 770s index.make(repoapps, apks, repodirs[0], False) 770s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 139, in make 770s make_v0(sortedapps, apks, repodir, repodict, requestsdict, 770s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 1086, in make_v0 770s pubkey, repo_pubkey_fingerprint = extract_pubkey() 770s ^^^^^^^^^^^^^^^^ 770s File "/usr/lib/python3/dist-packages/fdroidserver/index.py", line 1392, in extract_pubkey 770s raise FDroidException(msg) 770s fdroidserver.exception.FDroidException: Failed to get repo pubkey! 770s + '[' 1 -eq 0 ']' 770s + echo '`fdroid update` prompted to add keystore' 770s + set -e 770s + echo_header 'copy tests/repo, update with binary transparency log' 770s `fdroid update` prompted to add keystore 770s ============================================================================== 770s copy tests/repo, update with binary transparency log 770s ++ create_test_dir 770s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 770s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 770s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK 770s ++ create_test_dir 770s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 770s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 770s + GIT_REMOTE=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.1mvg 770s + GNUPGHOME=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/gnupghome 770s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK 770s + fdroid_init_with_prebuilt_keystore 770s + '[' -z '' ']' 770s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 770s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 771s 2024-03-07 20:04:57,806 WARNING: 771s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 771s Now set these in config.yml: keystorepass, keypass, keydname 771s 771s 2024-03-07 20:04:57,806 INFO: 771s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK" with this config: 771s 771s Android SDK: /usr/lib/android-sdk 771s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 771s Alias for key in store: sova 771s 771s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/repo" 771s then run "fdroid update -c; fdroid update". You might also want to edit 771s "config.yml" to set the URL, repo name, and more. You should also set up 771s a signing key (a temporary one might have been automatically generated). 771s 771s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 771s and https://f-droid.org/docs/Signing_Process 771s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 771s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 771s + cp -a /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/stats /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/ 771s + echo 'binary_transparency_remote: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.1mvg' 771s + /usr/bin/fdroid update --verbose 771s 2024-03-07 20:04:58,213 DEBUG: Reading 'config.yml' 771s 2024-03-07 20:04:58,225 DEBUG: ipfs_cid not found, skipping CIDv1 generation 771s 2024-03-07 20:04:58,226 DEBUG: Using androguard from "/usr/lib/python3/dist-packages/androguard/__init__.py" 771s 2024-03-07 20:04:58,226 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 771s 2024-03-07 20:04:58,296 DEBUG: Processing com.example.test.helloworld_1.apk 771s 2024-03-07 20:04:58,355 INFO: Starting analysis on AndroidManifest.xml 771s 2024-03-07 20:04:58,364 INFO: APK file was successfully validated! 771s 2024-03-07 20:04:58,368 DEBUG: Getting signature of com.example.test.helloworld_1.apk 771s 2024-03-07 20:04:58,695 DEBUG: repo/com.example.test.helloworld_1.apk: Verifies 771s Verified using v1 scheme (JAR signing): true 771s Verified using v2 scheme (APK Signature Scheme v2): false 771s Verified using v3 scheme (APK Signature Scheme v3): false 771s Verified using v4 scheme (APK Signature Scheme v4): false 771s Verified for SourceStamp: false 771s Number of signers: 1 771s 771s 2024-03-07 20:04:58,696 DEBUG: Processing com.politedroid_3.apk 771s 2024-03-07 20:04:58,696 INFO: Starting analysis on AndroidManifest.xml 771s 2024-03-07 20:04:58,697 INFO: APK file was successfully validated! 771s 2024-03-07 20:04:58,699 DEBUG: Getting signature of com.politedroid_3.apk 772s 2024-03-07 20:04:59,026 DEBUG: repo/com.politedroid_3.apk: Verifies 772s Verified using v1 scheme (JAR signing): true 772s Verified using v2 scheme (APK Signature Scheme v2): false 772s Verified using v3 scheme (APK Signature Scheme v3): false 772s Verified using v4 scheme (APK Signature Scheme v4): false 772s Verified for SourceStamp: false 772s Number of signers: 1 772s 772s 2024-03-07 20:04:59,030 DEBUG: Processing com.politedroid_4.apk 772s 2024-03-07 20:04:59,031 INFO: Starting analysis on AndroidManifest.xml 772s 2024-03-07 20:04:59,032 INFO: APK file was successfully validated! 772s 2024-03-07 20:04:59,033 DEBUG: Getting signature of com.politedroid_4.apk 772s 2024-03-07 20:04:59,365 DEBUG: repo/com.politedroid_4.apk: Verifies 772s Verified using v1 scheme (JAR signing): true 772s Verified using v2 scheme (APK Signature Scheme v2): false 772s Verified using v3 scheme (APK Signature Scheme v3): false 772s Verified using v4 scheme (APK Signature Scheme v4): false 772s Verified for SourceStamp: false 772s Number of signers: 1 772s 772s 2024-03-07 20:04:59,367 DEBUG: Processing com.politedroid_5.apk 772s 2024-03-07 20:04:59,367 INFO: Starting analysis on AndroidManifest.xml 772s 2024-03-07 20:04:59,368 INFO: APK file was successfully validated! 772s 2024-03-07 20:04:59,370 DEBUG: Getting signature of com.politedroid_5.apk 772s 2024-03-07 20:04:59,704 DEBUG: repo/com.politedroid_5.apk: Verifies 772s Verified using v1 scheme (JAR signing): true 772s Verified using v2 scheme (APK Signature Scheme v2): false 772s Verified using v3 scheme (APK Signature Scheme v3): false 772s Verified using v4 scheme (APK Signature Scheme v4): false 772s Verified for SourceStamp: false 772s Number of signers: 1 772s 772s 2024-03-07 20:04:59,706 DEBUG: Processing com.politedroid_6.apk 772s 2024-03-07 20:04:59,706 INFO: Starting analysis on AndroidManifest.xml 772s 2024-03-07 20:04:59,707 INFO: APK file was successfully validated! 772s 2024-03-07 20:04:59,710 DEBUG: Getting signature of com.politedroid_6.apk 773s 2024-03-07 20:05:00,054 DEBUG: repo/com.politedroid_6.apk: Verifies 773s Verified using v1 scheme (JAR signing): true 773s Verified using v2 scheme (APK Signature Scheme v2): false 773s Verified using v3 scheme (APK Signature Scheme v3): false 773s Verified using v4 scheme (APK Signature Scheme v4): false 773s Verified for SourceStamp: false 773s Number of signers: 1 773s 773s 2024-03-07 20:05:00,056 DEBUG: Processing duplicate.permisssions_9999999.apk 773s 2024-03-07 20:05:00,057 INFO: Starting analysis on AndroidManifest.xml 773s 2024-03-07 20:05:00,058 INFO: APK file was successfully validated! 773s 2024-03-07 20:05:00,061 DEBUG: Getting signature of duplicate.permisssions_9999999.apk 773s 2024-03-07 20:05:00,067 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 773s 2024-03-07 20:05:00,406 DEBUG: repo/duplicate.permisssions_9999999.apk: Verifies 773s Verified using v1 scheme (JAR signing): true 773s Verified using v2 scheme (APK Signature Scheme v2): true 773s Verified using v3 scheme (APK Signature Scheme v3): false 773s Verified using v4 scheme (APK Signature Scheme v4): false 773s Verified for SourceStamp: false 773s Number of signers: 1 773s 773s 2024-03-07 20:05:00,407 DEBUG: Density 120 not available, resizing down from 160 773s 2024-03-07 20:05:00,409 DEBUG: Processing info.zwanenburg.caffeinetile_4.apk 773s 2024-03-07 20:05:00,409 INFO: Starting analysis on AndroidManifest.xml 773s 2024-03-07 20:05:00,410 INFO: APK file was successfully validated! 773s 2024-03-07 20:05:00,412 DEBUG: Getting signature of info.zwanenburg.caffeinetile_4.apk 773s 2024-03-07 20:05:00,744 DEBUG: repo/info.zwanenburg.caffeinetile_4.apk: Verifies 773s Verified using v1 scheme (JAR signing): true 773s Verified using v2 scheme (APK Signature Scheme v2): false 773s Verified using v3 scheme (APK Signature Scheme v3): false 773s Verified using v4 scheme (APK Signature Scheme v4): false 773s Verified for SourceStamp: false 773s Number of signers: 1 773s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 773s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 773s 773s 2024-03-07 20:05:00,745 DEBUG: Processing no.min.target.sdk_987.apk 773s 2024-03-07 20:05:00,745 INFO: Starting analysis on AndroidManifest.xml 773s 2024-03-07 20:05:00,746 INFO: APK file was successfully validated! 773s 2024-03-07 20:05:00,748 DEBUG: Getting signature of no.min.target.sdk_987.apk 773s 2024-03-07 20:05:00,756 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 774s 2024-03-07 20:05:01,110 DEBUG: repo/no.min.target.sdk_987.apk: Verifies 774s Verified using v1 scheme (JAR signing): true 774s Verified using v2 scheme (APK Signature Scheme v2): true 774s Verified using v3 scheme (APK Signature Scheme v3): false 774s Verified using v4 scheme (APK Signature Scheme v4): false 774s Verified for SourceStamp: false 774s Number of signers: 1 774s 774s 2024-03-07 20:05:01,111 DEBUG: Density 120 not available, resizing down from 160 774s 2024-03-07 20:05:01,113 DEBUG: Processing obb.main.oldversion_1444412523.apk 774s 2024-03-07 20:05:01,113 INFO: Starting analysis on AndroidManifest.xml 774s 2024-03-07 20:05:01,115 INFO: APK file was successfully validated! 774s 2024-03-07 20:05:01,116 DEBUG: Getting signature of obb.main.oldversion_1444412523.apk 774s 2024-03-07 20:05:01,479 DEBUG: repo/obb.main.oldversion_1444412523.apk: Verifies 774s Verified using v1 scheme (JAR signing): true 774s Verified using v2 scheme (APK Signature Scheme v2): true 774s Verified using v3 scheme (APK Signature Scheme v3): false 774s Verified using v4 scheme (APK Signature Scheme v4): false 774s Verified for SourceStamp: false 774s Number of signers: 1 774s 774s 2024-03-07 20:05:01,480 DEBUG: Density 120 not available, resizing down from 160 774s 2024-03-07 20:05:01,481 DEBUG: Processing obb.main.twoversions_1101613.apk 774s 2024-03-07 20:05:01,481 INFO: Starting analysis on AndroidManifest.xml 774s 2024-03-07 20:05:01,483 INFO: APK file was successfully validated! 774s 2024-03-07 20:05:01,484 DEBUG: Getting signature of obb.main.twoversions_1101613.apk 774s 2024-03-07 20:05:01,819 DEBUG: repo/obb.main.twoversions_1101613.apk: Verifies 774s Verified using v1 scheme (JAR signing): true 774s Verified using v2 scheme (APK Signature Scheme v2): false 774s Verified using v3 scheme (APK Signature Scheme v3): false 774s Verified using v4 scheme (APK Signature Scheme v4): false 774s Verified for SourceStamp: false 774s Number of signers: 1 774s 774s 2024-03-07 20:05:01,820 DEBUG: Density 120 not available, resizing down from 160 774s 2024-03-07 20:05:01,822 DEBUG: Processing obb.main.twoversions_1101615.apk 774s 2024-03-07 20:05:01,822 INFO: Starting analysis on AndroidManifest.xml 774s 2024-03-07 20:05:01,823 INFO: APK file was successfully validated! 774s 2024-03-07 20:05:01,825 DEBUG: Getting signature of obb.main.twoversions_1101615.apk 775s 2024-03-07 20:05:02,161 DEBUG: repo/obb.main.twoversions_1101615.apk: Verifies 775s Verified using v1 scheme (JAR signing): true 775s Verified using v2 scheme (APK Signature Scheme v2): false 775s Verified using v3 scheme (APK Signature Scheme v3): false 775s Verified using v4 scheme (APK Signature Scheme v4): false 775s Verified for SourceStamp: false 775s Number of signers: 1 775s 775s 2024-03-07 20:05:02,162 DEBUG: Density 120 not available, resizing down from 160 775s 2024-03-07 20:05:02,164 DEBUG: Processing obb.main.twoversions_1101617.apk 775s 2024-03-07 20:05:02,164 INFO: Starting analysis on AndroidManifest.xml 775s 2024-03-07 20:05:02,165 INFO: APK file was successfully validated! 775s 2024-03-07 20:05:02,167 DEBUG: Getting signature of obb.main.twoversions_1101617.apk 775s 2024-03-07 20:05:02,499 DEBUG: repo/obb.main.twoversions_1101617.apk: Verifies 775s Verified using v1 scheme (JAR signing): true 775s Verified using v2 scheme (APK Signature Scheme v2): false 775s Verified using v3 scheme (APK Signature Scheme v3): false 775s Verified using v4 scheme (APK Signature Scheme v4): false 775s Verified for SourceStamp: false 775s Number of signers: 1 775s 775s 2024-03-07 20:05:02,500 DEBUG: Density 120 not available, resizing down from 160 775s 2024-03-07 20:05:02,501 DEBUG: Processing obb.mainpatch.current_1619.apk 775s 2024-03-07 20:05:02,501 INFO: Starting analysis on AndroidManifest.xml 775s 2024-03-07 20:05:02,503 INFO: APK file was successfully validated! 775s 2024-03-07 20:05:02,504 DEBUG: Getting signature of obb.mainpatch.current_1619.apk 777s 2024-03-07 20:05:02,838 DEBUG: repo/obb.mainpatch.current_1619.apk: Verifies 777s Verified using v1 scheme (JAR signing): true 777s Verified using v2 scheme (APK Signature Scheme v2): false 777s Verified using v3 scheme (APK Signature Scheme v3): false 777s Verified using v4 scheme (APK Signature Scheme v4): false 777s Verified for SourceStamp: false 777s Number of signers: 1 777s 777s 2024-03-07 20:05:02,839 DEBUG: Density 120 not available, resizing down from 160 777s 2024-03-07 20:05:02,840 DEBUG: Processing obb.mainpatch.current_1619_another-release-key.apk 777s 2024-03-07 20:05:02,841 INFO: Starting analysis on AndroidManifest.xml 777s 2024-03-07 20:05:02,842 INFO: APK file was successfully validated! 777s 2024-03-07 20:05:02,844 DEBUG: Getting signature of obb.mainpatch.current_1619_another-release-key.apk 777s 2024-03-07 20:05:03,175 DEBUG: repo/obb.mainpatch.current_1619_another-release-key.apk: Verifies 777s Verified using v1 scheme (JAR signing): true 777s Verified using v2 scheme (APK Signature Scheme v2): false 777s Verified using v3 scheme (APK Signature Scheme v3): false 777s Verified using v4 scheme (APK Signature Scheme v4): false 777s Verified for SourceStamp: false 777s Number of signers: 1 777s 777s 2024-03-07 20:05:03,175 DEBUG: Density 120 not available, resizing down from 160 777s 2024-03-07 20:05:03,177 DEBUG: Processing souch.smsbypass_9.apk 777s 2024-03-07 20:05:03,177 INFO: Starting analysis on AndroidManifest.xml 777s 2024-03-07 20:05:03,179 INFO: APK file was successfully validated! 777s 2024-03-07 20:05:03,182 DEBUG: Getting signature of souch.smsbypass_9.apk 777s 2024-03-07 20:05:03,547 DEBUG: repo/souch.smsbypass_9.apk: Verifies 777s Verified using v1 scheme (JAR signing): true 777s Verified using v2 scheme (APK Signature Scheme v2): false 777s Verified using v3 scheme (APK Signature Scheme v3): false 777s Verified using v4 scheme (APK Signature Scheme v4): false 777s Verified for SourceStamp: false 777s Number of signers: 1 777s WARNING: META-INF/buildserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 777s WARNING: META-INF/fdroidserverid not protected by signature. Unauthorized modifications to this JAR entry will not be detected. Delete or move the entry outside of META-INF/. 777s 777s 2024-03-07 20:05:03,548 DEBUG: Density 120 not available, resizing down from 160 777s 2024-03-07 20:05:03,550 DEBUG: Processing urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 777s 2024-03-07 20:05:03,550 INFO: Starting analysis on AndroidManifest.xml 777s 2024-03-07 20:05:03,552 INFO: APK file was successfully validated! 777s 2024-03-07 20:05:03,553 DEBUG: Getting signature of urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 777s 2024-03-07 20:05:03,889 DEBUG: repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk: Verifies 777s Verified using v1 scheme (JAR signing): true 777s Verified using v2 scheme (APK Signature Scheme v2): false 777s Verified using v3 scheme (APK Signature Scheme v3): false 777s Verified using v4 scheme (APK Signature Scheme v4): false 777s Verified for SourceStamp: false 777s Number of signers: 1 777s 777s 2024-03-07 20:05:03,890 DEBUG: Density 120 not available, resizing down from 160 777s 2024-03-07 20:05:03,891 DEBUG: Processing v1.v2.sig_1020.apk 777s 2024-03-07 20:05:03,891 INFO: Starting analysis on AndroidManifest.xml 777s 2024-03-07 20:05:03,893 INFO: APK file was successfully validated! 777s 2024-03-07 20:05:03,894 DEBUG: Getting signature of v1.v2.sig_1020.apk 777s 2024-03-07 20:05:04,261 DEBUG: repo/v1.v2.sig_1020.apk: Verifies 777s Verified using v1 scheme (JAR signing): true 777s Verified using v2 scheme (APK Signature Scheme v2): true 777s Verified using v3 scheme (APK Signature Scheme v3): false 777s Verified using v4 scheme (APK Signature Scheme v4): false 777s Verified for SourceStamp: false 777s Number of signers: 1 777s 777s 2024-03-07 20:05:04,262 DEBUG: Density 120 not available, resizing down from 160 777s 2024-03-07 20:05:04,264 DEBUG: Processing fake.ota.update_1234.zip 777s 2024-03-07 20:05:04,264 DEBUG: skipping source tarball: repo/obb.main.twoversions_1101617_src.tar.gz 777s 2024-03-07 20:05:04,264 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 777s Use `fdroid update -c` to create it. 777s 2024-03-07 20:05:04,264 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 777s Use `fdroid update -c` to create it. 777s 2024-03-07 20:05:04,266 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 777s 2024-03-07 20:05:04,266 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 777s 2024-03-07 20:05:04,267 DEBUG: info.guardianproject.checkey does not have app metadata, skipping l18n scan. 777s 2024-03-07 20:05:04,267 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/icon.png repo/info.guardianproject.urzip/en-US 777s 2024-03-07 20:05:04,267 DEBUG: copying metadata/info.guardianproject.urzip/en-US/images/featureGraphic.png repo/info.guardianproject.urzip/en-US 777s 2024-03-07 20:05:04,348 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 777s 2024-03-07 20:05:04,348 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 777s 2024-03-07 20:05:04,348 DEBUG: org.smssecure.smssecure does not have app metadata, skipping l18n scan. 777s 2024-03-07 20:05:04,349 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 777s 2024-03-07 20:05:04,349 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 777s 2024-03-07 20:05:04,350 DEBUG: adding to phoneScreenshots: repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 777s 2024-03-07 20:05:04,351 DEBUG: adding to sevenInchScreenshots: repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 777s 2024-03-07 20:05:04,351 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,351 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,352 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,353 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,354 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,354 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,354 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,354 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,354 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 777s 2024-03-07 20:05:04,355 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 777s 777s Warning: 777s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 778s 2024-03-07 20:05:05,064 INFO: Creating signed index with this key (SHA256): 778s 2024-03-07 20:05:05,064 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 778s 2024-03-07 20:05:05,064 DEBUG: Directory: repo 778s 2024-03-07 20:05:05,064 DEBUG: > jar cf index.jar index.xml 778s 2024-03-07 20:05:05,267 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 779s jar signed. 779s 779s Warning: 779s The signer's certificate is self-signed. 779s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 779s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 779s 2024-03-07 20:05:06,273 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 779s 2024-03-07 20:05:06,280 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 779s 2024-03-07 20:05:06,281 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 779s 2024-03-07 20:05:06,283 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 780s jar signed. 780s 780s Warning: 780s The signer's certificate is self-signed. 780s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 780s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 780s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 780s 2024-03-07 20:05:07,396 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 780s 2024-03-07 20:05:07,397 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 780s 2024-03-07 20:05:07,401 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 781s 2024-03-07 20:05:08,005 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 781s 781s Warning: 781s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks -deststoretype pkcs12". 781s 2024-03-07 20:05:08,724 INFO: Committing indexes to binary_transparency 781s 2024-03-07 20:05:08,724 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/binary_transparency, universal_newlines=False, shell=None, istream=None) 781s 2024-03-07 20:05:08,731 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/binary_transparency, universal_newlines=False, shell=None, istream=) 781s 2024-03-07 20:05:08,734 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/binary_transparency, universal_newlines=False, shell=None, istream=) 781s 2024-03-07 20:05:08,757 DEBUG: Outputting JSON 781s 2024-03-07 20:05:08,757 DEBUG: skip deploying full build logs: not enabled in config 781s 2024-03-07 20:05:08,758 DEBUG: skip deploying full build logs: not enabled in config 781s 2024-03-07 20:05:08,758 DEBUG: skip deploying full build logs: not enabled in config 781s 2024-03-07 20:05:08,759 INFO: Finished 781s + /usr/bin/fdroid deploy --verbose 782s 2024-03-07 20:05:09,217 DEBUG: Reading 'config.yml' 782s 2024-03-07 20:05:09,228 DEBUG: ipfs_cid not found, skipping CIDv1 generation 782s 2024-03-07 20:05:09,228 INFO: Pushing binary transparency log to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.1mvg 782s 2024-03-07 20:05:09,228 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.1mvg, universal_newlines=False, shell=None, istream=None) 782s 2024-03-07 20:05:09,234 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/binary_transparency'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.1mvg, universal_newlines=False, shell=None, istream=None) 782s 2024-03-07 20:05:09,236 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.1mvg, universal_newlines=True, shell=None, istream=None) 782s 2024-03-07 20:05:09,260 DEBUG: Fetch head lines do not match lines provided via progress information 782s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 782s Will ignore extra progress lines or fetch head lines. 782s 2024-03-07 20:05:09,261 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' * [new branch] master -> local/master']" 782s 2024-03-07 20:05:09,261 DEBUG: b'head info: ["78897afa7cbaa696f2eed35ac20bfab01f189799\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hUbK/binary_transparency\\n"]' 782s 2024-03-07 20:05:09,261 DEBUG: skip deploying full build logs: not enabled in config 782s 2024-03-07 20:05:09,261 DEBUG: skip deploying full build logs: not enabled in config 782s 2024-03-07 20:05:09,262 DEBUG: skip deploying full build logs: not enabled in config 782s + test -e repo/index.xml 782s + test -e repo/index.jar 782s + test -e repo/index-v1.jar 782s + grep -F ' /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 784s 784s Warning: 784s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -deststoretype pkcs12". 784s 2024-03-07 20:05:11,253 INFO: Creating signed index with this key (SHA256): 784s 2024-03-07 20:05:11,253 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 784s 2024-03-07 20:05:11,253 DEBUG: Directory: repo 784s 2024-03-07 20:05:11,253 DEBUG: > jar cf index.jar index.xml 784s 2024-03-07 20:05:11,455 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index.jar sova -keypass:env FDROID_KEY_PASS 785s jar signed. 785s 785s Warning: 785s The signer's certificate is self-signed. 785s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 785s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 785s 2024-03-07 20:05:12,461 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 785s 2024-03-07 20:05:12,468 DEBUG: > /usr/lib/jvm/default-java/bin/jarsigner -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -storepass:env FDROID_KEY_STORE_PASS -digestalg SHA1 -sigalg SHA1withRSA repo/index-v1.jar sova -keypass:env FDROID_KEY_PASS 786s jar signed. 786s 786s Warning: 786s The signer's certificate is self-signed. 786s The SHA1 algorithm specified for the -digestalg option is considered a security risk and is disabled. 786s The SHA1withRSA algorithm specified for the -sigalg option is considered a security risk and is disabled. 786s POSIX file permission and/or symlink attributes detected. These attributes are ignored when signing and are not protected by the signature. 786s 2024-03-07 20:05:13,476 DEBUG: > /usr/bin/apksigner sign --min-sdk-version 23 --max-sdk-version 24 --v1-signing-enabled true --v2-signing-enabled false --v3-signing-enabled false --v4-signing-enabled false --ks /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks --ks-pass env:FDROID_KEY_STORE_PASS --ks-key-alias sova --key-pass env:FDROID_KEY_PASS repo/entry.jar 787s 2024-03-07 20:05:14,082 DEBUG: > /usr/lib/jvm/default-java/bin/keytool -exportcert -alias sova -keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -storepass:env FDROID_KEY_STORE_PASS 787s 787s Warning: 787s The JKS keystore uses a proprietary format. It is recommended to migrate to PKCS12 which is an industry standard format using "keytool -importkeystore -srckeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -destkeystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hCyl/keystore.jks -deststoretype pkcs12". 787s 2024-03-07 20:05:14,800 DEBUG: Outputting JSON 787s 2024-03-07 20:05:14,800 DEBUG: skip deploying full build logs: not enabled in config 787s 2024-03-07 20:05:14,801 DEBUG: skip deploying full build logs: not enabled in config 787s 2024-03-07 20:05:14,801 DEBUG: skip deploying full build logs: not enabled in config 787s 2024-03-07 20:05:14,801 INFO: Finished 787s + /usr/bin/fdroid readmeta 788s + test -e repo/index.xml 788s + test -e repo/index.jar 788s + test -e repo/index-v1.jar 788s + test -e tmp/apkcache.json 788s + test -z tmp/apkcache.json 788s + grep -F ' 801s hint: 801s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 801s hint: 'development'. The just-created branch can be renamed via this command: 801s hint: 801s hint: git branch -m 801s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git config receive.denyCurrentBranch updateInstead 801s ++ create_test_dir 801s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 801s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 801s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5 801s + GIT_MIRROR=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror 801s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5 801s + fdroid_init_with_prebuilt_keystore 801s + '[' -z '' ']' 801s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 801s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 801s 2024-03-07 20:05:28,837 WARNING: 801s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 801s Now set these in config.yml: keystorepass, keypass, keydname 801s 801s 2024-03-07 20:05:28,837 INFO: 801s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5" with this config: 801s 801s Android SDK: /usr/lib/android-sdk 801s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 801s Alias for key in store: sova 801s 801s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/repo" 801s then run "fdroid update -c; fdroid update". You might also want to edit 801s "config.yml" to set the URL, repo name, and more. You should also set up 801s a signing key (a temporary one might have been automatically generated). 801s 801s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 801s and https://f-droid.org/docs/Signing_Process 801s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 801s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 801s + printf '\narchive_older: 3\n' 801s + echo 'servergitmirrors: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf' 801s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_3.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_4.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_5.apk repo/ 801s + /usr/bin/fdroid update --create-metadata 802s 2024-03-07 20:05:29,265 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 802s 2024-03-07 20:05:29,351 INFO: Starting analysis on AndroidManifest.xml 802s 2024-03-07 20:05:29,360 INFO: APK file was successfully validated! 802s 2024-03-07 20:05:29,702 INFO: Starting analysis on AndroidManifest.xml 802s 2024-03-07 20:05:29,702 INFO: APK file was successfully validated! 803s 2024-03-07 20:05:30,051 INFO: Starting analysis on AndroidManifest.xml 803s 2024-03-07 20:05:30,052 INFO: APK file was successfully validated! 803s 2024-03-07 20:05:30,390 INFO: Generated skeleton metadata for com.politedroid 804s 2024-03-07 20:05:30,999 INFO: Creating signed index with this key (SHA256): 804s 2024-03-07 20:05:31,000 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 805s 2024-03-07 20:05:32,308 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 808s 2024-03-07 20:05:35,149 INFO: Creating signed index with this key (SHA256): 808s 2024-03-07 20:05:35,149 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 809s 2024-03-07 20:05:36,467 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 811s 2024-03-07 20:05:38,812 INFO: Finished 811s + /usr/bin/fdroid deploy 812s 2024-03-07 20:05:39,341 INFO: Mirroring to: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf 812s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/repo/com.politedroid_3.apk 812s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/repo/com.politedroid_4.apk 812s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/repo/com.politedroid_5.apk 812s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/repo/com.politedroid_3.apk 812s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/repo/com.politedroid_4.apk 812s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/repo/com.politedroid_5.apk 812s + date 812s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk repo/ 812s + /usr/bin/fdroid update 812s 2024-03-07 20:05:39,832 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 812s 2024-03-07 20:05:39,921 INFO: Starting analysis on AndroidManifest.xml 812s 2024-03-07 20:05:39,930 INFO: APK file was successfully validated! 813s 2024-03-07 20:05:40,281 INFO: Moving com.politedroid_3.apk from repo to archive 813s 2024-03-07 20:05:40,888 INFO: Creating signed index with this key (SHA256): 813s 2024-03-07 20:05:40,888 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 815s 2024-03-07 20:05:42,096 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 817s 2024-03-07 20:05:44,941 INFO: Creating signed index with this key (SHA256): 817s 2024-03-07 20:05:44,941 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 819s 2024-03-07 20:05:46,149 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 821s 2024-03-07 20:05:48,496 INFO: Finished 821s + /usr/bin/fdroid deploy 822s 2024-03-07 20:05:49,010 INFO: Mirroring to: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/archive/com.politedroid_3.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/archive/com.politedroid_3.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/archive/com.politedroid_3.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/repo/com.politedroid_4.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/repo/com.politedroid_5.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/fdroid/repo/com.politedroid_6.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/repo/com.politedroid_4.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/repo/com.politedroid_5.apk 822s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/repo/com.politedroid_6.apk 822s ++ du -s --bytes /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/.git/ 822s ++ awk '{print $1}' 822s + before=133108 822s + echo 'git_mirror_size_limit: 60kb' 822s + /usr/bin/fdroid update 822s 2024-03-07 20:05:49,474 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 823s 2024-03-07 20:05:50,084 INFO: Creating signed index with this key (SHA256): 823s 2024-03-07 20:05:50,084 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 824s 2024-03-07 20:05:51,295 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 827s 2024-03-07 20:05:54,140 INFO: Creating signed index with this key (SHA256): 827s 2024-03-07 20:05:54,141 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 828s 2024-03-07 20:05:55,449 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 830s 2024-03-07 20:05:57,688 INFO: Finished 830s + /usr/bin/fdroid deploy 831s 2024-03-07 20:05:58,112 WARNING: Deleting git-mirror history, repo is too big (133108 max 60000) 831s 2024-03-07 20:05:58,170 INFO: Mirroring to: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf 831s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/archive/com.politedroid_3.apk 831s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf/fdroid/archive/com.politedroid_3.apk 831s ++ du -s --bytes /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/.git/ 831s ++ awk '{print $1}' 831s + after=101402 831s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror/.git/test-stamp 831s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git -C /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.qFp5/git-mirror gc 831s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git -C /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.hSXf gc 831s ============================================================================== 831s sign binary repo in offline box, then publishing from online box 831s + test 133108 -gt 101402 831s + echo_header 'sign binary repo in offline box, then publishing from online box' 831s ++ create_test_dir 831s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 831s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 831s + OFFLINE_ROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn 831s + KEYSTORE=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.p12 831s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency/.git/ 831s ++ create_test_dir 831s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 831s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 831s + LOCAL_COPY_DIR=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid 831s + mkdir /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid 831s ++ create_test_dir 831s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 831s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 831s + ONLINE_ROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi 831s ++ create_test_dir 831s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 831s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 831s + SERVERWEBROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.Lq4I/fdroid 831s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn 831s + mkdir binary_transparency 831s + cd binary_transparency 831s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 831s hint: Using 'master' as the name for the initial branch. This default branch name 831s hint: is subject to change. To configure the initial branch name to use in all 831s hint: of your new repositories, which will suppress this warning, call: 831s hint: 831s hint: git config --global init.defaultBranch 831s hint: 831s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 831s hint: 'development'. The just-created branch can be renamed via this command: 831s hint: 831s hint: git branch -m 831s ++ create_test_dir 831s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 831s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 831s + BINARY_TRANSPARENCY_REMOTE=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egfh 831s ++ create_test_dir 831s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 831s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 831s + SERVER_GIT_MIRROR=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd 831s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd 831s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 831s hint: Using 'master' as the name for the initial branch. This default branch name 831s hint: is subject to change. To configure the initial branch name to use in all 831s hint: of your new repositories, which will suppress this warning, call: 831s hint: 831s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd/.git/ 831s hint: git config --global init.defaultBranch 831s hint: 831s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 831s hint: 'development'. The just-created branch can be renamed via this command: 831s hint: 831s hint: git branch -m 831s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git config receive.denyCurrentBranch updateInstead 831s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn 831s + fdroid_init_with_prebuilt_keystore 831s + '[' -z '' ']' 831s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 831s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 831s 2024-03-07 20:05:58,743 WARNING: 831s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 831s Now set these in config.yml: keystorepass, keypass, keydname 831s 831s 2024-03-07 20:05:58,743 INFO: 831s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn" with this config: 831s 831s Android SDK: /usr/lib/android-sdk 831s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 831s Alias for key in store: sova 831s 831s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/repo" 831s then run "fdroid update -c; fdroid update". You might also want to edit 831s "config.yml" to set the URL, repo name, and more. You should also set up 831s a signing key (a temporary one might have been automatically generated). 831s 831s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 831s and https://f-droid.org/docs/Signing_Process 831s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 831s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 831s + printf '\narchive_older: 3\n' 831s + cp -a /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/stats /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/ 831s + mkdir /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/unsigned 831s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/urzip-release-unsigned.apk /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/unsigned 831s + echo 'mirrors: ['\''http://foo.bar/fdroid'\'', '\''http://asdflkdsfjafdsdfhkjh.onion/fdroid'\'']' 831s + echo 'servergitmirrors: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd' 831s + echo 'local_copy_dir: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid' 831s + /usr/bin/fdroid update --pretty 832s 2024-03-07 20:05:59,182 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 832s 2024-03-07 20:05:59,315 INFO: Starting analysis on AndroidManifest.xml 832s 2024-03-07 20:05:59,324 INFO: APK file was successfully validated! 832s 2024-03-07 20:05:59,654 INFO: Starting analysis on AndroidManifest.xml 832s 2024-03-07 20:05:59,655 INFO: APK file was successfully validated! 833s 2024-03-07 20:05:59,985 INFO: Starting analysis on AndroidManifest.xml 833s 2024-03-07 20:05:59,986 INFO: APK file was successfully validated! 833s 2024-03-07 20:06:00,316 INFO: Starting analysis on AndroidManifest.xml 833s 2024-03-07 20:06:00,317 INFO: APK file was successfully validated! 833s 2024-03-07 20:06:00,652 INFO: Starting analysis on AndroidManifest.xml 833s 2024-03-07 20:06:00,653 INFO: APK file was successfully validated! 834s 2024-03-07 20:06:00,988 INFO: Starting analysis on AndroidManifest.xml 834s 2024-03-07 20:06:00,990 INFO: APK file was successfully validated! 834s 2024-03-07 20:06:00,998 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 834s 2024-03-07 20:06:01,337 INFO: Starting analysis on AndroidManifest.xml 834s 2024-03-07 20:06:01,338 INFO: APK file was successfully validated! 834s 2024-03-07 20:06:01,668 INFO: Starting analysis on AndroidManifest.xml 834s 2024-03-07 20:06:01,670 INFO: APK file was successfully validated! 834s 2024-03-07 20:06:01,679 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 835s 2024-03-07 20:06:02,046 INFO: Starting analysis on AndroidManifest.xml 835s 2024-03-07 20:06:02,048 INFO: APK file was successfully validated! 835s 2024-03-07 20:06:02,420 INFO: Starting analysis on AndroidManifest.xml 835s 2024-03-07 20:06:02,421 INFO: APK file was successfully validated! 835s 2024-03-07 20:06:02,754 INFO: Starting analysis on AndroidManifest.xml 835s 2024-03-07 20:06:02,756 INFO: APK file was successfully validated! 836s 2024-03-07 20:06:03,085 INFO: Starting analysis on AndroidManifest.xml 836s 2024-03-07 20:06:03,086 INFO: APK file was successfully validated! 836s 2024-03-07 20:06:03,422 INFO: Starting analysis on AndroidManifest.xml 836s 2024-03-07 20:06:03,423 INFO: APK file was successfully validated! 836s 2024-03-07 20:06:03,763 INFO: Starting analysis on AndroidManifest.xml 836s 2024-03-07 20:06:03,764 INFO: APK file was successfully validated! 837s 2024-03-07 20:06:04,082 INFO: Starting analysis on AndroidManifest.xml 837s 2024-03-07 20:06:04,083 INFO: APK file was successfully validated! 837s 2024-03-07 20:06:04,458 INFO: Starting analysis on AndroidManifest.xml 837s 2024-03-07 20:06:04,459 INFO: APK file was successfully validated! 837s 2024-03-07 20:06:04,788 INFO: Starting analysis on AndroidManifest.xml 837s 2024-03-07 20:06:04,789 INFO: APK file was successfully validated! 838s 2024-03-07 20:06:05,163 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 838s Use `fdroid update -c` to create it. 838s 2024-03-07 20:06:05,163 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 838s Use `fdroid update -c` to create it. 838s 2024-03-07 20:06:05,772 INFO: Creating signed index with this key (SHA256): 838s 2024-03-07 20:06:05,772 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 840s 2024-03-07 20:06:07,082 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 842s 2024-03-07 20:06:09,410 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 842s 2024-03-07 20:06:09,410 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 842s 2024-03-07 20:06:09,412 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,412 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 842s 2024-03-07 20:06:09,413 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 843s 2024-03-07 20:06:10,026 INFO: Creating signed index with this key (SHA256): 843s 2024-03-07 20:06:10,026 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 844s 2024-03-07 20:06:11,336 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 844s 2024-03-07 20:06:11,343 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 844s 2024-03-07 20:06:11,343 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 845s 2024-03-07 20:06:12,454 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 845s 2024-03-07 20:06:12,455 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 846s 2024-03-07 20:06:13,686 INFO: Committing indexes to binary_transparency 846s 2024-03-07 20:06:13,722 INFO: Finished 846s + grep -F '' repo/index.xml 846s + grep -F '/fdroid/archive' archive/index.xml 846s http://foo.bar/fdroid/archive 846s http://asdflkdsfjafdsdfhkjh.onion/fdroid/archive 846s ++ grep '' repo/index.xml 846s ++ wc -l 846s + test 2 -eq 2 846s ++ grep '' archive/index.xml 846s ++ wc -l 846s + test 2 -eq 2 846s + cd binary_transparency 846s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD 846s + '[' 1 == 1 ']' 846s + cd .. 846s + /usr/bin/fdroid deploy --verbose 847s 2024-03-07 20:06:14,182 DEBUG: Reading 'config.yml' 847s 2024-03-07 20:06:14,192 DEBUG: ipfs_cid not found, skipping CIDv1 generation 847s 2024-03-07 20:06:14,193 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/ 847s sending incremental file list 847s repo/ 847s repo/categories.txt 847s repo/com.example.test.helloworld_1.apk 847s repo/com.politedroid_3.apk 847s repo/com.politedroid_4.apk 847s repo/com.politedroid_5.apk 847s repo/com.politedroid_6.apk 847s repo/duplicate.permisssions_9999999.apk 847s repo/entry.jar 847s repo/entry.json 847s repo/fake.ota.update_1234.zip 847s repo/index-v1.jar 847s repo/index-v1.json 847s repo/index-v2.json 847s repo/index.css 847s repo/index.html 847s repo/index.jar 847s repo/index.png 847s repo/index.xml 847s repo/info.zwanenburg.caffeinetile_4.apk 847s repo/main.1101613.obb.main.twoversions.obb 847s repo/main.1101615.obb.main.twoversions.obb 847s repo/main.1434483388.obb.main.oldversion.obb 847s repo/main.1619.obb.mainpatch.current.obb 847s repo/no.min.target.sdk_987.apk 847s repo/obb.main.oldversion_1444412523.apk 847s repo/obb.main.twoversions_1101613.apk 847s repo/obb.main.twoversions_1101615.apk 847s repo/obb.main.twoversions_1101617.apk 847s repo/obb.main.twoversions_1101617_src.tar.gz 847s repo/obb.mainpatch.current_1619.apk 847s repo/obb.mainpatch.current_1619_another-release-key.apk 847s repo/patch.1619.obb.mainpatch.current.obb 847s repo/souch.smsbypass_9.apk 847s repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 847s repo/v1.v2.sig_1020.apk 847s repo/icons-120/ 847s repo/icons-120/com.politedroid.3.png 847s repo/icons-120/com.politedroid.4.png 847s repo/icons-120/com.politedroid.5.png 847s repo/icons-120/com.politedroid.6.png 847s repo/icons-120/duplicate.permisssions.9999999.png 847s repo/icons-120/info.guardianproject.urzip.100.png 847s repo/icons-120/no.min.target.sdk.987.png 847s repo/icons-120/obb.main.oldversion.1444412523.png 847s repo/icons-120/obb.main.twoversions.1101613.png 847s repo/icons-120/obb.main.twoversions.1101615.png 847s repo/icons-120/obb.main.twoversions.1101617.png 847s repo/icons-120/obb.mainpatch.current.1619.png 847s repo/icons-120/souch.smsbypass.9.png 847s repo/icons-120/v1.v2.sig.1020.png 847s repo/icons-160/ 847s repo/icons-160/com.politedroid.3.png 847s repo/icons-160/com.politedroid.4.png 847s repo/icons-160/com.politedroid.5.png 847s repo/icons-160/com.politedroid.6.png 847s repo/icons-160/duplicate.permisssions.9999999.png 847s repo/icons-160/info.guardianproject.urzip.100.png 847s repo/icons-160/no.min.target.sdk.987.png 847s repo/icons-160/obb.main.oldversion.1444412523.png 847s repo/icons-160/obb.main.twoversions.1101613.png 847s repo/icons-160/obb.main.twoversions.1101615.png 847s repo/icons-160/obb.main.twoversions.1101617.png 847s repo/icons-160/obb.mainpatch.current.1619.png 847s repo/icons-160/souch.smsbypass.9.png 847s repo/icons-160/v1.v2.sig.1020.png 847s repo/icons-240/ 847s repo/icons-240/com.politedroid.3.png 847s repo/icons-240/com.politedroid.4.png 847s repo/icons-240/com.politedroid.5.png 847s repo/icons-240/com.politedroid.6.png 847s repo/icons-240/duplicate.permisssions.9999999.png 847s repo/icons-240/info.guardianproject.urzip.100.png 847s repo/icons-240/no.min.target.sdk.987.png 847s repo/icons-240/obb.main.oldversion.1444412523.png 847s repo/icons-240/obb.main.twoversions.1101613.png 847s repo/icons-240/obb.main.twoversions.1101615.png 847s repo/icons-240/obb.main.twoversions.1101617.png 847s repo/icons-240/obb.mainpatch.current.1619.png 847s repo/icons-240/souch.smsbypass.9.png 847s repo/icons-240/v1.v2.sig.1020.png 847s repo/icons-320/ 847s repo/icons-320/com.politedroid.3.png 847s repo/icons-320/com.politedroid.4.png 847s repo/icons-320/com.politedroid.5.png 847s repo/icons-320/com.politedroid.6.png 847s repo/icons-320/duplicate.permisssions.9999999.png 847s repo/icons-320/info.guardianproject.urzip.100.png 847s repo/icons-320/no.min.target.sdk.987.png 847s repo/icons-320/obb.main.oldversion.1444412523.png 847s repo/icons-320/obb.main.twoversions.1101613.png 847s repo/icons-320/obb.main.twoversions.1101615.png 847s repo/icons-320/obb.main.twoversions.1101617.png 847s repo/icons-320/obb.mainpatch.current.1619.png 847s repo/icons-320/souch.smsbypass.9.png 847s repo/icons-320/v1.v2.sig.1020.png 847s repo/icons-480/ 847s repo/icons-480/com.politedroid.3.png 847s repo/icons-480/com.politedroid.4.png 847s repo/icons-480/com.politedroid.5.png 847s repo/icons-480/com.politedroid.6.png 847s repo/icons-480/duplicate.permisssions.9999999.png 847s repo/icons-480/info.guardianproject.urzip.100.png 847s repo/icons-480/no.min.target.sdk.987.png 847s repo/icons-480/obb.main.oldversion.1444412523.png 847s repo/icons-480/obb.main.twoversions.1101613.png 847s repo/icons-480/obb.main.twoversions.1101615.png 847s repo/icons-480/obb.main.twoversions.1101617.png 847s repo/icons-480/obb.mainpatch.current.1619.png 847s repo/icons-480/souch.smsbypass.9.png 847s repo/icons-480/v1.v2.sig.1020.png 847s repo/icons-640/ 847s repo/icons-640/com.politedroid.3.png 847s repo/icons-640/com.politedroid.4.png 847s repo/icons-640/com.politedroid.5.png 847s repo/icons-640/com.politedroid.6.png 847s repo/icons-640/duplicate.permisssions.9999999.png 847s repo/icons-640/info.guardianproject.urzip.100.png 847s repo/icons-640/no.min.target.sdk.987.png 847s repo/icons-640/obb.main.oldversion.1444412523.png 847s repo/icons-640/obb.main.twoversions.1101613.png 847s repo/icons-640/obb.main.twoversions.1101615.png 847s repo/icons-640/obb.main.twoversions.1101617.png 847s repo/icons-640/obb.mainpatch.current.1619.png 847s repo/icons-640/souch.smsbypass.9.png 847s repo/icons-640/v1.v2.sig.1020.png 847s repo/icons/ 847s repo/icons/com.politedroid.3.png 847s repo/icons/com.politedroid.4.png 847s repo/icons/com.politedroid.5.png 847s repo/icons/com.politedroid.6.png 847s repo/icons/duplicate.permisssions.9999999.png 847s repo/icons/icon.png 847s repo/icons/info.guardianproject.urzip.100.png 847s repo/icons/no.min.target.sdk.987.png 847s repo/icons/obb.main.oldversion.1444412523.png 847s repo/icons/obb.main.twoversions.1101613.png 847s repo/icons/obb.main.twoversions.1101615.png 847s repo/icons/obb.main.twoversions.1101617.png 847s repo/icons/obb.mainpatch.current.1619.png 847s repo/icons/souch.smsbypass.9.png 847s repo/icons/v1.v2.sig.1020.png 847s repo/info.guardianproject.checkey/ 847s repo/info.guardianproject.checkey/en-US/ 847s repo/info.guardianproject.checkey/en-US/phoneScreenshots/ 847s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png 847s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png 847s 2024-03-07 20:06:14,240 INFO: Pushing binary transparency log to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency 847s 2024-03-07 20:06:14,240 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 847s 2024-03-07 20:06:14,246 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 847s 2024-03-07 20:06:14,248 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None) 847s repo/info.guardianproject.urzip/ 847s repo/info.guardianproject.urzip/en-US/ 847s repo/info.guardianproject.urzip/en-US/featureGraphic.png 847s repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png 847s repo/info.guardianproject.urzip/en-US/icon.png 847s repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png 847s repo/obb.mainpatch.current/ 847s repo/obb.mainpatch.current/en-US/ 847s repo/obb.mainpatch.current/en-US/featureGraphic.png 847s repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png 847s repo/obb.mainpatch.current/en-US/icon.png 847s repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png 847s repo/obb.mainpatch.current/en-US/phoneScreenshots/ 847s repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 847s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/ 847s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 847s repo/org.videolan.vlc/ 847s repo/org.videolan.vlc/en-US/ 847s repo/org.videolan.vlc/en-US/icon.png 847s repo/org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/ 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/ 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png 847s repo/status/ 847s repo/status/running.json 847s repo/status/update.json 847s 847s sent 3,727,912 bytes received 3,462 bytes 7,462,748.00 bytes/sec 847s total size is 3,709,727 speedup is 0.99 847s 2024-03-07 20:06:14,276 DEBUG: Fetch head lines do not match lines provided via progress information 847s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 847s Will ignore extra progress lines or fetch head lines. 847s 2024-03-07 20:06:14,276 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' * [new branch] master -> local/master']" 847s 2024-03-07 20:06:14,276 DEBUG: b'head info: ["8b959b4c27203ddfed854d760b8c81665e47540f\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency\\n"]' 847s 2024-03-07 20:06:14,282 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy` 847s 2024-03-07 20:06:14,282 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose archive /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/ 847s sending incremental file list 847s archive/ 847s archive/entry.jar 847s archive/entry.json 847s archive/index-v1.jar 847s archive/index-v1.json 847s archive/index-v2.json 847s archive/index.css 847s archive/index.html 847s archive/index.jar 847s archive/index.png 847s archive/index.xml 847s archive/icons-120/ 847s archive/icons-160/ 847s archive/icons-240/ 847s archive/icons-320/ 847s archive/icons-480/ 847s archive/icons-640/ 847s archive/icons/ 847s archive/icons/icon.png 847s 847s 2024-03-07 20:06:14,330 INFO: Pushing binary transparency log to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency 847s 2024-03-07 20:06:14,331 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 847s sent 25,332 bytes received 261 bytes 51,186.00 bytes/sec 847s total size is 24,126 speedup is 0.94 847s 2024-03-07 20:06:14,333 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None) 847s 2024-03-07 20:06:14,343 DEBUG: Fetch head lines do not match lines provided via progress information 847s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 847s Will ignore extra progress lines or fetch head lines. 847s 2024-03-07 20:06:14,343 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' = [up to date] master -> local/master']" 847s 2024-03-07 20:06:14,344 DEBUG: b'head info: ["8b959b4c27203ddfed854d760b8c81665e47540f\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency\\n"]' 847s 2024-03-07 20:06:14,344 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy` 847s 2024-03-07 20:06:14,344 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose unsigned /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/ 847s sending incremental file list 847s unsigned/ 847s unsigned/urzip-release-unsigned.apk 847s 847s sent 8,635 bytes received 39 bytes 17,348.00 bytes/sec 847s total size is 8,471 speedup is 0.98 847s 2024-03-07 20:06:14,390 INFO: Pushing binary transparency log to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency 847s 2024-03-07 20:06:14,392 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=False, shell=None, istream=None) 847s 2024-03-07 20:06:14,394 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency, universal_newlines=True, shell=None, istream=None) 847s 2024-03-07 20:06:14,404 DEBUG: Fetch head lines do not match lines provided via progress information 847s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 847s Will ignore extra progress lines or fetch head lines. 847s 2024-03-07 20:06:14,404 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' = [up to date] master -> local/master']" 847s 2024-03-07 20:06:14,405 DEBUG: b'head info: ["8b959b4c27203ddfed854d760b8c81665e47540f\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.kFvn/binary_transparency\\n"]' 847s 2024-03-07 20:06:14,405 DEBUG: Offline machine, skipping git mirror generation until `fdroid deploy` 847s 2024-03-07 20:06:14,405 DEBUG: skip deploying full build logs: not enabled in config 847s 2024-03-07 20:06:14,406 DEBUG: skip deploying full build logs: not enabled in config 847s 2024-03-07 20:06:14,406 DEBUG: skip deploying full build logs: not enabled in config 847s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/unsigned/urzip-release-unsigned.apk 847s + grep -F ' FETCH_HEAD', ' * [new branch] master -> local/master']" 847s 2024-03-07 20:06:14,905 DEBUG: b'head info: ["8b959b4c27203ddfed854d760b8c81665e47540f\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency\\n"]' 847s 2024-03-07 20:06:14,905 INFO: rsyncing repo to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.Lq4I/fdroid/ 847s building file list ... done 847s created directory /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.Lq4I/fdroid 847s repo/ 847s repo/categories.txt 847s repo/com.example.test.helloworld_1.apk 847s repo/com.politedroid_3.apk 847s repo/com.politedroid_4.apk 847s repo/com.politedroid_5.apk 847s repo/com.politedroid_6.apk 847s repo/duplicate.permisssions_9999999.apk 847s repo/fake.ota.update_1234.zip 847s repo/index.css 847s repo/index.html 847s repo/index.png 847s repo/info.zwanenburg.caffeinetile_4.apk 847s repo/main.1101613.obb.main.twoversions.obb 847s repo/main.1101615.obb.main.twoversions.obb 847s repo/main.1434483388.obb.main.oldversion.obb 847s repo/main.1619.obb.mainpatch.current.obb 847s repo/no.min.target.sdk_987.apk 847s repo/obb.main.oldversion_1444412523.apk 847s repo/obb.main.twoversions_1101613.apk 847s repo/obb.main.twoversions_1101615.apk 847s repo/obb.main.twoversions_1101617.apk 847s repo/obb.main.twoversions_1101617_src.tar.gz 847s repo/obb.mainpatch.current_1619.apk 847s repo/obb.mainpatch.current_1619_another-release-key.apk 847s repo/patch.1619.obb.mainpatch.current.obb 847s repo/souch.smsbypass_9.apk 847s repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 847s repo/v1.v2.sig_1020.apk 847s repo/icons-120/ 847s repo/icons-120/com.politedroid.3.png 847s repo/icons-120/com.politedroid.4.png 847s repo/icons-120/com.politedroid.5.png 847s repo/icons-120/com.politedroid.6.png 847s repo/icons-120/duplicate.permisssions.9999999.png 847s repo/icons-120/info.guardianproject.urzip.100.png 847s repo/icons-120/no.min.target.sdk.987.png 847s repo/icons-120/obb.main.oldversion.1444412523.png 847s repo/icons-120/obb.main.twoversions.1101613.png 847s repo/icons-120/obb.main.twoversions.1101615.png 847s repo/icons-120/obb.main.twoversions.1101617.png 847s repo/icons-120/obb.mainpatch.current.1619.png 847s repo/icons-120/souch.smsbypass.9.png 847s repo/icons-120/v1.v2.sig.1020.png 847s repo/icons-160/ 847s repo/icons-160/com.politedroid.3.png 847s repo/icons-160/com.politedroid.4.png 847s repo/icons-160/com.politedroid.5.png 847s repo/icons-160/com.politedroid.6.png 847s repo/icons-160/duplicate.permisssions.9999999.png 847s repo/icons-160/info.guardianproject.urzip.100.png 847s repo/icons-160/no.min.target.sdk.987.png 847s repo/icons-160/obb.main.oldversion.1444412523.png 847s repo/icons-160/obb.main.twoversions.1101613.png 847s repo/icons-160/obb.main.twoversions.1101615.png 847s repo/icons-160/obb.main.twoversions.1101617.png 847s repo/icons-160/obb.mainpatch.current.1619.png 847s repo/icons-160/souch.smsbypass.9.png 847s repo/icons-160/v1.v2.sig.1020.png 847s repo/icons-240/ 847s repo/icons-240/com.politedroid.3.png 847s repo/icons-240/com.politedroid.4.png 847s repo/icons-240/com.politedroid.5.png 847s repo/icons-240/com.politedroid.6.png 847s repo/icons-240/duplicate.permisssions.9999999.png 847s repo/icons-240/info.guardianproject.urzip.100.png 847s repo/icons-240/no.min.target.sdk.987.png 847s repo/icons-240/obb.main.oldversion.1444412523.png 847s repo/icons-240/obb.main.twoversions.1101613.png 847s repo/icons-240/obb.main.twoversions.1101615.png 847s repo/icons-240/obb.main.twoversions.1101617.png 847s repo/icons-240/obb.mainpatch.current.1619.png 847s repo/icons-240/souch.smsbypass.9.png 847s repo/icons-240/v1.v2.sig.1020.png 847s repo/icons-320/ 847s repo/icons-320/com.politedroid.3.png 847s repo/icons-320/com.politedroid.4.png 847s repo/icons-320/com.politedroid.5.png 847s repo/icons-320/com.politedroid.6.png 847s repo/icons-320/duplicate.permisssions.9999999.png 847s repo/icons-320/info.guardianproject.urzip.100.png 847s repo/icons-320/no.min.target.sdk.987.png 847s repo/icons-320/obb.main.oldversion.1444412523.png 847s repo/icons-320/obb.main.twoversions.1101613.png 847s repo/icons-320/obb.main.twoversions.1101615.png 847s repo/icons-320/obb.main.twoversions.1101617.png 847s repo/icons-320/obb.mainpatch.current.1619.png 847s repo/icons-320/souch.smsbypass.9.png 847s repo/icons-320/v1.v2.sig.1020.png 847s repo/icons-480/ 847s repo/icons-480/com.politedroid.3.png 847s repo/icons-480/com.politedroid.4.png 847s repo/icons-480/com.politedroid.5.png 847s repo/icons-480/com.politedroid.6.png 847s repo/icons-480/duplicate.permisssions.9999999.png 847s repo/icons-480/info.guardianproject.urzip.100.png 847s repo/icons-480/no.min.target.sdk.987.png 847s repo/icons-480/obb.main.oldversion.1444412523.png 847s repo/icons-480/obb.main.twoversions.1101613.png 847s repo/icons-480/obb.main.twoversions.1101615.png 847s repo/icons-480/obb.main.twoversions.1101617.png 847s repo/icons-480/obb.mainpatch.current.1619.png 847s repo/icons-480/souch.smsbypass.9.png 847s repo/icons-480/v1.v2.sig.1020.png 847s repo/icons-640/ 847s repo/icons-640/com.politedroid.3.png 847s repo/icons-640/com.politedroid.4.png 847s repo/icons-640/com.politedroid.5.png 847s repo/icons-640/com.politedroid.6.png 847s repo/icons-640/duplicate.permisssions.9999999.png 847s repo/icons-640/info.guardianproject.urzip.100.png 847s repo/icons-640/no.min.target.sdk.987.png 847s repo/icons-640/obb.main.oldversion.1444412523.png 847s repo/icons-640/obb.main.twoversions.1101613.png 847s repo/icons-640/obb.main.twoversions.1101615.png 847s repo/icons-640/obb.main.twoversions.1101617.png 847s repo/icons-640/obb.mainpatch.current.1619.png 847s repo/icons-640/souch.smsbypass.9.png 847s repo/icons-640/v1.v2.sig.1020.png 847s repo/icons/ 847s repo/icons/com.politedroid.3.png 847s repo/icons/com.politedroid.4.png 847s repo/icons/com.politedroid.5.png 847s repo/icons/com.politedroid.6.png 847s repo/icons/duplicate.permisssions.9999999.png 847s repo/icons/icon.png 847s repo/icons/info.guardianproject.urzip.100.png 847s repo/icons/no.min.target.sdk.987.png 847s repo/icons/obb.main.oldversion.1444412523.png 847s repo/icons/obb.main.twoversions.1101613.png 847s repo/icons/obb.main.twoversions.1101615.png 847s repo/icons/obb.main.twoversions.1101617.png 847s repo/icons/obb.mainpatch.current.1619.png 847s repo/icons/souch.smsbypass.9.png 847s repo/icons/v1.v2.sig.1020.png 847s repo/info.guardianproject.checkey/ 847s repo/info.guardianproject.checkey/en-US/ 847s repo/info.guardianproject.checkey/en-US/phoneScreenshots/ 847s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png 847s repo/info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png 847s repo/info.guardianproject.urzip/ 847s repo/info.guardianproject.urzip/en-US/ 847s repo/info.guardianproject.urzip/en-US/featureGraphic.png 847s repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png 847s repo/info.guardianproject.urzip/en-US/icon.png 847s repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png 847s repo/obb.mainpatch.current/ 847s repo/obb.mainpatch.current/en-US/ 847s repo/obb.mainpatch.current/en-US/featureGraphic.png 847s repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png 847s repo/obb.mainpatch.current/en-US/icon.png 847s repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png 847s repo/obb.mainpatch.current/en-US/phoneScreenshots/ 847s repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 847s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/ 847s repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 847s repo/org.videolan.vlc/ 847s repo/org.videolan.vlc/en-US/ 847s repo/org.videolan.vlc/en-US/icon.png 847s repo/org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/ 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png 847s repo/org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/ 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png 847s repo/org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png 847s repo/status/ 847s repo/status/running.json 847s repo/status/update.json 847s 847s sent 3,629,113 bytes received 3,347 bytes 7,264,920.00 bytes/sec 847s total size is 3,611,566 speedup is 0.99 848s building file list ... done 848s repo/entry.jar 848s repo/entry.json 848s repo/index-v1.jar 848s repo/index-v1.json 848s repo/index-v2.json 848s repo/index.jar 848s repo/index.xml 848s 848s sent 108,384 bytes received 144 bytes 217,056.00 bytes/sec 848s total size is 3,709,727 speedup is 34.18 848s 2024-03-07 20:06:14,990 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose repo/ git-mirror/fdroid/repo/ 848s sending incremental file list 848s ./ 848s categories.txt 848s com.example.test.helloworld_1.apk 848s com.politedroid_3.apk 848s com.politedroid_4.apk 848s com.politedroid_5.apk 848s com.politedroid_6.apk 848s duplicate.permisssions_9999999.apk 848s entry.jar 848s entry.json 848s fake.ota.update_1234.zip 848s index-v1.jar 848s index-v1.json 848s index-v2.json 848s index.css 848s index.html 848s index.jar 848s index.png 848s index.xml 848s info.zwanenburg.caffeinetile_4.apk 848s main.1101613.obb.main.twoversions.obb 848s main.1101615.obb.main.twoversions.obb 848s main.1434483388.obb.main.oldversion.obb 848s main.1619.obb.mainpatch.current.obb 848s no.min.target.sdk_987.apk 848s obb.main.oldversion_1444412523.apk 848s obb.main.twoversions_1101613.apk 848s obb.main.twoversions_1101615.apk 848s obb.main.twoversions_1101617.apk 848s obb.main.twoversions_1101617_src.tar.gz 848s obb.mainpatch.current_1619.apk 848s obb.mainpatch.current_1619_another-release-key.apk 848s patch.1619.obb.mainpatch.current.obb 848s souch.smsbypass_9.apk 848s urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk 848s v1.v2.sig_1020.apk 848s icons-120/ 848s icons-120/com.politedroid.3.png 848s icons-120/com.politedroid.4.png 848s icons-120/com.politedroid.5.png 848s icons-120/com.politedroid.6.png 848s icons-120/duplicate.permisssions.9999999.png 848s icons-120/info.guardianproject.urzip.100.png 848s icons-120/no.min.target.sdk.987.png 848s icons-120/obb.main.oldversion.1444412523.png 848s icons-120/obb.main.twoversions.1101613.png 848s icons-120/obb.main.twoversions.1101615.png 848s icons-120/obb.main.twoversions.1101617.png 848s icons-120/obb.mainpatch.current.1619.png 848s icons-120/souch.smsbypass.9.png 848s icons-120/v1.v2.sig.1020.png 848s icons-160/ 848s icons-160/com.politedroid.3.png 848s icons-160/com.politedroid.4.png 848s icons-160/com.politedroid.5.png 848s icons-160/com.politedroid.6.png 848s icons-160/duplicate.permisssions.9999999.png 848s icons-160/info.guardianproject.urzip.100.png 848s icons-160/no.min.target.sdk.987.png 848s icons-160/obb.main.oldversion.1444412523.png 848s icons-160/obb.main.twoversions.1101613.png 848s icons-160/obb.main.twoversions.1101615.png 848s icons-160/obb.main.twoversions.1101617.png 848s icons-160/obb.mainpatch.current.1619.png 848s icons-160/souch.smsbypass.9.png 848s icons-160/v1.v2.sig.1020.png 848s icons-240/ 848s icons-240/com.politedroid.3.png 848s icons-240/com.politedroid.4.png 848s icons-240/com.politedroid.5.png 848s icons-240/com.politedroid.6.png 848s icons-240/duplicate.permisssions.9999999.png 848s icons-240/info.guardianproject.urzip.100.png 848s icons-240/no.min.target.sdk.987.png 848s icons-240/obb.main.oldversion.1444412523.png 848s icons-240/obb.main.twoversions.1101613.png 848s icons-240/obb.main.twoversions.1101615.png 848s icons-240/obb.main.twoversions.1101617.png 848s icons-240/obb.mainpatch.current.1619.png 848s icons-240/souch.smsbypass.9.png 848s icons-240/v1.v2.sig.1020.png 848s icons-320/ 848s icons-320/com.politedroid.3.png 848s icons-320/com.politedroid.4.png 848s icons-320/com.politedroid.5.png 848s icons-320/com.politedroid.6.png 848s icons-320/duplicate.permisssions.9999999.png 848s icons-320/info.guardianproject.urzip.100.png 848s icons-320/no.min.target.sdk.987.png 848s icons-320/obb.main.oldversion.1444412523.png 848s icons-320/obb.main.twoversions.1101613.png 848s icons-320/obb.main.twoversions.1101615.png 848s icons-320/obb.main.twoversions.1101617.png 848s icons-320/obb.mainpatch.current.1619.png 848s icons-320/souch.smsbypass.9.png 848s icons-320/v1.v2.sig.1020.png 848s icons-480/ 848s icons-480/com.politedroid.3.png 848s icons-480/com.politedroid.4.png 848s icons-480/com.politedroid.5.png 848s icons-480/com.politedroid.6.png 848s icons-480/duplicate.permisssions.9999999.png 848s icons-480/info.guardianproject.urzip.100.png 848s icons-480/no.min.target.sdk.987.png 848s icons-480/obb.main.oldversion.1444412523.png 848s icons-480/obb.main.twoversions.1101613.png 848s icons-480/obb.main.twoversions.1101615.png 848s icons-480/obb.main.twoversions.1101617.png 848s icons-480/obb.mainpatch.current.1619.png 848s icons-480/souch.smsbypass.9.png 848s icons-480/v1.v2.sig.1020.png 848s icons-640/ 848s icons-640/com.politedroid.3.png 848s icons-640/com.politedroid.4.png 848s icons-640/com.politedroid.5.png 848s icons-640/com.politedroid.6.png 848s icons-640/duplicate.permisssions.9999999.png 848s icons-640/info.guardianproject.urzip.100.png 848s icons-640/no.min.target.sdk.987.png 848s icons-640/obb.main.oldversion.1444412523.png 848s icons-640/obb.main.twoversions.1101613.png 848s icons-640/obb.main.twoversions.1101615.png 848s icons-640/obb.main.twoversions.1101617.png 848s icons-640/obb.mainpatch.current.1619.png 848s icons-640/souch.smsbypass.9.png 848s icons-640/v1.v2.sig.1020.png 848s icons/ 848s icons/com.politedroid.3.png 848s icons/com.politedroid.4.png 848s icons/com.politedroid.5.png 848s icons/com.politedroid.6.png 848s icons/duplicate.permisssions.9999999.png 848s icons/icon.png 848s icons/info.guardianproject.urzip.100.png 848s icons/no.min.target.sdk.987.png 848s icons/obb.main.oldversion.1444412523.png 848s icons/obb.main.twoversions.1101613.png 848s icons/obb.main.twoversions.1101615.png 848s icons/obb.main.twoversions.1101617.png 848s icons/obb.mainpatch.current.1619.png 848s icons/souch.smsbypass.9.png 848s icons/v1.v2.sig.1020.png 848s info.guardianproject.checkey/ 848s info.guardianproject.checkey/en-US/ 848s info.guardianproject.checkey/en-US/phoneScreenshots/ 848s info.guardianproject.checkey/en-US/phoneScreenshots/checkey-phone.png 848s info.guardianproject.checkey/en-US/phoneScreenshots/checkey.png 848s info.guardianproject.urzip/ 848s info.guardianproject.urzip/en-US/ 848s info.guardianproject.urzip/en-US/featureGraphic.png 848s info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png 848s info.guardianproject.urzip/en-US/icon.png 848s info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png 848s obb.mainpatch.current/ 848s obb.mainpatch.current/en-US/ 848s obb.mainpatch.current/en-US/featureGraphic.png 848s obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png 848s obb.mainpatch.current/en-US/icon.png 848s obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png 848s obb.mainpatch.current/en-US/phoneScreenshots/ 848s obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 848s obb.mainpatch.current/en-US/sevenInchScreenshots/ 848s obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 848s org.videolan.vlc/ 848s org.videolan.vlc/en-US/ 848s org.videolan.vlc/en-US/icon.png 848s org.videolan.vlc/en-US/icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png 848s org.videolan.vlc/en-US/phoneScreenshots/ 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot10.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot12.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot15.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot18.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot20.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot22.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot4.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot7.png 848s org.videolan.vlc/en-US/phoneScreenshots/screenshot9.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/ 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot0.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot1.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot11.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot13.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot14.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot16.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot17.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot19.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot2.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot21.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot23.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot3.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot5.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot6.png 848s org.videolan.vlc/en-US/sevenInchScreenshots/screenshot8.png 848s status/ 848s status/running.json 848s status/update.json 848s 848s sent 3,727,862 bytes received 3,461 bytes 2,487,548.67 bytes/sec 848s total size is 3,709,727 speedup is 0.99 848s 2024-03-07 20:06:15,057 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,061 DEBUG: Popen(['git', 'remote', 'add', '--', 'autopkgtest', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,063 INFO: Mirroring to: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd 848s 2024-03-07 20:06:15,064 DEBUG: Adding all files to git mirror 848s 2024-03-07 20:06:15,064 DEBUG: Popen(['git', 'add', '--all'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,182 DEBUG: Committing all files into git mirror 848s 2024-03-07 20:06:15,189 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=False, shell=None, istream=) 848s 2024-03-07 20:06:15,191 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=False, shell=None, istream=) 848s 2024-03-07 20:06:15,197 DEBUG: Pushing to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd 848s 2024-03-07 20:06:15,197 DEBUG: Popen(['git', 'version'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,198 DEBUG: Popen(['git', 'push', '--porcelain', '--force', '--set-upstream', '--progress', '--', 'autopkgtest', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/git-mirror, universal_newlines=True, shell=None, istream=None) 848s 2024-03-07 20:06:15,520 DEBUG: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd: [new branch] 848s 848s 2024-03-07 20:06:15,520 INFO: Syncing from local_copy_dir to this repo. 848s 2024-03-07 20:06:15,520 DEBUG: rsync --recursive --safe-links --times --perms --one-file-system --delete --chmod=Da+rx,Fa-x,a+r,u+w --checksum --verbose /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/unsigned/ unsigned/ 848s sending incremental file list 848s created directory unsigned 848s ./ 848s urzip-release-unsigned.apk 848s 848s sent 8,617 bytes received 69 bytes 17,372.00 bytes/sec 848s total size is 8,471 speedup is 0.98 848s 2024-03-07 20:06:15,566 INFO: Pushing binary transparency log to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/binary_transparency 848s building file list ... done 848s unsigned/ 848s unsigned/urzip-release-unsigned.apk 848s 2024-03-07 20:06:15,567 DEBUG: Popen(['git', 'remote', 'set-url', '--', 'local', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/binary_transparency, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,569 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/binary_transparency, universal_newlines=True, shell=None, istream=None) 848s 2024-03-07 20:06:15,579 DEBUG: Fetch head lines do not match lines provided via progress information 848s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 848s Will ignore extra progress lines or fetch head lines. 848s 2024-03-07 20:06:15,579 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' = [up to date] master -> local/master']" 848s 2024-03-07 20:06:15,579 DEBUG: b'head info: ["8b959b4c27203ddfed854d760b8c81665e47540f\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.eReB/fdroid/binary_transparency\\n"]' 848s 2024-03-07 20:06:15,579 INFO: rsyncing unsigned to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.Lq4I/fdroid/ 848s 848s sent 8,658 bytes received 37 bytes 17,390.00 bytes/sec 848s total size is 8,471 speedup is 0.97 848s building file list ... done 848s 848s sent 137 bytes received 11 bytes 296.00 bytes/sec 848s total size is 8,471 speedup is 57.24 848s 2024-03-07 20:06:15,632 INFO: Pushing binary transparency log to /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egfh 848s 2024-03-07 20:06:15,632 DEBUG: Popen(['git', 'init'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egfh, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,636 DEBUG: Popen(['git', 'remote', 'add', '--', 'local', '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/binary_transparency'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egfh, universal_newlines=False, shell=None, istream=None) 848s 2024-03-07 20:06:15,638 DEBUG: Popen(['git', 'pull', '-v', '--', 'local', 'master'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egfh, universal_newlines=True, shell=None, istream=None) 848s 2024-03-07 20:06:15,664 DEBUG: Fetch head lines do not match lines provided via progress information 848s length of progress lines 2 should be equal to lines in FETCH_HEAD file 1 848s Will ignore extra progress lines or fetch head lines. 848s 2024-03-07 20:06:15,665 DEBUG: b"info lines: [' * branch master -> FETCH_HEAD', ' * [new branch] master -> local/master']" 848s 2024-03-07 20:06:15,665 DEBUG: b'head info: ["8b959b4c27203ddfed854d760b8c81665e47540f\\t\\tbranch \'master\' of /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/binary_transparency\\n"]' 848s 2024-03-07 20:06:15,665 DEBUG: skip deploying full build logs: not enabled in config 848s 2024-03-07 20:06:15,666 DEBUG: skip deploying full build logs: not enabled in config 848s 2024-03-07 20:06:15,666 DEBUG: skip deploying full build logs: not enabled in config 848s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.yqfi/unsigned/urzip-release-unsigned.apk 848s + test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.Lq4I/fdroid/unsigned/urzip-release-unsigned.apk 848s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egfh 848s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD 848s + '[' 1 == 1 ']' 848s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.egRd 848s ++ env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git rev-list --count HEAD 848s + '[' 1 == 1 ']' 848s + echo_header 'test extracting and publishing with developer signature' 848s + use_apksigner 848s + python3 -c ' 848s import sys 848s sys.path.insert(0, '\''/tmp/autopkgtest.MqVFDp/build.8ZF/src'\'') 848s from fdroidserver import common 848s c = {'\''sdk_path'\'': '\''/usr/lib/android-sdk'\''} 848s common.find_apksigner(c) 848s exit(c.get('\''apksigner'\'') is None) 848s ' 848s ============================================================================== 848s test extracting and publishing with developer signature 849s ++ create_test_dir 849s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 849s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 849s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.2g7r 849s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.2g7r 849s + fdroid_init_with_prebuilt_keystore 849s + '[' -z '' ']' 849s + keystore=/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 849s + /usr/bin/fdroid init --keystore /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks --repo-keyalias=sova 849s 2024-03-07 20:06:16,452 WARNING: 849s Using existing keystore "/tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks" 849s Now set these in config.yml: keystorepass, keypass, keydname 849s 849s 2024-03-07 20:06:16,452 INFO: 849s Built repo based in "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.2g7r" with this config: 849s 849s Android SDK: /usr/lib/android-sdk 849s Keystore for signing key: /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/keystore.jks 849s Alias for key in store: sova 849s 849s To complete the setup, add your APKs to "/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.2g7r/repo" 849s then run "fdroid update -c; fdroid update". You might also want to edit 849s "config.yml" to set the URL, repo name, and more. You should also set up 849s a signing key (a temporary one might have been automatically generated). 849s 849s For more info: https://f-droid.org/docs/Setup_an_F-Droid_App_Repo 849s and https://f-droid.org/docs/Signing_Process 849s + echo 'keystorepass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 849s + echo 'keypass: r9aquRHYoI8+dYz6jKrLntQ5/NJNASFBacJh7Jv2BlI=' 849s + echo 'keydname: "CN=Birdman, OU=Cell, O=Alcatraz, L=Alcatraz, S=California, C=US"' 849s + test -d metadata 849s + mkdir metadata 849s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/metadata/com.politedroid.yml metadata/ 849s + test -d repo 849s + test -d unsigned 849s + mkdir unsigned 849s + cp /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests/repo/com.politedroid_6.apk unsigned/ 849s + /usr/bin/fdroid signatures unsigned/com.politedroid_6.apk 850s 2024-03-07 20:06:17,287 INFO: Fetched signatures for 'unsigned/com.politedroid_6.apk' -> 'metadata/com.politedroid/signatures/6' 850s + test -d metadata/com.politedroid/signatures/6 850s + test -f metadata/com.politedroid/signatures/6/MANIFEST.MF 850s + test -f metadata/com.politedroid/signatures/6/RELEASE.RSA 850s + test -f metadata/com.politedroid/signatures/6/RELEASE.SF 850s + test -f repo/com.politedroid_6.apk 850s + /usr/bin/fdroid publish 850s 2024-03-07 20:06:17,729 INFO: Creating log directory 850s 2024-03-07 20:06:17,732 INFO: 1 app, 1 key aliases 850s 2024-03-07 20:06:17,732 INFO: Processing unsigned/com.politedroid_6.apk 851s 2024-03-07 20:06:18,077 INFO: Key alias: 4e7da5b7 852s 2024-03-07 20:06:19,392 INFO: Published com.politedroid_6.apk 854s 2024-03-07 20:06:21,102 INFO: published list signing-key fingerprints 854s + test -f repo/com.politedroid_6.apk 854s + which apksigner 854s /usr/bin/apksigner 854s + apksigner verify repo/com.politedroid_6.apk 854s + which jarsigner 854s /usr/bin/jarsigner 854s + jarsigner -verify repo/com.politedroid_6.apk 855s 855s The jar will be treated as unsigned, because it is signed with a weak algorithm that is now disabled. 855s 855s Re-run jarsigner with the -verbose option for more details. 855s + echo_header 'test mirroring a repo' 855s + which wget 855s ++ create_test_dir 855s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 855s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 855s ============================================================================== 855s test mirroring a repo 855s /usr/bin/wget 855s + TESTROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.gH98 855s ++ create_test_dir 855s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 855s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 855s + REPOROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.YhF3 855s + cp -r /tmp/autopkgtest.MqVFDp/build.8ZF/src/tests /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.gH98 855s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.gH98/tests 855s + test -d archive 855s + mkdir archive 855s + cp repo/index-v1.json /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.YhF3/ 855s + /usr/bin/fdroid update 855s 2024-03-07 20:06:22,413 WARNING: config.py is deprecated, use config.yml 855s 2024-03-07 20:06:22,416 WARNING: repo_icon "repo/icons/icon.png" does not exist! Check "config.yml". 855s 2024-03-07 20:06:22,552 INFO: Starting analysis on AndroidManifest.xml 855s 2024-03-07 20:06:22,560 INFO: APK file was successfully validated! 855s 2024-03-07 20:06:22,936 INFO: Starting analysis on AndroidManifest.xml 855s 2024-03-07 20:06:22,937 INFO: APK file was successfully validated! 856s 2024-03-07 20:06:23,274 INFO: Starting analysis on AndroidManifest.xml 856s 2024-03-07 20:06:23,275 INFO: APK file was successfully validated! 856s 2024-03-07 20:06:23,625 INFO: Starting analysis on AndroidManifest.xml 856s 2024-03-07 20:06:23,626 INFO: APK file was successfully validated! 857s 2024-03-07 20:06:23,970 INFO: Starting analysis on AndroidManifest.xml 857s 2024-03-07 20:06:23,971 INFO: APK file was successfully validated! 857s 2024-03-07 20:06:24,319 INFO: Starting analysis on AndroidManifest.xml 857s 2024-03-07 20:06:24,320 INFO: APK file was successfully validated! 857s 2024-03-07 20:06:24,329 WARNING: repo/duplicate.permisssions_9999999.apk is set to android:debuggable="true" 857s 2024-03-07 20:06:24,688 INFO: Starting analysis on AndroidManifest.xml 857s 2024-03-07 20:06:24,689 INFO: APK file was successfully validated! 858s 2024-03-07 20:06:25,037 INFO: Starting analysis on AndroidManifest.xml 858s 2024-03-07 20:06:25,038 INFO: APK file was successfully validated! 858s 2024-03-07 20:06:25,049 WARNING: No minimum SDK version found in repo/no.min.target.sdk_987.apk, using default (3). 858s 2024-03-07 20:06:25,430 INFO: Starting analysis on AndroidManifest.xml 858s 2024-03-07 20:06:25,432 INFO: APK file was successfully validated! 858s 2024-03-07 20:06:25,807 INFO: Starting analysis on AndroidManifest.xml 858s 2024-03-07 20:06:25,808 INFO: APK file was successfully validated! 859s 2024-03-07 20:06:26,143 INFO: Starting analysis on AndroidManifest.xml 859s 2024-03-07 20:06:26,144 INFO: APK file was successfully validated! 859s 2024-03-07 20:06:26,493 INFO: Starting analysis on AndroidManifest.xml 859s 2024-03-07 20:06:26,494 INFO: APK file was successfully validated! 859s 2024-03-07 20:06:26,832 INFO: Starting analysis on AndroidManifest.xml 859s 2024-03-07 20:06:26,834 INFO: APK file was successfully validated! 860s 2024-03-07 20:06:27,174 INFO: Starting analysis on AndroidManifest.xml 860s 2024-03-07 20:06:27,175 INFO: APK file was successfully validated! 860s 2024-03-07 20:06:27,500 INFO: Starting analysis on AndroidManifest.xml 860s 2024-03-07 20:06:27,501 INFO: APK file was successfully validated! 860s 2024-03-07 20:06:27,868 INFO: Starting analysis on AndroidManifest.xml 860s 2024-03-07 20:06:27,870 INFO: APK file was successfully validated! 861s 2024-03-07 20:06:28,203 INFO: Starting analysis on AndroidManifest.xml 861s 2024-03-07 20:06:28,204 INFO: APK file was successfully validated! 861s 2024-03-07 20:06:28,567 WARNING: com.example.test.helloworld_1.apk (com.example.test.helloworld) has no metadata! 861s Use `fdroid update -c` to create it. 861s 2024-03-07 20:06:28,568 WARNING: v1.v2.sig_1020.apk (v1.v2.sig) has no metadata! 861s Use `fdroid update -c` to create it. 862s 2024-03-07 20:06:29,178 INFO: Creating signed index with this key (SHA256): 862s 2024-03-07 20:06:29,178 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 863s 2024-03-07 20:06:30,389 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 865s 2024-03-07 20:06:32,711 WARNING: Found "checkey-phone.png" graphic without metadata for app "info.guardianproject.checkey"! 865s 2024-03-07 20:06:32,712 WARNING: Found "checkey.png" graphic without metadata for app "info.guardianproject.checkey"! 865s 2024-03-07 20:06:32,713 WARNING: Found "icon.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,713 WARNING: Found "icon_yAfSvPRJukZzMMfUzvbYqwaD1XmHXNtiPBtuPVHW-6s=.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot10.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot12.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot15.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot18.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot20.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot22.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,714 WARNING: Found "screenshot4.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot7.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot9.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot0.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot1.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot11.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot13.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot14.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot16.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,715 WARNING: Found "screenshot17.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot19.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot2.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot21.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot23.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot3.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot5.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot6.png" graphic without metadata for app "org.videolan.vlc"! 865s 2024-03-07 20:06:32,716 WARNING: Found "screenshot8.png" graphic without metadata for app "org.videolan.vlc"! 866s 2024-03-07 20:06:33,326 INFO: Creating signed index with this key (SHA256): 866s 2024-03-07 20:06:33,326 INFO: F4 9A F3 F1 1E FD DF 20 DF FD 70 F5 E3 11 7B 99 76 67 41 67 AD CA 28 0E 6B 19 32 A0 60 1B 26 F6 867s 2024-03-07 20:06:34,538 WARNING: repo_icon "repo/icons/icon.png" does not exist, generating placeholder. 867s 2024-03-07 20:06:34,544 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 867s 2024-03-07 20:06:34,545 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 868s 2024-03-07 20:06:35,553 INFO: Ignoring package without metadata: com.example.test.helloworld_1.apk 868s 2024-03-07 20:06:35,554 INFO: Ignoring package without metadata: v1.v2.sig_1020.apk 869s 2024-03-07 20:06:36,781 INFO: Finished 869s + /usr/bin/fdroid signindex 870s 2024-03-07 20:06:37,229 WARNING: config.py is deprecated, use config.yml 871s 2024-03-07 20:06:38,240 INFO: Signed repo/index-v1.json 871s 2024-03-07 20:06:38,847 INFO: Signed repo/entry.json 872s 2024-03-07 20:06:39,853 INFO: Signed archive/index-v1.json 873s 2024-03-07 20:06:40,458 INFO: Signed archive/entry.json 873s + mv /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.YhF3/index-v1.json repo/index-v1.json 873s + port=32158 873s ++ printf 32158 873s ++ wc -m 873s + test 5 -le 3 873s + http_server_pid=23077 873s + timeout 5m python3 -m http.server 32158 --bind 127.0.0.1 873s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.YhF3 873s + http_proxy= 873s + HTTP_PROXY= 873s + /usr/bin/fdroid mirror http://127.0.0.1:32158/ 873s 2024-03-07 20:06:40,936 WARNING: http://127.0.0.1:32158/ does not end with "fdroid", check the URL path! 873s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/com.politedroid_6.apk [16578/16578] -> "com.politedroid_6.apk" [1] 873s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/com.politedroid_5.apk [18817/18817] -> "com.politedroid_5.apk" [1] 873s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/com.politedroid_4.apk [18489/18489] -> "com.politedroid_4.apk" [1] 873s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/com.politedroid_3.apk [17552/17552] -> "com.politedroid_3.apk" [1] 873s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/duplicate.permisssions_9999999.apk [27446/27446] -> "duplicate.permisssions_9999999.apk" [1] 873s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/fake.ota.update_1234.zip [233/233] -> "fake.ota.update_1234.zip" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/urzip-;%20%D0%A0%D0%B0%D1%85%D0%BC%D0%B0%CC%81,%20[r%C9%90x%CB%88man%CA%B2%C9%AAn%C9%99f]%20%D8%B3%D9%8A%D8%B1%D8%AC%D9%8A_%D8%B1%D8%AE%D9%85%D8%A7%D9%86%D9%8A%D9%86%D9%88%D9%81%20%E8%B0%A2%C2%B7.apk [11471/11471] -> "urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/info.zwanenburg.caffeinetile_4.apk [11740/11740] -> "info.zwanenburg.caffeinetile_4.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/no.min.target.sdk_987.apk [14102/14102] -> "no.min.target.sdk_987.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.main.oldversion_1444412523.apk [14323/14323] -> "obb.main.oldversion_1444412523.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.main.twoversions_1101617.apk [11481/11481] -> "obb.main.twoversions_1101617.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.main.twoversions_1101615.apk [11480/11480] -> "obb.main.twoversions_1101615.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.main.twoversions_1101613.apk [11477/11477] -> "obb.main.twoversions_1101613.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.mainpatch.current_1619.apk [11479/11479] -> "obb.mainpatch.current_1619.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.mainpatch.current_1619_another-release-key.apk [10541/10541] -> "obb.mainpatch.current_1619_another-release-key.apk" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/souch.smsbypass_9.apk [81295/81295] -> "souch.smsbypass_9.apk" [1] 874s FINISHED --2024-03-07 20:06:40-- 874s Total wall clock time: 0.01s 874s Downloaded: 16 files, 282K in 0.001s (391 MB/s) 874s http://127.0.0.1:32158/repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png [44990/44990] -> "screenshot-main.png" [1] 874s FINISHED --2024-03-07 20:06:40-- 874s Total wall clock time: 0.001s 874s Downloaded: 1 files, 44K in 0s (2.16 GB/s) 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png [56049/56049] -> "screenshot-tablet-main.png" [1] 874s FINISHED --2024-03-07 20:06:40-- 874s Total wall clock time: 0.001s 874s Downloaded: 1 files, 55K in 0s (2.25 GB/s) 874s http://127.0.0.1:32158/repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s 2024-03-07 20:06:40,976 ERROR: no "icon" in info.zwanenburg.caffeinetile 874s 2024-03-07 20:06:40,976 ERROR: no "icon" in fake.ota.update 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/souch.smsbypass.9.png [1558/1558] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/com.politedroid.6.png [559/559] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:40-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 9.9K in 0s (329 MB/s) 874s http://127.0.0.1:32158/repo/icons-65534/souch.smsbypass.9.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/duplicate.permisssions.9999999.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/no.min.target.sdk.987.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/obb.main.oldversion.1444412523.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/obb.main.twoversions.1101617.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/obb.mainpatch.current.1619.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/com.politedroid.6.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s http://127.0.0.1:32158/repo/icons-65534/info.guardianproject.urzip.100.png: 874s 2024-03-07 20:06:40 ERROR 404: File not found. 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/souch.smsbypass.9.png [5874/5874] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:40 URL:http://127.0.0.1:32158/repo/icons-640/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:40-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 15K in 0s (216 MB/s) 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/souch.smsbypass.9.png [5874/5874] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-480/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:41-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 15K in 0s (483 MB/s) 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/souch.smsbypass.9.png [3615/3615] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/com.politedroid.6.png [1586/1586] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-320/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:41-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 13K in 0s (388 MB/s) 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/souch.smsbypass.9.png [2264/2264] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/com.politedroid.6.png [910/910] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-240/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:41-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 11K in 0s (69.4 MB/s) 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/souch.smsbypass.9.png [1558/1558] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/com.politedroid.6.png [559/559] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-160/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:41-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 9.9K in 0s (73.4 MB/s) 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/souch.smsbypass.9.png [1335/1335] -> "souch.smsbypass.9.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/duplicate.permisssions.9999999.png [1301/1301] -> "duplicate.permisssions.9999999.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/no.min.target.sdk.987.png [1301/1301] -> "no.min.target.sdk.987.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/obb.main.oldversion.1444412523.png [1301/1301] -> "obb.main.oldversion.1444412523.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/obb.main.twoversions.1101617.png [1413/1413] -> "obb.main.twoversions.1101617.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/obb.mainpatch.current.1619.png [1301/1301] -> "obb.mainpatch.current.1619.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/com.politedroid.6.png [357/357] -> "com.politedroid.6.png" [1] 874s 2024-03-07 20:06:41 URL:http://127.0.0.1:32158/repo/icons-120/info.guardianproject.urzip.100.png [1413/1413] -> "info.guardianproject.urzip.100.png" [1] 874s FINISHED --2024-03-07 20:06:41-- 874s Total wall clock time: 0.006s 874s Downloaded: 8 files, 9.5K in 0s (70.2 MB/s) 874s + test -e 127.0.0.1:32158/repo/souch.smsbypass_9.apk 874s + test -e 127.0.0.1:32158/repo/icons-640/souch.smsbypass.9.png 874s + test -e 127.0.0.1:32158/repo/index-v1.jar 874s + http_proxy= 874s + HTTP_PROXY= 874s + /usr/bin/fdroid mirror 'http://127.0.0.1:32158/?fingerprint=asdfasdf' 874s 2024-03-07 20:06:41,455 WARNING: http://127.0.0.1:32158/?fingerprint=asdfasdf does not end with "fdroid", check the URL path! 875s 2024-03-07 20:06:42,105 CRITICAL: The repository's fingerprint does not match. 875s + test -e 127.0.0.1:32158/repo/index-v1.jar 875s + http_proxy= 875s + HTTP_PROXY= 875s + /usr/bin/fdroid mirror 'http://127.0.0.1:32158/?fingerprint=F49AF3F11EFDDF20DFFD70F5E3117B9976674167ADCA280E6B1932A0601B26F6' 875s 2024-03-07 20:06:42,521 WARNING: http://127.0.0.1:32158/?fingerprint=F49AF3F11EFDDF20DFFD70F5E3117B9976674167ADCA280E6B1932A0601B26F6 does not end with "fdroid", check the URL path! 876s 2024-03-07 20:06:43 URL:http://127.0.0.1:32158/repo/index-v1.jar [8360/8360] -> "index-v1.jar" [1] 876s FINISHED --2024-03-07 20:06:43-- 876s Total wall clock time: 0.002s 876s Downloaded: 1 files, 8.2K in 0s (1007 MB/s) 876s http://127.0.0.1:32158/repo/obb.mainpatch.current/en-US/featureGraphic_ffhLaojxbGAfu9ROe1MJgK5ux8d0OVc6b65nmvOBaTk=.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/obb.mainpatch.current/en-US/icon_WI0pkO3LsklrsTAnRr-OQSxkkoMY41lYe2-fAvXLiLg=.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/info.guardianproject.urzip/en-US/featureGraphic_GFRT5BovZsENGpJq1HqPODGWBRPWQsx25B95Ol5w_wU=.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/info.guardianproject.urzip/en-US/icon_NJXNzMcyf-v9i5a1ElJi0j9X1LvllibCa48xXYPlOqQ=.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s 2024-03-07 20:06:43,197 ERROR: no "icon" in info.zwanenburg.caffeinetile 876s 2024-03-07 20:06:43,197 ERROR: no "icon" in fake.ota.update 876s http://127.0.0.1:32158/repo/icons-65534/souch.smsbypass.9.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/duplicate.permisssions.9999999.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/no.min.target.sdk.987.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/obb.main.oldversion.1444412523.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/obb.main.twoversions.1101617.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/obb.mainpatch.current.1619.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/com.politedroid.6.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s http://127.0.0.1:32158/repo/icons-65534/info.guardianproject.urzip.100.png: 876s 2024-03-07 20:06:43 ERROR 404: File not found. 876s + test -e 127.0.0.1:32158/repo/index-v1.jar 876s + kill -9 23077 876s + rm -f 127.0.0.1:32158/repo/com.politedroid_3.apk 127.0.0.1:32158/repo/com.politedroid_4.apk 127.0.0.1:32158/repo/com.politedroid_5.apk 127.0.0.1:32158/repo/com.politedroid_6.apk 127.0.0.1:32158/repo/duplicate.permisssions_9999999.apk 127.0.0.1:32158/repo/info.zwanenburg.caffeinetile_4.apk 127.0.0.1:32158/repo/no.min.target.sdk_987.apk 127.0.0.1:32158/repo/obb.main.oldversion_1444412523.apk 127.0.0.1:32158/repo/obb.main.twoversions_1101613.apk 127.0.0.1:32158/repo/obb.main.twoversions_1101615.apk 127.0.0.1:32158/repo/obb.main.twoversions_1101617.apk 127.0.0.1:32158/repo/obb.mainpatch.current_1619.apk 127.0.0.1:32158/repo/obb.mainpatch.current_1619_another-release-key.apk 127.0.0.1:32158/repo/souch.smsbypass_9.apk '127.0.0.1:32158/repo/urzip-; Рахма́, [rɐxˈmanʲɪnəf] سيرجي_رخمانينوف 谢·.apk' 127.0.0.1:32158/repo/obb.mainpatch.current/en-US/phoneScreenshots/screenshot-main.png 127.0.0.1:32158/repo/obb.mainpatch.current/en-US/sevenInchScreenshots/screenshot-tablet-main.png 876s ./tests/run-tests: line 1314: 23077 Killed timeout 5m python3 -m http.server $port --bind 127.0.0.1 > $REPOROOT/http.server.log 2>&1 (wd: /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.gH98/tests) 876s + sleep 1 877s ============================================================================== 877s Test recovering from from broken git submodules 877s + echo_header 'Test recovering from from broken git submodules' 877s + export GIT_ALLOW_PROTOCOL=file 877s + GIT_ALLOW_PROTOCOL=file 877s ++ create_test_dir 877s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 877s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 877s + ROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO 877s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO 877s + mkdir foo bar 877s + cd foo 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 877s hint: Using 'master' as the name for the initial branch. This default branch name 877s hint: is subject to change. To configure the initial branch name to use in all 877s hint: of your new repositories, which will suppress this warning, call: 877s hint: 877s hint: git config --global init.defaultBranch 877s hint: 877s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 877s hint: 'development'. The just-created branch can be renamed via this command: 877s hint: 877s hint: git branch -m 877s + echo a 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add a 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m a 877s + cd ../bar 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 877s hint: Using 'master' as the name for the initial branch. This default branch name 877s hint: is subject to change. To configure the initial branch name to use in all 877s hint: of your new repositories, which will suppress this warning, call: 877s hint: 877s hint: git config --global init.defaultBranch 877s hint: 877s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 877s hint: 'development'. The just-created branch can be renamed via this command: 877s hint: 877s hint: git branch -m 877s ++ pwd 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO/bar/../foo baz 877s Cloning into '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO/bar/baz'... 877s + rm .gitmodules 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am a 877s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO/foo/.git/ 877s [master (root-commit) 0335858] a 877s 1 file changed, 1 insertion(+) 877s create mode 100644 a 877s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO/bar/.git/ 877s [master (root-commit) 152e5ae] a 877s 1 file changed, 1 insertion(+) 877s create mode 160000 baz 877s + rm -rf baz 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git checkout baz 877s Updated 1 path from the index 877s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 2 877s + cd .. 877s + mkdir repo 877s + mkdir metadata 877s + echo 'RepoType: git' 877s ++ pwd 877s + echo 'Repo: file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.PNjO/bar' 877s + echo 'AutoUpdateMode: Version' 877s + echo 'UpdateCheckMode: Tags' 877s + echo 'UpdateCheckData: '\''|||'\''' 877s + echo 'CurrentVersion: 1' 877s + echo 'CurrentVersionCode: 1' 877s + /usr/bin/fdroid checkupdates --allow-dirty 877s 2024-03-07 20:06:44,775 INFO: Processing fake 881s 2024-03-07 20:06:48,547 INFO: ...updating to version 2 (2) 881s + grep 'CurrentVersionCode: 2' metadata/fake.yml 881s CurrentVersionCode: 2 881s ============================================================================== 881s checkupdates ignore broken submodule 881s + echo_header 'checkupdates ignore broken submodule' 881s ++ create_test_dir 881s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 881s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 881s + ROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ 881s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ 881s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ/foo/.git/ 881s [master (root-commit) 2e47523] a 881s 1 file changed, 1 insertion(+) 881s create mode 100644 a 881s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ/bar/.git/ 881s + mkdir foo bar 881s + cd foo 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 881s hint: Using 'master' as the name for the initial branch. This default branch name 881s hint: is subject to change. To configure the initial branch name to use in all 881s hint: of your new repositories, which will suppress this warning, call: 881s hint: 881s hint: git config --global init.defaultBranch 881s hint: 881s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 881s hint: 'development'. The just-created branch can be renamed via this command: 881s hint: 881s hint: git branch -m 881s + echo a 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add a 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m a 881s + cd ../bar 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 881s hint: Using 'master' as the name for the initial branch. This default branch name 881s hint: is subject to change. To configure the initial branch name to use in all 881s hint: of your new repositories, which will suppress this warning, call: 881s hint: 881s hint: git config --global init.defaultBranch 881s hint: 881s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 881s hint: 'development'. The just-created branch can be renamed via this command: 881s hint: 881s hint: git branch -m 881s ++ pwd 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ/bar/../foo baz 881s Cloning into '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ/bar/baz'... 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am a 881s [master (root-commit) c96b306] a 881s 2 files changed, 4 insertions(+) 881s create mode 100644 .gitmodules 881s create mode 160000 baz 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 2 881s + cd ../foo 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit --amend -m aa 881s [master cba3008] aa 881s Date: Thu Mar 7 20:06:48 2024 +0000 881s 1 file changed, 1 insertion(+) 881s create mode 100644 a 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git reflog expire --expire=now --all 881s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git gc --aggressive --prune=now 881s + cd .. 881s + mkdir repo 881s + mkdir metadata 881s + echo 'RepoType: git' 881s ++ pwd 881s + echo 'Repo: file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.SyrQ/bar' 881s + echo Builds: 881s + echo ' - versionName: 1' 881s + echo ' versionCode: 1' 881s + echo ' submodules: true' 881s + echo 'AutoUpdateMode: Version' 881s + echo 'UpdateCheckMode: Tags' 881s + echo 'UpdateCheckData: '\''|||'\''' 881s + echo 'CurrentVersion: 1' 881s + echo 'CurrentVersionCode: 1' 881s + /usr/bin/fdroid checkupdates --allow-dirty 882s 2024-03-07 20:06:49,115 INFO: Processing fake 883s 2024-03-07 20:06:50,134 INFO: submodule broken for fake 885s 2024-03-07 20:06:52,277 INFO: submodule broken for fake 887s 2024-03-07 20:06:54,112 INFO: ...updating to version 2 (2) 887s CurrentVersionCode: 2 887s ============================================================================== 887s checkupdates check version in submodule 887s + grep 'CurrentVersionCode: 2' metadata/fake.yml 887s + echo_header 'checkupdates check version in submodule' 887s ++ create_test_dir 887s ++ test -e /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles 887s ++ mktemp -d /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.XXXX 887s + ROOT=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar 887s + cd /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar 887s + mkdir app sub 887s + cd sub 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 887s hint: Using 'master' as the name for the initial branch. This default branch name 887s hint: is subject to change. To configure the initial branch name to use in all 887s hint: of your new repositories, which will suppress this warning, call: 887s hint: 887s hint: git config --global init.defaultBranch 887s hint: 887s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 887s hint: 'development'. The just-created branch can be renamed via this command: 887s hint: 887s hint: git branch -m 887s + echo 1 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git add ver 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -m 1 887s + cd ../app 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 887s hint: Using 'master' as the name for the initial branch. This default branch name 887s hint: is subject to change. To configure the initial branch name to use in all 887s hint: of your new repositories, which will suppress this warning, call: 887s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/sub/.git/ 887s [master (root-commit) 144584f] 1 887s 1 file changed, 1 insertion(+) 887s create mode 100644 ver 887s Initialized empty Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app/.git/ 887s hint: 887s hint: git config --global init.defaultBranch 887s hint: 887s hint: Names commonly chosen instead of 'master' are 'main', 'trunk' and 887s hint: 'development'. The just-created branch can be renamed via this command: 887s hint: 887s hint: git branch -m 887s ++ pwd 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule add file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app/../sub 887s Cloning into '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app/sub'... 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 1 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git tag 1 887s [master (root-commit) 0e75b49] 1 887s 2 files changed, 4 insertions(+) 887s create mode 100644 .gitmodules 887s create mode 160000 sub 887s + cd ../sub 887s + echo 2 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 2 887s [master 2fc8e98] 2 887s 1 file changed, 1 insertion(+), 1 deletion(-) 887s + cd ../app 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git init 887s Reinitialized existing Git repository in /tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app/.git/ 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git submodule update --remote 887s From file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app/../sub 887s 144584f..2fc8e98 master -> origin/master 887s Submodule path 'sub': checked out '2fc8e98fd1365802dcbc21e0f9e5db57d80ae59b' 887s + env HOME= 'GIT_AUTHOR_NAME='\''Test'\''' 'GIT_AUTHOR_EMAIL='\''no@mail'\''' 'GIT_COMMITTER_NAME='\''Test'\''' 'GIT_COMMITTER_EMAIL='\''no@mail'\''' git commit -am 2 887s [master 087d8da] 2 887s 1 file changed, 1 insertion(+), 1 deletion(-) 887s + cd .. 887s + mkdir repo 887s + mkdir metadata 887s + cat 887s ++ pwd 887s + /usr/bin/fdroid checkupdates --allow-dirty --auto -v 887s 2024-03-07 20:06:54,704 DEBUG: ipfs_cid not found, skipping CIDv1 generation 887s 2024-03-07 20:06:54,706 INFO: Processing fake 887s 2024-03-07 20:06:54,706 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org clone -- file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app build/fake 887s Cloning into 'build/fake'... 887s 2024-03-07 20:06:54,910 DEBUG: Directory: build/fake 887s 2024-03-07 20:06:54,910 DEBUG: > git rev-parse --show-toplevel 888s 2024-03-07 20:06:55,012 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,013 DEBUG: > git checkout -f origin/HEAD 888s 2024-03-07 20:06:55,215 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,215 DEBUG: > git clean -dffx 888s 2024-03-07 20:06:55,218 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,218 DEBUG: > git rev-parse --show-toplevel 888s 2024-03-07 20:06:55,421 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,421 DEBUG: > git submodule sync 888s 2024-03-07 20:06:55,524 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,524 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org submodule update --init --force --recursive 888s Submodule 'sub' (file:///tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/app/../sub) registered for path 'sub' 888s Cloning into '/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/build/fake/sub'... 888s Submodule path 'sub': checked out '2fc8e98fd1365802dcbc21e0f9e5db57d80ae59b' 888s 2024-03-07 20:06:55,727 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,727 DEBUG: > git rev-parse --show-toplevel 888s 2024-03-07 20:06:55,832 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/build/fake, universal_newlines=False, shell=None, istream=) 888s 2024-03-07 20:06:55,834 DEBUG: Popen(['git', 'cat-file', '--batch'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/build/fake, universal_newlines=False, shell=None, istream=) 888s 2024-03-07 20:06:55,836 DEBUG: All tags: 1 888s 2024-03-07 20:06:55,836 DEBUG: Check tag: '1' 888s 2024-03-07 20:06:55,836 DEBUG: Directory: build/fake 888s 2024-03-07 20:06:55,836 DEBUG: > git rev-parse --show-toplevel 889s 2024-03-07 20:06:56,038 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,039 DEBUG: > git submodule foreach --recursive git reset --hard 889s 2024-03-07 20:06:56,242 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,242 DEBUG: > git reset --hard 889s 2024-03-07 20:06:56,445 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,446 DEBUG: > git submodule foreach --recursive git clean -dffx 889s 2024-03-07 20:06:56,649 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,649 DEBUG: > git clean -dffx 889s 2024-03-07 20:06:56,751 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,751 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch origin 889s 2024-03-07 20:06:56,855 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,855 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org remote prune origin 889s 2024-03-07 20:06:56,958 DEBUG: Directory: build/fake 889s 2024-03-07 20:06:56,958 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin 890s 2024-03-07 20:06:57,061 DEBUG: Directory: build/fake 890s 2024-03-07 20:06:57,062 DEBUG: > git remote set-head origin --auto 890s 2024-03-07 20:06:57,265 DEBUG: Directory: build/fake 890s 2024-03-07 20:06:57,265 DEBUG: > git checkout -f 1 890s 2024-03-07 20:06:57,467 DEBUG: Directory: build/fake 890s 2024-03-07 20:06:57,467 DEBUG: > git clean -dffx 890s 2024-03-07 20:06:57,470 DEBUG: Directory: build/fake 890s 2024-03-07 20:06:57,470 DEBUG: > git rev-parse --show-toplevel 890s 2024-03-07 20:06:57,572 DEBUG: Directory: build/fake 890s 2024-03-07 20:06:57,572 DEBUG: > git submodule sync 890s 2024-03-07 20:06:57,775 DEBUG: Directory: build/fake 890s 2024-03-07 20:06:57,775 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org submodule update --init --force --recursive 890s Submodule path 'sub': checked out '144584f9f0ccfc3007da8b571172d4d75f2af76d' 891s 2024-03-07 20:06:57,979 DEBUG: UpdateCheckData found version 1 (1) 891s 2024-03-07 20:06:57,979 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:57,979 DEBUG: > git rev-parse --show-toplevel 891s 2024-03-07 20:06:58,082 DEBUG: Popen(['git', 'cat-file', '--batch-check'], cwd=/tmp/autopkgtest.MqVFDp/build.8ZF/src/.testfiles/run-tests.8lar/build/fake, universal_newlines=False, shell=None, istream=) 891s 2024-03-07 20:06:58,084 DEBUG: ...updating - old vercode=0, new vercode=1 891s 2024-03-07 20:06:58,084 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:58,084 DEBUG: > git rev-parse --show-toplevel 891s 2024-03-07 20:06:58,287 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:58,287 DEBUG: > git submodule foreach --recursive git reset --hard 891s 2024-03-07 20:06:58,490 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:58,490 DEBUG: > git reset --hard 891s 2024-03-07 20:06:58,693 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:58,693 DEBUG: > git submodule foreach --recursive git clean -dffx 891s 2024-03-07 20:06:58,895 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:58,895 DEBUG: > git clean -dffx 891s 2024-03-07 20:06:58,898 DEBUG: Directory: build/fake 891s 2024-03-07 20:06:58,898 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch origin 892s 2024-03-07 20:06:59,001 DEBUG: Directory: build/fake 892s 2024-03-07 20:06:59,001 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org remote prune origin 892s 2024-03-07 20:06:59,103 DEBUG: Directory: build/fake 892s 2024-03-07 20:06:59,103 DEBUG: > git -c core.askpass=/bin/true -c core.sshCommand=/bin/false -c url.https://.insteadOf=ssh:// -c url.https://u:p@bitbucket.org/.insteadOf=git@bitbucket.org: -c url.https://u:p@bitbucket.org.insteadOf=git://bitbucket.org -c url.https://u:p@bitbucket.org.insteadOf=https://bitbucket.org -c url.https://u:p@github.com/.insteadOf=git@github.com: -c url.https://u:p@github.com.insteadOf=git://github.com -c url.https://u:p@github.com.insteadOf=https://github.com -c url.https://u:p@gitlab.com/.insteadOf=git@gitlab.com: -c url.https://u:p@gitlab.com.insteadOf=git://gitlab.com -c url.https://u:p@gitlab.com.insteadOf=https://gitlab.com -c url.https://u:p@codeberg.org/.insteadOf=git@codeberg.org: -c url.https://u:p@codeberg.org.insteadOf=git://codeberg.org -c url.https://u:p@codeberg.org.insteadOf=https://codeberg.org fetch --prune --tags --force origin 892s 2024-03-07 20:06:59,206 DEBUG: Directory: build/fake 892s 2024-03-07 20:06:59,207 DEBUG: > git remote set-head origin --auto 892s 2024-03-07 20:06:59,410 DEBUG: Directory: build/fake 892s 2024-03-07 20:06:59,410 DEBUG: > git checkout -f 0e75b49a360c4f6dfdca9c9758267348649b3aff 892s 2024-03-07 20:06:59,613 DEBUG: Directory: build/fake 892s 2024-03-07 20:06:59,613 DEBUG: > git clean -dffx 892s 2024-03-07 20:06:59,715 DEBUG: ...fetch auto name from build/fake 892s 2024-03-07 20:06:59,716 DEBUG: ...couldn't get autoname 892s 2024-03-07 20:06:59,716 INFO: ...updating to version 1 (1) 892s 2024-03-07 20:06:59,716 INFO: ...auto-generating build for 1 892s 2024-03-07 20:06:59,720 DEBUG: Outputting JSON 892s 2024-03-07 20:06:59,721 DEBUG: skip deploying full build logs: not enabled in config 892s 2024-03-07 20:06:59,721 DEBUG: skip deploying full build logs: not enabled in config 892s 2024-03-07 20:06:59,722 DEBUG: skip deploying full build logs: not enabled in config 892s + grep 'CurrentVersionCode: 1' metadata/fake.yml 892s + unset GIT_ALLOW_PROTOCOL 892s + echo SUCCESS 892s + err_handler 892s + set +x 892s CurrentVersionCode: 1 892s SUCCESS 893s autopkgtest [20:07:00]: test command1: -----------------------] 894s autopkgtest [20:07:01]: test command1: - - - - - - - - - - results - - - - - - - - - - 894s command1 PASS 895s autopkgtest [20:07:02]: test locales: preparing testbed 1101s autopkgtest [20:10:28]: @@@@@@@@@@@@@@@@@@@@ test bed setup 1102s Get:1 http://ftpmaster.internal/ubuntu noble-proposed InRelease [117 kB] 1103s Get:2 http://ftpmaster.internal/ubuntu noble-proposed/universe Sources [1833 kB] 1105s Get:3 http://ftpmaster.internal/ubuntu noble-proposed/main Sources [321 kB] 1105s Get:4 http://ftpmaster.internal/ubuntu noble-proposed/multiverse Sources [23.8 kB] 1105s Get:5 http://ftpmaster.internal/ubuntu noble-proposed/restricted Sources [3976 B] 1105s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 Packages [444 kB] 1105s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 c-n-f Metadata [3144 B] 1105s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 Packages [20.3 kB] 1105s Get:9 http://ftpmaster.internal/ubuntu noble-proposed/restricted arm64 c-n-f Metadata [116 B] 1105s Get:10 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 Packages [2165 kB] 1105s Get:11 http://ftpmaster.internal/ubuntu noble-proposed/universe arm64 c-n-f Metadata [8528 B] 1105s Get:12 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 Packages [21.5 kB] 1105s Get:13 http://ftpmaster.internal/ubuntu noble-proposed/multiverse arm64 c-n-f Metadata [116 B] 1113s Fetched 4961 kB in 4s (1267 kB/s) 1114s Reading package lists... 1123s Reading package lists... 1123s Building dependency tree... 1123s Reading state information... 1125s Calculating upgrade... 1126s The following packages will be REMOVED: 1126s libefiboot1 libefivar1 libssl3 1126s The following NEW packages will be installed: 1126s libefiboot1t64 libefivar1t64 libssl3t64 1126s The following packages will be upgraded: 1126s dmsetup grub-common grub2-common libdevmapper1.02.1 openssl pci.ids rsync 1126s 7 upgraded, 3 newly installed, 3 to remove and 0 not upgraded. 1126s Need to get 6589 kB of archives. 1126s After this operation, 35.8 kB of additional disk space will be used. 1126s Get:1 http://ftpmaster.internal/ubuntu noble/main arm64 libdevmapper1.02.1 arm64 2:1.02.185-3ubuntu1 [128 kB] 1127s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 grub2-common arm64 2.12-1ubuntu4 [671 kB] 1127s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 grub-common arm64 2.12-1ubuntu4 [2174 kB] 1127s Get:4 http://ftpmaster.internal/ubuntu noble/main arm64 libefivar1t64 arm64 38-3.1 [55.1 kB] 1127s Get:5 http://ftpmaster.internal/ubuntu noble/main arm64 libefiboot1t64 arm64 38-3.1 [40.5 kB] 1127s Get:6 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 openssl arm64 3.0.10-1ubuntu5 [982 kB] 1127s Get:7 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 rsync arm64 3.2.7-1build1 [427 kB] 1127s Get:8 http://ftpmaster.internal/ubuntu noble-proposed/main arm64 libssl3t64 arm64 3.0.10-1ubuntu5 [1763 kB] 1127s Get:9 http://ftpmaster.internal/ubuntu noble/main arm64 dmsetup arm64 2:1.02.185-3ubuntu1 [74.5 kB] 1127s Get:10 http://ftpmaster.internal/ubuntu noble/main arm64 pci.ids all 0.0~2024.02.02-1 [273 kB] 1128s Preconfiguring packages ... 1129s Fetched 6589 kB in 1s (7250 kB/s) 1131s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75860 files and directories currently installed.) 1131s Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.185-3ubuntu1_arm64.deb ... 1131s Unpacking libdevmapper1.02.1:arm64 (2:1.02.185-3ubuntu1) over (2:1.02.185-2ubuntu1) ... 1131s Preparing to unpack .../grub2-common_2.12-1ubuntu4_arm64.deb ... 1131s Unpacking grub2-common (2.12-1ubuntu4) over (2.12-1ubuntu3) ... 1131s Preparing to unpack .../grub-common_2.12-1ubuntu4_arm64.deb ... 1131s Unpacking grub-common (2.12-1ubuntu4) over (2.12-1ubuntu3) ... 1132s dpkg: libefivar1:arm64: dependency problems, but removing anyway as you requested: 1132s mokutil depends on libefivar1 (>= 37). 1132s libefiboot1:arm64 depends on libefivar1 (>= 38). 1132s efibootmgr depends on libefivar1 (>= 38). 1132s 1132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75860 files and directories currently installed.) 1132s Removing libefivar1:arm64 (38-3) ... 1132s Selecting previously unselected package libefivar1t64:arm64. 1132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75855 files and directories currently installed.) 1132s Preparing to unpack .../libefivar1t64_38-3.1_arm64.deb ... 1132s Unpacking libefivar1t64:arm64 (38-3.1) ... 1132s dpkg: libefiboot1:arm64: dependency problems, but removing anyway as you requested: 1132s efibootmgr depends on libefiboot1 (>= 38). 1132s 1132s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75861 files and directories currently installed.) 1132s Removing libefiboot1:arm64 (38-3) ... 1132s Selecting previously unselected package libefiboot1t64:arm64. 1133s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75856 files and directories currently installed.) 1133s Preparing to unpack .../libefiboot1t64_38-3.1_arm64.deb ... 1133s Unpacking libefiboot1t64:arm64 (38-3.1) ... 1133s Preparing to unpack .../openssl_3.0.10-1ubuntu5_arm64.deb ... 1133s Unpacking openssl (3.0.10-1ubuntu5) over (3.0.10-1ubuntu4) ... 1133s Preparing to unpack .../rsync_3.2.7-1build1_arm64.deb ... 1133s Unpacking rsync (3.2.7-1build1) over (3.2.7-1) ... 1133s dpkg: libssl3:arm64: dependency problems, but removing anyway as you requested: 1133s wget depends on libssl3 (>= 3.0.0). 1133s u-boot-tools depends on libssl3 (>= 3.0.0). 1133s tnftp depends on libssl3 (>= 3.0.0). 1133s tcpdump depends on libssl3 (>= 3.0.0). 1133s systemd-resolved depends on libssl3 (>= 3.0.0). 1133s systemd depends on libssl3 (>= 3.0.0). 1133s sudo depends on libssl3 (>= 3.0.0). 1133s sbsigntool depends on libssl3 (>= 3.0.0). 1133s python3-cryptography depends on libssl3 (>= 3.0.0). 1133s openssh-server depends on libssl3 (>= 3.0.10). 1133s openssh-client depends on libssl3 (>= 3.0.10). 1133s mtd-utils depends on libssl3 (>= 3.0.0). 1133s mokutil depends on libssl3 (>= 3.0.0). 1133s linux-headers-6.8.0-11-generic depends on libssl3 (>= 3.0.0). 1133s libsystemd-shared:arm64 depends on libssl3 (>= 3.0.0). 1133s libssh-4:arm64 depends on libssl3 (>= 3.0.0). 1133s libsasl2-modules:arm64 depends on libssl3 (>= 3.0.0). 1133s libsasl2-2:arm64 depends on libssl3 (>= 3.0.0). 1133s libpython3.12-minimal:arm64 depends on libssl3 (>= 3.0.0). 1133s libpython3.11-minimal:arm64 depends on libssl3 (>= 3.0.0). 1133s libnvme1 depends on libssl3 (>= 3.0.0). 1133s libkrb5-3:arm64 depends on libssl3 (>= 3.0.0). 1133s libkmod2:arm64 depends on libssl3 (>= 3.0.0). 1133s libfido2-1:arm64 depends on libssl3 (>= 3.0.0). 1133s libcurl4:arm64 depends on libssl3 (>= 3.0.0). 1133s libcryptsetup12:arm64 depends on libssl3 (>= 3.0.0). 1133s kmod depends on libssl3 (>= 3.0.0). 1133s dhcpcd-base depends on libssl3 (>= 3.0.0). 1133s bind9-libs:arm64 depends on libssl3 (>= 3.0.0). 1133s 1133s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75862 files and directories currently installed.) 1133s Removing libssl3:arm64 (3.0.10-1ubuntu4) ... 1133s Selecting previously unselected package libssl3t64:arm64. 1134s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75851 files and directories currently installed.) 1134s Preparing to unpack .../libssl3t64_3.0.10-1ubuntu5_arm64.deb ... 1134s Unpacking libssl3t64:arm64 (3.0.10-1ubuntu5) ... 1134s Preparing to unpack .../dmsetup_2%3a1.02.185-3ubuntu1_arm64.deb ... 1134s Unpacking dmsetup (2:1.02.185-3ubuntu1) over (2:1.02.185-2ubuntu1) ... 1134s Preparing to unpack .../pci.ids_0.0~2024.02.02-1_all.deb ... 1134s Unpacking pci.ids (0.0~2024.02.02-1) over (0.0~2023.11.11-1) ... 1134s Setting up pci.ids (0.0~2024.02.02-1) ... 1134s Setting up libssl3t64:arm64 (3.0.10-1ubuntu5) ... 1134s Setting up libefivar1t64:arm64 (38-3.1) ... 1134s Setting up libdevmapper1.02.1:arm64 (2:1.02.185-3ubuntu1) ... 1134s Setting up dmsetup (2:1.02.185-3ubuntu1) ... 1134s Setting up libefiboot1t64:arm64 (38-3.1) ... 1134s Setting up openssl (3.0.10-1ubuntu5) ... 1134s Setting up rsync (3.2.7-1build1) ... 1136s rsync.service is a disabled or a static unit not running, not starting it. 1136s Setting up grub-common (2.12-1ubuntu4) ... 1137s update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults 1140s Setting up grub2-common (2.12-1ubuntu4) ... 1140s Processing triggers for man-db (2.12.0-3) ... 1153s Processing triggers for install-info (7.1-3) ... 1153s Processing triggers for initramfs-tools (0.142ubuntu19) ... 1153s update-initramfs: Generating /boot/initrd.img-6.8.0-11-generic 1153s W: No lz4 in /usr/bin:/sbin:/bin, using gzip 1199s System running in EFI mode, skipping. 1199s Processing triggers for libc-bin (2.39-0ubuntu2) ... 1201s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1201s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1201s Reading package lists... 1201s Building dependency tree... 1201s Reading state information... 1204s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1206s sh: Attempting to set up Debian/Ubuntu apt sources automatically 1206s sh: Distribution appears to be Ubuntu 1219s Reading package lists... 1220s Building dependency tree... 1220s Reading state information... 1224s eatmydata is already the newest version (131-1). 1224s dbus is already the newest version (1.14.10-4ubuntu1). 1224s dbus set to manually installed. 1224s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1224s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1224s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1224s Reading package lists... 1225s Building dependency tree... 1225s Reading state information... 1228s rng-tools-debian is already the newest version (2.4). 1228s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1228s Reading package lists... 1230s Building dependency tree... 1230s Reading state information... 1233s haveged is already the newest version (1.9.14-1ubuntu1). 1233s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1234s Reading package lists... 1236s Building dependency tree... 1236s Reading state information... 1240s The following packages will be REMOVED: 1240s cloud-init* python3-configobj* python3-debconf* 1243s 0 upgraded, 0 newly installed, 3 to remove and 0 not upgraded. 1243s After this operation, 3248 kB disk space will be freed. 1243s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75864 files and directories currently installed.) 1243s Removing cloud-init (24.1-0ubuntu1) ... 1247s Removing python3-configobj (5.0.8-3) ... 1248s Removing python3-debconf (1.5.86) ... 1249s Processing triggers for man-db (2.12.0-3) ... 1250s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75475 files and directories currently installed.) 1250s Purging configuration files for cloud-init (24.1-0ubuntu1) ... 1254s dpkg: warning: while removing cloud-init, directory '/etc/cloud/cloud.cfg.d' not empty so not removed 1254s Processing triggers for rsyslog (8.2312.0-3ubuntu3) ... 1256s Reading package lists... 1256s Building dependency tree... 1256s Reading state information... 1259s linux-generic is already the newest version (6.8.0-11.11+1). 1259s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1260s Hit:1 http://ftpmaster.internal/ubuntu noble InRelease 1260s Hit:2 http://ftpmaster.internal/ubuntu noble-updates InRelease 1261s Hit:3 http://ftpmaster.internal/ubuntu noble-security InRelease 1261s Hit:4 http://ftpmaster.internal/ubuntu noble-proposed InRelease 1261s Hit:5 http://ftpmaster.internal/ubuntu noble-backports InRelease 1276s Reading package lists... 1276s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:1 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:2 and /etc/apt/sources.list.d/ubuntu.sources:1 1276s W: Target Packages (main/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (main/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (main/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (main/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (universe/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (universe/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (universe/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (universe/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (restricted/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (restricted/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (restricted/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (restricted/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (multiverse/binary-arm64/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target Packages (multiverse/binary-all/Packages) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (multiverse/cnf/Commands-arm64) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s W: Target CNF (multiverse/cnf/Commands-all) is configured multiple times in /etc/apt/sources.list:3 and /etc/apt/sources.list.d/ubuntu.sources:2 1276s Reading package lists... 1277s Building dependency tree... 1277s Reading state information... 1278s Calculating upgrade... 1279s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1280s Reading package lists... 1280s Building dependency tree... 1280s Reading state information... 1282s 0 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. 1282s autopkgtest [20:13:29]: rebooting testbed after setup commands that affected boot 1456s autopkgtest-virt-ssh: WARNING: ssh connection failed. Retrying in 3 seconds... 1467s autopkgtest [20:16:34]: testbed dpkg architecture: arm64 1474s Reading package lists... 1475s Building dependency tree... 1475s Reading state information... 1476s Correcting dependencies...Starting pkgProblemResolver with broken count: 0 1476s Starting 2 pkgProblemResolver with broken count: 0 1476s Done 1477s Done 1478s Starting pkgProblemResolver with broken count: 0 1478s Starting 2 pkgProblemResolver with broken count: 0 1478s Done 1479s The following additional packages will be installed: 1479s adwaita-icon-theme androguard apksigner at-spi2-common blt 1479s ca-certificates-java default-jdk-headless default-jre default-jre-headless 1479s fdroidserver fontconfig fontconfig-config fonts-dejavu-core 1479s fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache 1479s hicolor-icon-theme humanity-icon-theme java-common libann0 libapksig-java 1479s libasound2 libasound2-data libatk1.0-0 libavahi-client3 libavahi-common-data 1479s libavahi-common3 libblas3 libcairo2 libcdt5 libcgraph6 libcups2 libdatrie1 1479s libdeflate0 libdrm-amdgpu1 libdrm-nouveau2 libdrm-radeon1 liberror-perl 1479s libfontconfig1 libgd3 libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common 1479s libgfortran5 libgif7 libgl1 libgl1-mesa-dri libglapi-mesa libglvnd0 1479s libglx-mesa0 libglx0 libgomp1 libgraphite2-3 libgtk2.0-0 libgtk2.0-common 1479s libgts-0.7-5 libgvc6 libgvpr2 libharfbuzz0b libice6 libimagequant0 libjbig0 1479s libjpeg-turbo8 libjpeg8 libjs-jquery libjs-jquery-ui liblab-gamut1 1479s liblapack3 liblbfgsb0 liblcms2-2 liblerc4 libllvm17 libltdl7 libopenjp2-7 1479s libpango-1.0-0 libpangocairo-1.0-0 libpangoft2-1.0-0 libpathplan4 1479s libpcsclite1 libpixman-1-0 libqhull-r8.0 libraqm0 libsharpyuv0 libsm6 1479s libsodium23 libtcl8.6 libthai-data libthai0 libtiff6 libtk8.6 libvulkan1 1479s libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 libxaw7 libxcb-dri2-0 1479s libxcb-dri3-0 libxcb-glx0 libxcb-present0 libxcb-randr0 libxcb-render0 1479s libxcb-shm0 libxcb-sync1 libxcb-xfixes0 libxcomposite1 libxcursor1 1479s libxdamage1 libxfixes3 libxft2 libxi6 libxinerama1 libxmu6 libxpm4 1479s libxrandr2 libxrender1 libxshmfence1 libxslt1.1 libxss1 libxt6 libxtst6 1479s libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre openjdk-21-jre-headless 1479s python-matplotlib-data python3-appdirs python3-args python3-asn1crypto 1479s python3-asttokens python3-bcrypt python3-brotli python3-click python3-clint 1479s python3-colorama python3-contourpy python3-cycler python3-dateutil 1479s python3-decorator python3-defusedxml python3-executing python3-fonttools 1479s python3-fs python3-git python3-gitdb python3-ipython python3-jedi 1479s python3-kiwisolver python3-libcloud python3-lockfile python3-lxml 1479s python3-lz4 python3-magic python3-matplotlib python3-matplotlib-inline 1479s python3-mpmath python3-nacl python3-networkx python3-numpy python3-oscrypto 1479s python3-packaging python3-paramiko python3-parso python3-pathspec 1479s python3-pexpect python3-pil python3-pil.imagetk python3-png 1479s python3-prompt-toolkit python3-ptyprocess python3-pure-eval python3-pyasn1 1479s python3-pyasn1-modules python3-pydot python3-qrcode python3-ruamel.yaml 1479s python3-ruamel.yaml.clib python3-scipy python3-simplejson python3-smmap 1479s python3-stack-data python3-sympy python3-tk python3-traitlets 1479s python3-ufolib2 python3-unicodedata2 python3-wcwidth tk8.6-blt2.5 1479s ubuntu-mono unicode-data x11-common yamllint 1479s Suggested packages: 1479s blt-demo gradle ipfs-cid vagrant vagrant-cachier vagrant-libvirt qemu-kvm 1479s git-daemon-run | git-daemon-sysvinit git-doc git-email git-gui gitk gitweb 1479s git-cvs git-mediawiki git-svn gsfonts graphviz-doc libasound2-plugins 1479s alsa-utils cups-common libgd-tools gvfs libjs-jquery-ui-docs liblcms2-utils 1479s pcscd tcl8.6 tk8.6 openjdk-21-demo openjdk-21-source libnss-mdns 1479s fonts-dejavu-extra fonts-ipafont-gothic fonts-ipafont-mincho 1479s fonts-wqy-microhei | fonts-wqy-zenhei fonts-indic python-cycler-doc 1479s python-git-doc python-ipython-doc python-lockfile-doc python-lxml-doc 1479s cm-super-minimal dvipng ffmpeg fonts-staypuft ghostscript gir1.2-gtk-3.0 1479s inkscape ipython3 librsvg2-common python3-cairocffi python3-gi-cairo 1479s python3-gobject python3-pyqt5 python3-sip python3-tornado 1479s texlive-extra-utils texlive-latex-extra python-mpmath-doc python3-gmpy2 1479s python-nacl-doc python-networkx-doc python3-gdal python3-pygraphviz gcc 1479s gfortran python3-dev python3-pytest python3-gssapi python3-invoke 1479s python-pexpect-doc python-pil-doc python-scipy-doc texlive-fonts-extra 1479s python-sympy-doc tix python3-tk-dbg 1479s Recommended packages: 1479s librsvg2-common python3-pyperclip python3-pyqt5 android-sdk dexdump opensc 1479s s3cmd fonts-liberation2 alsa-ucm-conf alsa-topology-conf 1479s libgdk-pixbuf2.0-bin libgl1-amber-dri libgail-common libgtk2.0-bin 1479s libgts-bin javascript-common mesa-vulkan-drivers | vulkan-icd 1479s libatk-wrapper-java-jni fonts-dejavu-extra python3-bs4 python3-cssselect 1479s python3-html5lib python3-olefile g++ | c++-compiler isympy-common 1480s The following NEW packages will be installed: 1480s adwaita-icon-theme androguard apksigner at-spi2-common blt 1480s ca-certificates-java default-jdk-headless default-jre default-jre-headless 1480s fdroidserver fontconfig fontconfig-config fonts-dejavu-core 1480s fonts-dejavu-mono fonts-lyx git git-man graphviz gtk-update-icon-cache 1480s hicolor-icon-theme humanity-icon-theme java-common libann0 libapksig-java 1480s libasound2 libasound2-data libatk1.0-0 libavahi-client3 libavahi-common-data 1480s libavahi-common3 libblas3 libcairo2 libcdt5 libcgraph6 libcups2 libdatrie1 1480s libdeflate0 libdrm-amdgpu1 libdrm-nouveau2 libdrm-radeon1 liberror-perl 1480s libfontconfig1 libgd3 libgdk-pixbuf-2.0-0 libgdk-pixbuf2.0-common 1480s libgfortran5 libgif7 libgl1 libgl1-mesa-dri libglapi-mesa libglvnd0 1480s libglx-mesa0 libglx0 libgomp1 libgraphite2-3 libgtk2.0-0 libgtk2.0-common 1480s libgts-0.7-5 libgvc6 libgvpr2 libharfbuzz0b libice6 libimagequant0 libjbig0 1480s libjpeg-turbo8 libjpeg8 libjs-jquery libjs-jquery-ui liblab-gamut1 1480s liblapack3 liblbfgsb0 liblcms2-2 liblerc4 libllvm17 libltdl7 libopenjp2-7 1480s libpango-1.0-0 libpangocairo-1.0-0 libpangoft2-1.0-0 libpathplan4 1480s libpcsclite1 libpixman-1-0 libqhull-r8.0 libraqm0 libsharpyuv0 libsm6 1480s libsodium23 libtcl8.6 libthai-data libthai0 libtiff6 libtk8.6 libvulkan1 1480s libwebp7 libwebpdemux2 libwebpmux3 libx11-xcb1 libxaw7 libxcb-dri2-0 1480s libxcb-dri3-0 libxcb-glx0 libxcb-present0 libxcb-randr0 libxcb-render0 1480s libxcb-shm0 libxcb-sync1 libxcb-xfixes0 libxcomposite1 libxcursor1 1480s libxdamage1 libxfixes3 libxft2 libxi6 libxinerama1 libxmu6 libxpm4 1480s libxrandr2 libxrender1 libxshmfence1 libxslt1.1 libxss1 libxt6 libxtst6 1480s libxxf86vm1 openjdk-21-jdk-headless openjdk-21-jre openjdk-21-jre-headless 1480s python-matplotlib-data python3-appdirs python3-args python3-asn1crypto 1480s python3-asttokens python3-bcrypt python3-brotli python3-click python3-clint 1480s python3-colorama python3-contourpy python3-cycler python3-dateutil 1480s python3-decorator python3-defusedxml python3-executing python3-fonttools 1480s python3-fs python3-git python3-gitdb python3-ipython python3-jedi 1480s python3-kiwisolver python3-libcloud python3-lockfile python3-lxml 1480s python3-lz4 python3-magic python3-matplotlib python3-matplotlib-inline 1480s python3-mpmath python3-nacl python3-networkx python3-numpy python3-oscrypto 1480s python3-packaging python3-paramiko python3-parso python3-pathspec 1480s python3-pexpect python3-pil python3-pil.imagetk python3-png 1480s python3-prompt-toolkit python3-ptyprocess python3-pure-eval python3-pyasn1 1480s python3-pyasn1-modules python3-pydot python3-qrcode python3-ruamel.yaml 1480s python3-ruamel.yaml.clib python3-scipy python3-simplejson python3-smmap 1480s python3-stack-data python3-sympy python3-tk python3-traitlets 1480s python3-ufolib2 python3-unicodedata2 python3-wcwidth tk8.6-blt2.5 1480s ubuntu-mono unicode-data x11-common yamllint 1480s 0 upgraded, 194 newly installed, 0 to remove and 0 not upgraded. 1480s 1 not fully installed or removed. 1480s Need to get 283 MB of archives. 1480s After this operation, 965 MB of additional disk space will be used. 1480s Get:1 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asn1crypto all 1.5.1-3 [79.7 kB] 1480s Get:2 http://ftpmaster.internal/ubuntu noble/main arm64 python3-colorama all 0.4.6-4 [32.1 kB] 1480s Get:3 http://ftpmaster.internal/ubuntu noble/main arm64 python3-click all 8.1.6-1 [79.0 kB] 1480s Get:4 http://ftpmaster.internal/ubuntu noble/main arm64 python3-decorator all 5.1.1-5 [10.1 kB] 1480s Get:5 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-parso all 0.8.3-1 [67.2 kB] 1480s Get:6 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-jedi all 0.18.2-1ubuntu1 [692 kB] 1481s Get:7 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-traitlets all 5.5.0-2 [85.0 kB] 1481s Get:8 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib-inline all 0.1.6-2 [8784 B] 1481s Get:9 http://ftpmaster.internal/ubuntu noble/main arm64 python3-ptyprocess all 0.7.0-5 [15.1 kB] 1481s Get:10 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pexpect all 4.9-2 [48.1 kB] 1481s Get:11 http://ftpmaster.internal/ubuntu noble/main arm64 python3-wcwidth all 0.2.5+dfsg1-1.1ubuntu1 [22.5 kB] 1481s Get:12 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-prompt-toolkit all 3.0.43-1 [256 kB] 1481s Get:13 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-asttokens all 2.4.1-1 [20.9 kB] 1481s Get:14 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-executing all 2.0.1-0.1 [23.3 kB] 1481s Get:15 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pure-eval all 0.2.2-1 [11.3 kB] 1481s Get:16 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-stack-data all 0.6.3-1 [22.0 kB] 1481s Get:17 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ipython all 8.20.0-1 [561 kB] 1481s Get:18 http://ftpmaster.internal/ubuntu noble/main arm64 libxslt1.1 arm64 1.1.35-1 [161 kB] 1481s Get:19 http://ftpmaster.internal/ubuntu noble/main arm64 python3-lxml arm64 5.1.0-1 [2042 kB] 1481s Get:20 http://ftpmaster.internal/ubuntu noble/main arm64 python3-magic all 2:0.4.27-2 [13.4 kB] 1481s Get:21 http://ftpmaster.internal/ubuntu noble/main arm64 libjs-jquery all 3.6.1+dfsg+~3.5.14-1 [328 kB] 1481s Get:22 http://ftpmaster.internal/ubuntu noble/universe arm64 libjs-jquery-ui all 1.13.2+dfsg-1 [252 kB] 1481s Get:23 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-mono all 2.37-8 [502 kB] 1481s Get:24 http://ftpmaster.internal/ubuntu noble/main arm64 fonts-dejavu-core all 2.37-8 [835 kB] 1481s Get:25 http://ftpmaster.internal/ubuntu noble/universe arm64 fonts-lyx all 2.4.0~RC3-1 [170 kB] 1481s Get:26 http://ftpmaster.internal/ubuntu noble/universe arm64 python-matplotlib-data all 3.6.3-1ubuntu3 [2936 kB] 1481s Get:27 http://ftpmaster.internal/ubuntu noble/main arm64 python3-dateutil all 2.8.2-3 [79.2 kB] 1481s Get:28 http://ftpmaster.internal/ubuntu noble/main arm64 libgomp1 arm64 14-20240303-1ubuntu1 [144 kB] 1481s Get:29 http://ftpmaster.internal/ubuntu noble/main arm64 libimagequant0 arm64 2.18.0-1 [37.0 kB] 1481s Get:30 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg-turbo8 arm64 2.1.5-2ubuntu1 [160 kB] 1481s Get:31 http://ftpmaster.internal/ubuntu noble/main arm64 libjpeg8 arm64 8c-2ubuntu11 [2148 B] 1481s Get:32 http://ftpmaster.internal/ubuntu noble/main arm64 liblcms2-2 arm64 2.14-2 [159 kB] 1481s Get:33 http://ftpmaster.internal/ubuntu noble/main arm64 libopenjp2-7 arm64 2.5.0-2 [170 kB] 1481s Get:34 http://ftpmaster.internal/ubuntu noble/main arm64 libgraphite2-3 arm64 1.3.14-2 [81.5 kB] 1481s Get:35 http://ftpmaster.internal/ubuntu noble/main arm64 libharfbuzz0b arm64 8.3.0-2 [463 kB] 1481s Get:36 http://ftpmaster.internal/ubuntu noble/main arm64 libraqm0 arm64 0.10.1-1 [14.4 kB] 1481s Get:37 http://ftpmaster.internal/ubuntu noble/main arm64 libdeflate0 arm64 1.19-1 [43.4 kB] 1481s Get:38 http://ftpmaster.internal/ubuntu noble/main arm64 libjbig0 arm64 2.1-6.1ubuntu1 [28.9 kB] 1481s Get:39 http://ftpmaster.internal/ubuntu noble/main arm64 liblerc4 arm64 4.0.0+ds-4ubuntu1 [153 kB] 1481s Get:40 http://ftpmaster.internal/ubuntu noble/main arm64 libsharpyuv0 arm64 1.3.2-0.4 [14.4 kB] 1481s Get:41 http://ftpmaster.internal/ubuntu noble/main arm64 libwebp7 arm64 1.3.2-0.4 [191 kB] 1481s Get:42 http://ftpmaster.internal/ubuntu noble/main arm64 libtiff6 arm64 4.5.1+git230720-3ubuntu1 [226 kB] 1481s Get:43 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpdemux2 arm64 1.3.2-0.4 [12.3 kB] 1481s Get:44 http://ftpmaster.internal/ubuntu noble/main arm64 libwebpmux3 arm64 1.3.2-0.4 [25.0 kB] 1481s Get:45 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pil arm64 10.2.0-1 [477 kB] 1481s Get:46 http://ftpmaster.internal/ubuntu noble/main arm64 libtcl8.6 arm64 8.6.13+dfsg-2 [980 kB] 1481s Get:47 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig-config arm64 2.15.0-1ubuntu1 [37.0 kB] 1481s Get:48 http://ftpmaster.internal/ubuntu noble/main arm64 libfontconfig1 arm64 2.15.0-1ubuntu1 [142 kB] 1481s Get:49 http://ftpmaster.internal/ubuntu noble/main arm64 libxrender1 arm64 1:0.9.10-1.1 [19.1 kB] 1481s Get:50 http://ftpmaster.internal/ubuntu noble/main arm64 libxft2 arm64 2.3.6-1 [43.3 kB] 1481s Get:51 http://ftpmaster.internal/ubuntu noble/main arm64 x11-common all 1:7.7+23ubuntu2 [23.4 kB] 1481s Get:52 http://ftpmaster.internal/ubuntu noble/main arm64 libxss1 arm64 1:1.2.3-1build2 [8252 B] 1481s Get:53 http://ftpmaster.internal/ubuntu noble/main arm64 libtk8.6 arm64 8.6.13-2 [760 kB] 1481s Get:54 http://ftpmaster.internal/ubuntu noble/main arm64 tk8.6-blt2.5 arm64 2.5.3+dfsg-7 [618 kB] 1481s Get:55 http://ftpmaster.internal/ubuntu noble/main arm64 blt arm64 2.5.3+dfsg-7 [4826 B] 1481s Get:56 http://ftpmaster.internal/ubuntu noble/main arm64 python3-tk arm64 3.11.5-1 [112 kB] 1482s Get:57 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pil.imagetk arm64 10.2.0-1 [9708 B] 1482s Get:58 http://ftpmaster.internal/ubuntu noble/main arm64 libblas3 arm64 3.12.0-3 [143 kB] 1482s Get:59 http://ftpmaster.internal/ubuntu noble/main arm64 libgfortran5 arm64 14-20240303-1ubuntu1 [444 kB] 1482s Get:60 http://ftpmaster.internal/ubuntu noble/main arm64 liblapack3 arm64 3.12.0-3 [2241 kB] 1482s Get:61 http://ftpmaster.internal/ubuntu noble/main arm64 python3-numpy arm64 1:1.24.2-2 [4525 kB] 1482s Get:62 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-contourpy arm64 1.0.7-1build2 [244 kB] 1482s Get:63 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-cycler all 0.11.0-2 [8202 B] 1482s Get:64 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-brotli arm64 1.1.0-2 [345 kB] 1482s Get:65 http://ftpmaster.internal/ubuntu noble/universe arm64 liblbfgsb0 arm64 3.0+dfsg.4-1 [27.7 kB] 1482s Get:66 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-scipy arm64 1.11.4-6 [18.6 MB] 1482s Get:67 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ufolib2 all 0.16.0+dfsg1-1 [33.5 kB] 1482s Get:68 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-mpmath all 1.2.1-3 [421 kB] 1482s Get:69 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-sympy all 1.12-7 [3966 kB] 1482s Get:70 http://ftpmaster.internal/ubuntu noble/main arm64 python3-appdirs all 1.4.4-4 [10.9 kB] 1482s Get:71 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fs all 2.4.16-3 [91.1 kB] 1482s Get:72 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lz4 arm64 4.0.2+dfsg-1build2 [28.4 kB] 1482s Get:73 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-unicodedata2 arm64 15.1.0+ds-1 [362 kB] 1482s Get:74 http://ftpmaster.internal/ubuntu noble/universe arm64 unicode-data all 15.1.0-1 [8878 kB] 1483s Get:75 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-fonttools arm64 4.46.0-1 [1625 kB] 1483s Get:76 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-kiwisolver arm64 1.4.4-1build2 [65.4 kB] 1483s Get:77 http://ftpmaster.internal/ubuntu noble/main arm64 python3-packaging all 23.2-1 [40.6 kB] 1483s Get:78 http://ftpmaster.internal/ubuntu noble/universe arm64 libqhull-r8.0 arm64 2020.2-6 [188 kB] 1483s Get:79 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-matplotlib arm64 3.6.3-1ubuntu3 [7291 kB] 1483s Get:80 http://ftpmaster.internal/ubuntu noble/main arm64 python3-networkx all 2.8.8-1ubuntu1 [1468 kB] 1483s Get:81 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-oscrypto all 1.3.0-5 [168 kB] 1483s Get:82 http://ftpmaster.internal/ubuntu noble/universe arm64 libann0 arm64 1.1.2+doc-9 [25.1 kB] 1483s Get:83 http://ftpmaster.internal/ubuntu noble/universe arm64 libcdt5 arm64 2.42.2-8build1 [20.3 kB] 1483s Get:84 http://ftpmaster.internal/ubuntu noble/universe arm64 libcgraph6 arm64 2.42.2-8build1 [44.8 kB] 1483s Get:85 http://ftpmaster.internal/ubuntu noble/main arm64 libxpm4 arm64 1:3.5.17-1 [34.5 kB] 1483s Get:86 http://ftpmaster.internal/ubuntu noble/main arm64 libgd3 arm64 2.3.3-9ubuntu1 [119 kB] 1483s Get:87 http://ftpmaster.internal/ubuntu noble/universe arm64 libgts-0.7-5 arm64 0.7.6+darcs121130-5 [157 kB] 1483s Get:88 http://ftpmaster.internal/ubuntu noble/main arm64 libpixman-1-0 arm64 0.42.2-1 [193 kB] 1483s Get:89 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-render0 arm64 1.15-1 [16.1 kB] 1483s Get:90 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-shm0 arm64 1.15-1 [5780 B] 1483s Get:91 http://ftpmaster.internal/ubuntu noble/main arm64 libcairo2 arm64 1.18.0-1 [550 kB] 1483s Get:92 http://ftpmaster.internal/ubuntu noble/main arm64 libltdl7 arm64 2.4.7-7 [40.3 kB] 1483s Get:93 http://ftpmaster.internal/ubuntu noble/main arm64 fontconfig arm64 2.15.0-1ubuntu1 [190 kB] 1483s Get:94 http://ftpmaster.internal/ubuntu noble/main arm64 libthai-data all 0.1.29-2 [158 kB] 1483s Get:95 http://ftpmaster.internal/ubuntu noble/main arm64 libdatrie1 arm64 0.2.13-3 [21.7 kB] 1483s Get:96 http://ftpmaster.internal/ubuntu noble/main arm64 libthai0 arm64 0.1.29-2 [18.1 kB] 1483s Get:97 http://ftpmaster.internal/ubuntu noble/main arm64 libpango-1.0-0 arm64 1.51.0+ds-4 [226 kB] 1483s Get:98 http://ftpmaster.internal/ubuntu noble/main arm64 libpangoft2-1.0-0 arm64 1.51.0+ds-4 [41.2 kB] 1483s Get:99 http://ftpmaster.internal/ubuntu noble/main arm64 libpangocairo-1.0-0 arm64 1.51.0+ds-4 [27.6 kB] 1483s Get:100 http://ftpmaster.internal/ubuntu noble/universe arm64 libpathplan4 arm64 2.42.2-8build1 [22.6 kB] 1483s Get:101 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvc6 arm64 2.42.2-8build1 [692 kB] 1483s Get:102 http://ftpmaster.internal/ubuntu noble/universe arm64 libgvpr2 arm64 2.42.2-8build1 [187 kB] 1484s Get:103 http://ftpmaster.internal/ubuntu noble/universe arm64 liblab-gamut1 arm64 2.42.2-8build1 [1860 kB] 1484s Get:104 http://ftpmaster.internal/ubuntu noble/main arm64 libice6 arm64 2:1.0.10-1build2 [41.7 kB] 1484s Get:105 http://ftpmaster.internal/ubuntu noble/main arm64 libsm6 arm64 2:1.2.3-1build2 [16.1 kB] 1484s Get:106 http://ftpmaster.internal/ubuntu noble/main arm64 libxt6 arm64 1:1.2.1-1.1 [167 kB] 1484s Get:107 http://ftpmaster.internal/ubuntu noble/main arm64 libxmu6 arm64 2:1.1.3-3 [48.9 kB] 1484s Get:108 http://ftpmaster.internal/ubuntu noble/main arm64 libxaw7 arm64 2:1.0.14-1 [184 kB] 1484s Get:109 http://ftpmaster.internal/ubuntu noble/universe arm64 graphviz arm64 2.42.2-8build1 [613 kB] 1484s Get:110 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pydot all 1.4.2-2 [24.4 kB] 1484s Get:111 http://ftpmaster.internal/ubuntu noble/universe arm64 androguard all 3.4.0~a1-10 [36.7 MB] 1486s Get:112 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-args all 0.1.0-5 [6082 B] 1486s Get:113 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-clint all 0.5.1-4 [27.8 kB] 1486s Get:114 http://ftpmaster.internal/ubuntu noble/main arm64 python3-defusedxml all 0.7.1-2 [42.0 kB] 1486s Get:115 http://ftpmaster.internal/ubuntu noble/main arm64 liberror-perl all 0.17029-2 [25.6 kB] 1486s Get:116 http://ftpmaster.internal/ubuntu noble/main arm64 git-man all 1:2.43.0-1ubuntu1 [1100 kB] 1486s Get:117 http://ftpmaster.internal/ubuntu noble/main arm64 git arm64 1:2.43.0-1ubuntu1 [3786 kB] 1486s Get:118 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-smmap all 6.0.0-1 [20.5 kB] 1486s Get:119 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-gitdb all 4.0.11-1 [46.2 kB] 1486s Get:120 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-git all 3.1.37-3 [138 kB] 1486s Get:121 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-lockfile all 1:0.12.2-3 [13.7 kB] 1486s Get:122 http://ftpmaster.internal/ubuntu noble/main arm64 python3-simplejson arm64 3.19.2-1build1 [61.4 kB] 1486s Get:123 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-libcloud all 3.4.1-5 [751 kB] 1486s Get:124 http://ftpmaster.internal/ubuntu noble/main arm64 python3-bcrypt arm64 3.2.2-1 [28.8 kB] 1486s Get:125 http://ftpmaster.internal/ubuntu noble/main arm64 libsodium23 arm64 1.0.18-1build2 [123 kB] 1486s Get:126 http://ftpmaster.internal/ubuntu noble/main arm64 python3-nacl arm64 1.5.0-4 [55.5 kB] 1486s Get:127 http://ftpmaster.internal/ubuntu noble/main arm64 python3-paramiko all 2.12.0-2ubuntu4 [137 kB] 1486s Get:128 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1 all 0.4.8-4 [51.2 kB] 1486s Get:129 http://ftpmaster.internal/ubuntu noble/main arm64 python3-pyasn1-modules all 0.2.8-1 [68.0 kB] 1486s Get:130 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-png all 0.20231004.0-2 [30.2 kB] 1486s Get:131 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-qrcode all 7.4.2-4 [40.1 kB] 1486s Get:132 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml.clib arm64 0.2.8-1 [187 kB] 1486s Get:133 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-ruamel.yaml all 0.17.21-1 [86.6 kB] 1486s Get:134 http://ftpmaster.internal/ubuntu noble/universe arm64 python3-pathspec all 0.12.1-1 [24.5 kB] 1486s Get:135 http://ftpmaster.internal/ubuntu noble/universe arm64 yamllint all 1.33.0-1 [47.2 kB] 1486s Get:136 http://ftpmaster.internal/ubuntu noble/main arm64 ca-certificates-java all 20240118 [11.6 kB] 1486s Get:137 http://ftpmaster.internal/ubuntu noble/main arm64 java-common all 0.75+exp1 [6798 B] 1486s Get:138 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common-data arm64 0.8-13ubuntu2 [29.5 kB] 1486s Get:139 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-common3 arm64 0.8-13ubuntu2 [23.2 kB] 1486s Get:140 http://ftpmaster.internal/ubuntu noble/main arm64 libavahi-client3 arm64 0.8-13ubuntu2 [27.3 kB] 1486s Get:141 http://ftpmaster.internal/ubuntu noble/main arm64 libcups2 arm64 2.4.6-0ubuntu3 [270 kB] 1486s Get:142 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2-data all 1.2.10-3build1 [20.7 kB] 1486s Get:143 http://ftpmaster.internal/ubuntu noble/main arm64 libasound2 arm64 1.2.10-3build1 [386 kB] 1486s Get:144 http://ftpmaster.internal/ubuntu noble/main arm64 libpcsclite1 arm64 2.0.0-1 [21.2 kB] 1486s Get:145 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre-headless arm64 21.0.2+13-2 [45.8 MB] 1488s Get:146 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre-headless arm64 2:1.21-75+exp1 [3096 B] 1488s Get:147 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-common all 2.24.33-2ubuntu2 [125 kB] 1488s Get:148 http://ftpmaster.internal/ubuntu noble/main arm64 at-spi2-common all 2.50.0-1 [7864 B] 1488s Get:149 http://ftpmaster.internal/ubuntu noble/main arm64 libatk1.0-0 arm64 2.50.0-1 [53.8 kB] 1488s Get:150 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf2.0-common all 2.42.10+dfsg-3 [7624 B] 1488s Get:151 http://ftpmaster.internal/ubuntu noble/main arm64 libgdk-pixbuf-2.0-0 arm64 2.42.10+dfsg-3 [144 kB] 1488s Get:152 http://ftpmaster.internal/ubuntu noble/main arm64 libxcomposite1 arm64 1:0.4.5-1build2 [7080 B] 1488s Get:153 http://ftpmaster.internal/ubuntu noble/main arm64 libxfixes3 arm64 1:6.0.0-2 [11.0 kB] 1488s Get:154 http://ftpmaster.internal/ubuntu noble/main arm64 libxcursor1 arm64 1:1.2.1-1 [21.3 kB] 1488s Get:155 http://ftpmaster.internal/ubuntu noble/main arm64 libxdamage1 arm64 1:1.1.6-1 [6032 B] 1488s Get:156 http://ftpmaster.internal/ubuntu noble/main arm64 libxi6 arm64 2:1.8.1-1 [31.9 kB] 1488s Get:157 http://ftpmaster.internal/ubuntu noble/main arm64 libxinerama1 arm64 2:1.1.4-3 [7056 B] 1488s Get:158 http://ftpmaster.internal/ubuntu noble/main arm64 libxrandr2 arm64 2:1.5.2-2 [19.6 kB] 1488s Get:159 http://ftpmaster.internal/ubuntu noble/main arm64 gtk-update-icon-cache arm64 3.24.40-2ubuntu1 [50.5 kB] 1488s Get:160 http://ftpmaster.internal/ubuntu noble/main arm64 hicolor-icon-theme all 0.17-2 [9976 B] 1488s Get:161 http://ftpmaster.internal/ubuntu noble/main arm64 humanity-icon-theme all 0.6.16 [1282 kB] 1488s Get:162 http://ftpmaster.internal/ubuntu noble/main arm64 ubuntu-mono all 20.10-0ubuntu2 [153 kB] 1488s Get:163 http://ftpmaster.internal/ubuntu noble/main arm64 adwaita-icon-theme all 46~rc-1 [723 kB] 1488s Get:164 http://ftpmaster.internal/ubuntu noble/main arm64 libgtk2.0-0 arm64 2.24.33-2ubuntu2 [1981 kB] 1488s Get:165 http://ftpmaster.internal/ubuntu noble/main arm64 libglvnd0 arm64 1.7.0-1 [60.0 kB] 1488s Get:166 http://ftpmaster.internal/ubuntu noble/main arm64 libglapi-mesa arm64 24.0.1-1ubuntu1 [57.8 kB] 1488s Get:167 http://ftpmaster.internal/ubuntu noble/main arm64 libx11-xcb1 arm64 2:1.8.7-1 [7836 B] 1488s Get:168 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri2-0 arm64 1.15-1 [7244 B] 1488s Get:169 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-dri3-0 arm64 1.15-1 [7108 B] 1488s Get:170 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-glx0 arm64 1.15-1 [25.2 kB] 1488s Get:171 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-present0 arm64 1.15-1 [5732 B] 1488s Get:172 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-randr0 arm64 1.15-1 [18.2 kB] 1488s Get:173 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-sync1 arm64 1.15-1 [9412 B] 1488s Get:174 http://ftpmaster.internal/ubuntu noble/main arm64 libxcb-xfixes0 arm64 1.15-1 [10.3 kB] 1488s Get:175 http://ftpmaster.internal/ubuntu noble/main arm64 libxshmfence1 arm64 1.3-1build4 [5444 B] 1488s Get:176 http://ftpmaster.internal/ubuntu noble/main arm64 libxxf86vm1 arm64 1:1.1.4-1build3 [10.3 kB] 1488s Get:177 http://ftpmaster.internal/ubuntu noble/main arm64 libvulkan1 arm64 1.3.275.0-1 [150 kB] 1488s Get:178 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-amdgpu1 arm64 2.4.120-2 [20.4 kB] 1488s Get:179 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-nouveau2 arm64 2.4.120-2 [17.8 kB] 1488s Get:180 http://ftpmaster.internal/ubuntu noble/main arm64 libdrm-radeon1 arm64 2.4.120-2 [20.9 kB] 1488s Get:181 http://ftpmaster.internal/ubuntu noble/main arm64 libllvm17 arm64 1:17.0.6-5build1 [25.0 MB] 1489s Get:182 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1-mesa-dri arm64 24.0.1-1ubuntu1 [8226 kB] 1489s Get:183 http://ftpmaster.internal/ubuntu noble/main arm64 libglx-mesa0 arm64 24.0.1-1ubuntu1 [166 kB] 1489s Get:184 http://ftpmaster.internal/ubuntu noble/main arm64 libglx0 arm64 1.7.0-1 [32.4 kB] 1489s Get:185 http://ftpmaster.internal/ubuntu noble/main arm64 libgl1 arm64 1.7.0-1 [107 kB] 1489s Get:186 http://ftpmaster.internal/ubuntu noble/main arm64 libgif7 arm64 5.2.1-2.5 [34.2 kB] 1489s Get:187 http://ftpmaster.internal/ubuntu noble/main arm64 libxtst6 arm64 2:1.2.3-1.1 [13.7 kB] 1489s Get:188 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jre arm64 21.0.2+13-2 [226 kB] 1489s Get:189 http://ftpmaster.internal/ubuntu noble/main arm64 default-jre arm64 2:1.21-75+exp1 [922 B] 1489s Get:190 http://ftpmaster.internal/ubuntu noble/universe arm64 libapksig-java all 31.0.2-1 [402 kB] 1489s Get:191 http://ftpmaster.internal/ubuntu noble/universe arm64 apksigner all 31.0.2-1 [438 kB] 1489s Get:192 http://ftpmaster.internal/ubuntu noble/main arm64 openjdk-21-jdk-headless arm64 21.0.2+13-2 [81.6 MB] 1492s Get:193 http://ftpmaster.internal/ubuntu noble/main arm64 default-jdk-headless arm64 2:1.21-75+exp1 [960 B] 1492s Get:194 http://ftpmaster.internal/ubuntu noble/universe arm64 fdroidserver all 2.2.1-2 [362 kB] 1496s Fetched 283 MB in 12s (22.7 MB/s) 1496s Selecting previously unselected package python3-asn1crypto. 1496s (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 75420 files and directories currently installed.) 1496s Preparing to unpack .../000-python3-asn1crypto_1.5.1-3_all.deb ... 1496s Unpacking python3-asn1crypto (1.5.1-3) ... 1496s Selecting previously unselected package python3-colorama. 1496s Preparing to unpack .../001-python3-colorama_0.4.6-4_all.deb ... 1496s Unpacking python3-colorama (0.4.6-4) ... 1496s Selecting previously unselected package python3-click. 1496s Preparing to unpack .../002-python3-click_8.1.6-1_all.deb ... 1496s Unpacking python3-click (8.1.6-1) ... 1496s Selecting previously unselected package python3-decorator. 1496s Preparing to unpack .../003-python3-decorator_5.1.1-5_all.deb ... 1496s Unpacking python3-decorator (5.1.1-5) ... 1496s Selecting previously unselected package python3-parso. 1497s Preparing to unpack .../004-python3-parso_0.8.3-1_all.deb ... 1497s Unpacking python3-parso (0.8.3-1) ... 1497s Selecting previously unselected package python3-jedi. 1497s Preparing to unpack .../005-python3-jedi_0.18.2-1ubuntu1_all.deb ... 1497s Unpacking python3-jedi (0.18.2-1ubuntu1) ... 1497s Selecting previously unselected package python3-traitlets. 1497s Preparing to unpack .../006-python3-traitlets_5.5.0-2_all.deb ... 1497s Unpacking python3-traitlets (5.5.0-2) ... 1497s Selecting previously unselected package python3-matplotlib-inline. 1497s Preparing to unpack .../007-python3-matplotlib-inline_0.1.6-2_all.deb ... 1497s Unpacking python3-matplotlib-inline (0.1.6-2) ... 1497s Selecting previously unselected package python3-ptyprocess. 1497s Preparing to unpack .../008-python3-ptyprocess_0.7.0-5_all.deb ... 1498s Unpacking python3-ptyprocess (0.7.0-5) ... 1498s Selecting previously unselected package python3-pexpect. 1498s Preparing to unpack .../009-python3-pexpect_4.9-2_all.deb ... 1498s Unpacking python3-pexpect (4.9-2) ... 1498s Selecting previously unselected package python3-wcwidth. 1498s Preparing to unpack .../010-python3-wcwidth_0.2.5+dfsg1-1.1ubuntu1_all.deb ... 1498s Unpacking python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ... 1498s Selecting previously unselected package python3-prompt-toolkit. 1498s Preparing to unpack .../011-python3-prompt-toolkit_3.0.43-1_all.deb ... 1498s Unpacking python3-prompt-toolkit (3.0.43-1) ... 1498s Selecting previously unselected package python3-asttokens. 1498s Preparing to unpack .../012-python3-asttokens_2.4.1-1_all.deb ... 1498s Unpacking python3-asttokens (2.4.1-1) ... 1498s Selecting previously unselected package python3-executing. 1498s Preparing to unpack .../013-python3-executing_2.0.1-0.1_all.deb ... 1498s Unpacking python3-executing (2.0.1-0.1) ... 1498s Selecting previously unselected package python3-pure-eval. 1498s Preparing to unpack .../014-python3-pure-eval_0.2.2-1_all.deb ... 1498s Unpacking python3-pure-eval (0.2.2-1) ... 1498s Selecting previously unselected package python3-stack-data. 1498s Preparing to unpack .../015-python3-stack-data_0.6.3-1_all.deb ... 1498s Unpacking python3-stack-data (0.6.3-1) ... 1498s Selecting previously unselected package python3-ipython. 1498s Preparing to unpack .../016-python3-ipython_8.20.0-1_all.deb ... 1498s Unpacking python3-ipython (8.20.0-1) ... 1498s Selecting previously unselected package libxslt1.1:arm64. 1498s Preparing to unpack .../017-libxslt1.1_1.1.35-1_arm64.deb ... 1498s Unpacking libxslt1.1:arm64 (1.1.35-1) ... 1498s Selecting previously unselected package python3-lxml:arm64. 1498s Preparing to unpack .../018-python3-lxml_5.1.0-1_arm64.deb ... 1498s Unpacking python3-lxml:arm64 (5.1.0-1) ... 1498s Selecting previously unselected package python3-magic. 1498s Preparing to unpack .../019-python3-magic_2%3a0.4.27-2_all.deb ... 1498s Unpacking python3-magic (2:0.4.27-2) ... 1499s Selecting previously unselected package libjs-jquery. 1499s Preparing to unpack .../020-libjs-jquery_3.6.1+dfsg+~3.5.14-1_all.deb ... 1499s Unpacking libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 1499s Selecting previously unselected package libjs-jquery-ui. 1499s Preparing to unpack .../021-libjs-jquery-ui_1.13.2+dfsg-1_all.deb ... 1499s Unpacking libjs-jquery-ui (1.13.2+dfsg-1) ... 1499s Selecting previously unselected package fonts-dejavu-mono. 1499s Preparing to unpack .../022-fonts-dejavu-mono_2.37-8_all.deb ... 1499s Unpacking fonts-dejavu-mono (2.37-8) ... 1499s Selecting previously unselected package fonts-dejavu-core. 1499s Preparing to unpack .../023-fonts-dejavu-core_2.37-8_all.deb ... 1499s Unpacking fonts-dejavu-core (2.37-8) ... 1499s Selecting previously unselected package fonts-lyx. 1499s Preparing to unpack .../024-fonts-lyx_2.4.0~RC3-1_all.deb ... 1499s Unpacking fonts-lyx (2.4.0~RC3-1) ... 1499s Selecting previously unselected package python-matplotlib-data. 1499s Preparing to unpack .../025-python-matplotlib-data_3.6.3-1ubuntu3_all.deb ... 1499s Unpacking python-matplotlib-data (3.6.3-1ubuntu3) ... 1499s Selecting previously unselected package python3-dateutil. 1499s Preparing to unpack .../026-python3-dateutil_2.8.2-3_all.deb ... 1499s Unpacking python3-dateutil (2.8.2-3) ... 1499s Selecting previously unselected package libgomp1:arm64. 1499s Preparing to unpack .../027-libgomp1_14-20240303-1ubuntu1_arm64.deb ... 1499s Unpacking libgomp1:arm64 (14-20240303-1ubuntu1) ... 1499s Selecting previously unselected package libimagequant0:arm64. 1499s Preparing to unpack .../028-libimagequant0_2.18.0-1_arm64.deb ... 1499s Unpacking libimagequant0:arm64 (2.18.0-1) ... 1500s Selecting previously unselected package libjpeg-turbo8:arm64. 1500s Preparing to unpack .../029-libjpeg-turbo8_2.1.5-2ubuntu1_arm64.deb ... 1500s Unpacking libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ... 1500s Selecting previously unselected package libjpeg8:arm64. 1500s Preparing to unpack .../030-libjpeg8_8c-2ubuntu11_arm64.deb ... 1500s Unpacking libjpeg8:arm64 (8c-2ubuntu11) ... 1500s Selecting previously unselected package liblcms2-2:arm64. 1500s Preparing to unpack .../031-liblcms2-2_2.14-2_arm64.deb ... 1500s Unpacking liblcms2-2:arm64 (2.14-2) ... 1500s Selecting previously unselected package libopenjp2-7:arm64. 1500s Preparing to unpack .../032-libopenjp2-7_2.5.0-2_arm64.deb ... 1500s Unpacking libopenjp2-7:arm64 (2.5.0-2) ... 1500s Selecting previously unselected package libgraphite2-3:arm64. 1500s Preparing to unpack .../033-libgraphite2-3_1.3.14-2_arm64.deb ... 1500s Unpacking libgraphite2-3:arm64 (1.3.14-2) ... 1500s Selecting previously unselected package libharfbuzz0b:arm64. 1500s Preparing to unpack .../034-libharfbuzz0b_8.3.0-2_arm64.deb ... 1500s Unpacking libharfbuzz0b:arm64 (8.3.0-2) ... 1500s Selecting previously unselected package libraqm0:arm64. 1500s Preparing to unpack .../035-libraqm0_0.10.1-1_arm64.deb ... 1500s Unpacking libraqm0:arm64 (0.10.1-1) ... 1500s Selecting previously unselected package libdeflate0:arm64. 1500s Preparing to unpack .../036-libdeflate0_1.19-1_arm64.deb ... 1500s Unpacking libdeflate0:arm64 (1.19-1) ... 1500s Selecting previously unselected package libjbig0:arm64. 1500s Preparing to unpack .../037-libjbig0_2.1-6.1ubuntu1_arm64.deb ... 1500s Unpacking libjbig0:arm64 (2.1-6.1ubuntu1) ... 1500s Selecting previously unselected package liblerc4:arm64. 1500s Preparing to unpack .../038-liblerc4_4.0.0+ds-4ubuntu1_arm64.deb ... 1500s Unpacking liblerc4:arm64 (4.0.0+ds-4ubuntu1) ... 1500s Selecting previously unselected package libsharpyuv0:arm64. 1500s Preparing to unpack .../039-libsharpyuv0_1.3.2-0.4_arm64.deb ... 1500s Unpacking libsharpyuv0:arm64 (1.3.2-0.4) ... 1500s Selecting previously unselected package libwebp7:arm64. 1500s Preparing to unpack .../040-libwebp7_1.3.2-0.4_arm64.deb ... 1500s Unpacking libwebp7:arm64 (1.3.2-0.4) ... 1500s Selecting previously unselected package libtiff6:arm64. 1500s Preparing to unpack .../041-libtiff6_4.5.1+git230720-3ubuntu1_arm64.deb ... 1500s Unpacking libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ... 1500s Selecting previously unselected package libwebpdemux2:arm64. 1500s Preparing to unpack .../042-libwebpdemux2_1.3.2-0.4_arm64.deb ... 1500s Unpacking libwebpdemux2:arm64 (1.3.2-0.4) ... 1500s Selecting previously unselected package libwebpmux3:arm64. 1500s Preparing to unpack .../043-libwebpmux3_1.3.2-0.4_arm64.deb ... 1500s Unpacking libwebpmux3:arm64 (1.3.2-0.4) ... 1501s Selecting previously unselected package python3-pil:arm64. 1501s Preparing to unpack .../044-python3-pil_10.2.0-1_arm64.deb ... 1501s Unpacking python3-pil:arm64 (10.2.0-1) ... 1501s Selecting previously unselected package libtcl8.6:arm64. 1501s Preparing to unpack .../045-libtcl8.6_8.6.13+dfsg-2_arm64.deb ... 1501s Unpacking libtcl8.6:arm64 (8.6.13+dfsg-2) ... 1501s Selecting previously unselected package fontconfig-config. 1501s Preparing to unpack .../046-fontconfig-config_2.15.0-1ubuntu1_arm64.deb ... 1501s Unpacking fontconfig-config (2.15.0-1ubuntu1) ... 1501s Selecting previously unselected package libfontconfig1:arm64. 1501s Preparing to unpack .../047-libfontconfig1_2.15.0-1ubuntu1_arm64.deb ... 1501s Unpacking libfontconfig1:arm64 (2.15.0-1ubuntu1) ... 1501s Selecting previously unselected package libxrender1:arm64. 1501s Preparing to unpack .../048-libxrender1_1%3a0.9.10-1.1_arm64.deb ... 1501s Unpacking libxrender1:arm64 (1:0.9.10-1.1) ... 1502s Selecting previously unselected package libxft2:arm64. 1502s Preparing to unpack .../049-libxft2_2.3.6-1_arm64.deb ... 1502s Unpacking libxft2:arm64 (2.3.6-1) ... 1502s Selecting previously unselected package x11-common. 1502s Preparing to unpack .../050-x11-common_1%3a7.7+23ubuntu2_all.deb ... 1502s Unpacking x11-common (1:7.7+23ubuntu2) ... 1502s Selecting previously unselected package libxss1:arm64. 1502s Preparing to unpack .../051-libxss1_1%3a1.2.3-1build2_arm64.deb ... 1502s Unpacking libxss1:arm64 (1:1.2.3-1build2) ... 1502s Selecting previously unselected package libtk8.6:arm64. 1502s Preparing to unpack .../052-libtk8.6_8.6.13-2_arm64.deb ... 1502s Unpacking libtk8.6:arm64 (8.6.13-2) ... 1502s Selecting previously unselected package tk8.6-blt2.5. 1502s Preparing to unpack .../053-tk8.6-blt2.5_2.5.3+dfsg-7_arm64.deb ... 1502s Unpacking tk8.6-blt2.5 (2.5.3+dfsg-7) ... 1502s Selecting previously unselected package blt. 1502s Preparing to unpack .../054-blt_2.5.3+dfsg-7_arm64.deb ... 1502s Unpacking blt (2.5.3+dfsg-7) ... 1502s Selecting previously unselected package python3-tk:arm64. 1502s Preparing to unpack .../055-python3-tk_3.11.5-1_arm64.deb ... 1502s Unpacking python3-tk:arm64 (3.11.5-1) ... 1502s Selecting previously unselected package python3-pil.imagetk:arm64. 1502s Preparing to unpack .../056-python3-pil.imagetk_10.2.0-1_arm64.deb ... 1502s Unpacking python3-pil.imagetk:arm64 (10.2.0-1) ... 1502s Selecting previously unselected package libblas3:arm64. 1502s Preparing to unpack .../057-libblas3_3.12.0-3_arm64.deb ... 1502s Unpacking libblas3:arm64 (3.12.0-3) ... 1502s Selecting previously unselected package libgfortran5:arm64. 1502s Preparing to unpack .../058-libgfortran5_14-20240303-1ubuntu1_arm64.deb ... 1502s Unpacking libgfortran5:arm64 (14-20240303-1ubuntu1) ... 1502s Selecting previously unselected package liblapack3:arm64. 1502s Preparing to unpack .../059-liblapack3_3.12.0-3_arm64.deb ... 1502s Unpacking liblapack3:arm64 (3.12.0-3) ... 1502s Selecting previously unselected package python3-numpy. 1502s Preparing to unpack .../060-python3-numpy_1%3a1.24.2-2_arm64.deb ... 1502s Unpacking python3-numpy (1:1.24.2-2) ... 1503s Selecting previously unselected package python3-contourpy. 1503s Preparing to unpack .../061-python3-contourpy_1.0.7-1build2_arm64.deb ... 1503s Unpacking python3-contourpy (1.0.7-1build2) ... 1503s Selecting previously unselected package python3-cycler. 1503s Preparing to unpack .../062-python3-cycler_0.11.0-2_all.deb ... 1503s Unpacking python3-cycler (0.11.0-2) ... 1503s Selecting previously unselected package python3-brotli. 1503s Preparing to unpack .../063-python3-brotli_1.1.0-2_arm64.deb ... 1503s Unpacking python3-brotli (1.1.0-2) ... 1503s Selecting previously unselected package liblbfgsb0:arm64. 1503s Preparing to unpack .../064-liblbfgsb0_3.0+dfsg.4-1_arm64.deb ... 1503s Unpacking liblbfgsb0:arm64 (3.0+dfsg.4-1) ... 1503s Selecting previously unselected package python3-scipy. 1503s Preparing to unpack .../065-python3-scipy_1.11.4-6_arm64.deb ... 1503s Unpacking python3-scipy (1.11.4-6) ... 1505s Selecting previously unselected package python3-ufolib2. 1505s Preparing to unpack .../066-python3-ufolib2_0.16.0+dfsg1-1_all.deb ... 1505s Unpacking python3-ufolib2 (0.16.0+dfsg1-1) ... 1505s Selecting previously unselected package python3-mpmath. 1505s Preparing to unpack .../067-python3-mpmath_1.2.1-3_all.deb ... 1505s Unpacking python3-mpmath (1.2.1-3) ... 1505s Selecting previously unselected package python3-sympy. 1505s Preparing to unpack .../068-python3-sympy_1.12-7_all.deb ... 1505s Unpacking python3-sympy (1.12-7) ... 1506s Selecting previously unselected package python3-appdirs. 1506s Preparing to unpack .../069-python3-appdirs_1.4.4-4_all.deb ... 1506s Unpacking python3-appdirs (1.4.4-4) ... 1506s Selecting previously unselected package python3-fs. 1507s Preparing to unpack .../070-python3-fs_2.4.16-3_all.deb ... 1507s Unpacking python3-fs (2.4.16-3) ... 1507s Selecting previously unselected package python3-lz4. 1507s Preparing to unpack .../071-python3-lz4_4.0.2+dfsg-1build2_arm64.deb ... 1507s Unpacking python3-lz4 (4.0.2+dfsg-1build2) ... 1507s Selecting previously unselected package python3-unicodedata2. 1507s Preparing to unpack .../072-python3-unicodedata2_15.1.0+ds-1_arm64.deb ... 1507s Unpacking python3-unicodedata2 (15.1.0+ds-1) ... 1507s Selecting previously unselected package unicode-data. 1507s Preparing to unpack .../073-unicode-data_15.1.0-1_all.deb ... 1507s Unpacking unicode-data (15.1.0-1) ... 1507s Selecting previously unselected package python3-fonttools. 1507s Preparing to unpack .../074-python3-fonttools_4.46.0-1_arm64.deb ... 1507s Unpacking python3-fonttools (4.46.0-1) ... 1508s Selecting previously unselected package python3-kiwisolver. 1508s Preparing to unpack .../075-python3-kiwisolver_1.4.4-1build2_arm64.deb ... 1508s Unpacking python3-kiwisolver (1.4.4-1build2) ... 1508s Selecting previously unselected package python3-packaging. 1508s Preparing to unpack .../076-python3-packaging_23.2-1_all.deb ... 1508s Unpacking python3-packaging (23.2-1) ... 1508s Selecting previously unselected package libqhull-r8.0:arm64. 1508s Preparing to unpack .../077-libqhull-r8.0_2020.2-6_arm64.deb ... 1508s Unpacking libqhull-r8.0:arm64 (2020.2-6) ... 1508s Selecting previously unselected package python3-matplotlib. 1508s Preparing to unpack .../078-python3-matplotlib_3.6.3-1ubuntu3_arm64.deb ... 1508s Unpacking python3-matplotlib (3.6.3-1ubuntu3) ... 1509s Selecting previously unselected package python3-networkx. 1509s Preparing to unpack .../079-python3-networkx_2.8.8-1ubuntu1_all.deb ... 1509s Unpacking python3-networkx (2.8.8-1ubuntu1) ... 1509s Selecting previously unselected package python3-oscrypto. 1509s Preparing to unpack .../080-python3-oscrypto_1.3.0-5_all.deb ... 1509s Unpacking python3-oscrypto (1.3.0-5) ... 1509s Selecting previously unselected package libann0. 1509s Preparing to unpack .../081-libann0_1.1.2+doc-9_arm64.deb ... 1509s Unpacking libann0 (1.1.2+doc-9) ... 1509s Selecting previously unselected package libcdt5:arm64. 1509s Preparing to unpack .../082-libcdt5_2.42.2-8build1_arm64.deb ... 1509s Unpacking libcdt5:arm64 (2.42.2-8build1) ... 1509s Selecting previously unselected package libcgraph6:arm64. 1509s Preparing to unpack .../083-libcgraph6_2.42.2-8build1_arm64.deb ... 1509s Unpacking libcgraph6:arm64 (2.42.2-8build1) ... 1509s Selecting previously unselected package libxpm4:arm64. 1509s Preparing to unpack .../084-libxpm4_1%3a3.5.17-1_arm64.deb ... 1509s Unpacking libxpm4:arm64 (1:3.5.17-1) ... 1509s Selecting previously unselected package libgd3:arm64. 1509s Preparing to unpack .../085-libgd3_2.3.3-9ubuntu1_arm64.deb ... 1509s Unpacking libgd3:arm64 (2.3.3-9ubuntu1) ... 1509s Selecting previously unselected package libgts-0.7-5:arm64. 1509s Preparing to unpack .../086-libgts-0.7-5_0.7.6+darcs121130-5_arm64.deb ... 1509s Unpacking libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ... 1509s Selecting previously unselected package libpixman-1-0:arm64. 1509s Preparing to unpack .../087-libpixman-1-0_0.42.2-1_arm64.deb ... 1509s Unpacking libpixman-1-0:arm64 (0.42.2-1) ... 1509s Selecting previously unselected package libxcb-render0:arm64. 1509s Preparing to unpack .../088-libxcb-render0_1.15-1_arm64.deb ... 1509s Unpacking libxcb-render0:arm64 (1.15-1) ... 1509s Selecting previously unselected package libxcb-shm0:arm64. 1510s Preparing to unpack .../089-libxcb-shm0_1.15-1_arm64.deb ... 1510s Unpacking libxcb-shm0:arm64 (1.15-1) ... 1510s Selecting previously unselected package libcairo2:arm64. 1510s Preparing to unpack .../090-libcairo2_1.18.0-1_arm64.deb ... 1510s Unpacking libcairo2:arm64 (1.18.0-1) ... 1510s Selecting previously unselected package libltdl7:arm64. 1510s Preparing to unpack .../091-libltdl7_2.4.7-7_arm64.deb ... 1510s Unpacking libltdl7:arm64 (2.4.7-7) ... 1510s Selecting previously unselected package fontconfig. 1510s Preparing to unpack .../092-fontconfig_2.15.0-1ubuntu1_arm64.deb ... 1510s Unpacking fontconfig (2.15.0-1ubuntu1) ... 1510s Selecting previously unselected package libthai-data. 1510s Preparing to unpack .../093-libthai-data_0.1.29-2_all.deb ... 1510s Unpacking libthai-data (0.1.29-2) ... 1510s Selecting previously unselected package libdatrie1:arm64. 1510s Preparing to unpack .../094-libdatrie1_0.2.13-3_arm64.deb ... 1510s Unpacking libdatrie1:arm64 (0.2.13-3) ... 1510s Selecting previously unselected package libthai0:arm64. 1510s Preparing to unpack .../095-libthai0_0.1.29-2_arm64.deb ... 1510s Unpacking libthai0:arm64 (0.1.29-2) ... 1510s Selecting previously unselected package libpango-1.0-0:arm64. 1510s Preparing to unpack .../096-libpango-1.0-0_1.51.0+ds-4_arm64.deb ... 1510s Unpacking libpango-1.0-0:arm64 (1.51.0+ds-4) ... 1510s Selecting previously unselected package libpangoft2-1.0-0:arm64. 1510s Preparing to unpack .../097-libpangoft2-1.0-0_1.51.0+ds-4_arm64.deb ... 1510s Unpacking libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ... 1510s Selecting previously unselected package libpangocairo-1.0-0:arm64. 1510s Preparing to unpack .../098-libpangocairo-1.0-0_1.51.0+ds-4_arm64.deb ... 1510s Unpacking libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ... 1510s Selecting previously unselected package libpathplan4:arm64. 1510s Preparing to unpack .../099-libpathplan4_2.42.2-8build1_arm64.deb ... 1510s Unpacking libpathplan4:arm64 (2.42.2-8build1) ... 1510s Selecting previously unselected package libgvc6. 1510s Preparing to unpack .../100-libgvc6_2.42.2-8build1_arm64.deb ... 1510s Unpacking libgvc6 (2.42.2-8build1) ... 1510s Selecting previously unselected package libgvpr2:arm64. 1510s Preparing to unpack .../101-libgvpr2_2.42.2-8build1_arm64.deb ... 1510s Unpacking libgvpr2:arm64 (2.42.2-8build1) ... 1510s Selecting previously unselected package liblab-gamut1:arm64. 1510s Preparing to unpack .../102-liblab-gamut1_2.42.2-8build1_arm64.deb ... 1510s Unpacking liblab-gamut1:arm64 (2.42.2-8build1) ... 1511s Selecting previously unselected package libice6:arm64. 1511s Preparing to unpack .../103-libice6_2%3a1.0.10-1build2_arm64.deb ... 1511s Unpacking libice6:arm64 (2:1.0.10-1build2) ... 1511s Selecting previously unselected package libsm6:arm64. 1511s Preparing to unpack .../104-libsm6_2%3a1.2.3-1build2_arm64.deb ... 1511s Unpacking libsm6:arm64 (2:1.2.3-1build2) ... 1511s Selecting previously unselected package libxt6:arm64. 1511s Preparing to unpack .../105-libxt6_1%3a1.2.1-1.1_arm64.deb ... 1511s Unpacking libxt6:arm64 (1:1.2.1-1.1) ... 1511s Selecting previously unselected package libxmu6:arm64. 1511s Preparing to unpack .../106-libxmu6_2%3a1.1.3-3_arm64.deb ... 1511s Unpacking libxmu6:arm64 (2:1.1.3-3) ... 1511s Selecting previously unselected package libxaw7:arm64. 1511s Preparing to unpack .../107-libxaw7_2%3a1.0.14-1_arm64.deb ... 1511s Unpacking libxaw7:arm64 (2:1.0.14-1) ... 1511s Selecting previously unselected package graphviz. 1511s Preparing to unpack .../108-graphviz_2.42.2-8build1_arm64.deb ... 1511s Unpacking graphviz (2.42.2-8build1) ... 1511s Selecting previously unselected package python3-pydot. 1511s Preparing to unpack .../109-python3-pydot_1.4.2-2_all.deb ... 1511s Unpacking python3-pydot (1.4.2-2) ... 1511s Selecting previously unselected package androguard. 1511s Preparing to unpack .../110-androguard_3.4.0~a1-10_all.deb ... 1511s Unpacking androguard (3.4.0~a1-10) ... 1512s Selecting previously unselected package python3-args. 1512s Preparing to unpack .../111-python3-args_0.1.0-5_all.deb ... 1512s Unpacking python3-args (0.1.0-5) ... 1512s Selecting previously unselected package python3-clint. 1512s Preparing to unpack .../112-python3-clint_0.5.1-4_all.deb ... 1512s Unpacking python3-clint (0.5.1-4) ... 1512s Selecting previously unselected package python3-defusedxml. 1512s Preparing to unpack .../113-python3-defusedxml_0.7.1-2_all.deb ... 1512s Unpacking python3-defusedxml (0.7.1-2) ... 1513s Selecting previously unselected package liberror-perl. 1513s Preparing to unpack .../114-liberror-perl_0.17029-2_all.deb ... 1513s Unpacking liberror-perl (0.17029-2) ... 1513s Selecting previously unselected package git-man. 1513s Preparing to unpack .../115-git-man_1%3a2.43.0-1ubuntu1_all.deb ... 1513s Unpacking git-man (1:2.43.0-1ubuntu1) ... 1513s Selecting previously unselected package git. 1513s Preparing to unpack .../116-git_1%3a2.43.0-1ubuntu1_arm64.deb ... 1513s Unpacking git (1:2.43.0-1ubuntu1) ... 1513s Selecting previously unselected package python3-smmap. 1513s Preparing to unpack .../117-python3-smmap_6.0.0-1_all.deb ... 1513s Unpacking python3-smmap (6.0.0-1) ... 1514s Selecting previously unselected package python3-gitdb. 1514s Preparing to unpack .../118-python3-gitdb_4.0.11-1_all.deb ... 1514s Unpacking python3-gitdb (4.0.11-1) ... 1514s Selecting previously unselected package python3-git. 1514s Preparing to unpack .../119-python3-git_3.1.37-3_all.deb ... 1514s Unpacking python3-git (3.1.37-3) ... 1514s Selecting previously unselected package python3-lockfile. 1514s Preparing to unpack .../120-python3-lockfile_1%3a0.12.2-3_all.deb ... 1514s Unpacking python3-lockfile (1:0.12.2-3) ... 1514s Selecting previously unselected package python3-simplejson. 1514s Preparing to unpack .../121-python3-simplejson_3.19.2-1build1_arm64.deb ... 1514s Unpacking python3-simplejson (3.19.2-1build1) ... 1514s Selecting previously unselected package python3-libcloud. 1514s Preparing to unpack .../122-python3-libcloud_3.4.1-5_all.deb ... 1514s Unpacking python3-libcloud (3.4.1-5) ... 1514s Selecting previously unselected package python3-bcrypt. 1514s Preparing to unpack .../123-python3-bcrypt_3.2.2-1_arm64.deb ... 1514s Unpacking python3-bcrypt (3.2.2-1) ... 1514s Selecting previously unselected package libsodium23:arm64. 1514s Preparing to unpack .../124-libsodium23_1.0.18-1build2_arm64.deb ... 1514s Unpacking libsodium23:arm64 (1.0.18-1build2) ... 1514s Selecting previously unselected package python3-nacl. 1514s Preparing to unpack .../125-python3-nacl_1.5.0-4_arm64.deb ... 1514s Unpacking python3-nacl (1.5.0-4) ... 1514s Selecting previously unselected package python3-paramiko. 1514s Preparing to unpack .../126-python3-paramiko_2.12.0-2ubuntu4_all.deb ... 1514s Unpacking python3-paramiko (2.12.0-2ubuntu4) ... 1514s Selecting previously unselected package python3-pyasn1. 1514s Preparing to unpack .../127-python3-pyasn1_0.4.8-4_all.deb ... 1514s Unpacking python3-pyasn1 (0.4.8-4) ... 1514s Selecting previously unselected package python3-pyasn1-modules. 1515s Preparing to unpack .../128-python3-pyasn1-modules_0.2.8-1_all.deb ... 1515s Unpacking python3-pyasn1-modules (0.2.8-1) ... 1515s Selecting previously unselected package python3-png. 1515s Preparing to unpack .../129-python3-png_0.20231004.0-2_all.deb ... 1515s Unpacking python3-png (0.20231004.0-2) ... 1515s Selecting previously unselected package python3-qrcode. 1515s Preparing to unpack .../130-python3-qrcode_7.4.2-4_all.deb ... 1515s Unpacking python3-qrcode (7.4.2-4) ... 1515s Selecting previously unselected package python3-ruamel.yaml.clib:arm64. 1515s Preparing to unpack .../131-python3-ruamel.yaml.clib_0.2.8-1_arm64.deb ... 1515s Unpacking python3-ruamel.yaml.clib:arm64 (0.2.8-1) ... 1515s Selecting previously unselected package python3-ruamel.yaml. 1515s Preparing to unpack .../132-python3-ruamel.yaml_0.17.21-1_all.deb ... 1515s Unpacking python3-ruamel.yaml (0.17.21-1) ... 1515s Selecting previously unselected package python3-pathspec. 1515s Preparing to unpack .../133-python3-pathspec_0.12.1-1_all.deb ... 1515s Unpacking python3-pathspec (0.12.1-1) ... 1515s Selecting previously unselected package yamllint. 1515s Preparing to unpack .../134-yamllint_1.33.0-1_all.deb ... 1515s Unpacking yamllint (1.33.0-1) ... 1515s Selecting previously unselected package ca-certificates-java. 1515s Preparing to unpack .../135-ca-certificates-java_20240118_all.deb ... 1515s Unpacking ca-certificates-java (20240118) ... 1515s Selecting previously unselected package java-common. 1515s Preparing to unpack .../136-java-common_0.75+exp1_all.deb ... 1515s Unpacking java-common (0.75+exp1) ... 1515s Selecting previously unselected package libavahi-common-data:arm64. 1515s Preparing to unpack .../137-libavahi-common-data_0.8-13ubuntu2_arm64.deb ... 1515s Unpacking libavahi-common-data:arm64 (0.8-13ubuntu2) ... 1515s Selecting previously unselected package libavahi-common3:arm64. 1515s Preparing to unpack .../138-libavahi-common3_0.8-13ubuntu2_arm64.deb ... 1515s Unpacking libavahi-common3:arm64 (0.8-13ubuntu2) ... 1515s Selecting previously unselected package libavahi-client3:arm64. 1515s Preparing to unpack .../139-libavahi-client3_0.8-13ubuntu2_arm64.deb ... 1515s Unpacking libavahi-client3:arm64 (0.8-13ubuntu2) ... 1516s Selecting previously unselected package libcups2:arm64. 1516s Preparing to unpack .../140-libcups2_2.4.6-0ubuntu3_arm64.deb ... 1516s Unpacking libcups2:arm64 (2.4.6-0ubuntu3) ... 1516s Selecting previously unselected package libasound2-data. 1516s Preparing to unpack .../141-libasound2-data_1.2.10-3build1_all.deb ... 1516s Unpacking libasound2-data (1.2.10-3build1) ... 1516s Selecting previously unselected package libasound2:arm64. 1516s Preparing to unpack .../142-libasound2_1.2.10-3build1_arm64.deb ... 1516s Unpacking libasound2:arm64 (1.2.10-3build1) ... 1516s Selecting previously unselected package libpcsclite1:arm64. 1516s Preparing to unpack .../143-libpcsclite1_2.0.0-1_arm64.deb ... 1516s Unpacking libpcsclite1:arm64 (2.0.0-1) ... 1516s Selecting previously unselected package openjdk-21-jre-headless:arm64. 1516s Preparing to unpack .../144-openjdk-21-jre-headless_21.0.2+13-2_arm64.deb ... 1516s Unpacking openjdk-21-jre-headless:arm64 (21.0.2+13-2) ... 1519s Selecting previously unselected package default-jre-headless. 1519s Preparing to unpack .../145-default-jre-headless_2%3a1.21-75+exp1_arm64.deb ... 1519s Unpacking default-jre-headless (2:1.21-75+exp1) ... 1519s Selecting previously unselected package libgtk2.0-common. 1519s Preparing to unpack .../146-libgtk2.0-common_2.24.33-2ubuntu2_all.deb ... 1519s Unpacking libgtk2.0-common (2.24.33-2ubuntu2) ... 1519s Selecting previously unselected package at-spi2-common. 1519s Preparing to unpack .../147-at-spi2-common_2.50.0-1_all.deb ... 1519s Unpacking at-spi2-common (2.50.0-1) ... 1519s Selecting previously unselected package libatk1.0-0:arm64. 1519s Preparing to unpack .../148-libatk1.0-0_2.50.0-1_arm64.deb ... 1519s Unpacking libatk1.0-0:arm64 (2.50.0-1) ... 1519s Selecting previously unselected package libgdk-pixbuf2.0-common. 1519s Preparing to unpack .../149-libgdk-pixbuf2.0-common_2.42.10+dfsg-3_all.deb ... 1519s Unpacking libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... 1519s Selecting previously unselected package libgdk-pixbuf-2.0-0:arm64. 1519s Preparing to unpack .../150-libgdk-pixbuf-2.0-0_2.42.10+dfsg-3_arm64.deb ... 1519s Unpacking libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ... 1519s Selecting previously unselected package libxcomposite1:arm64. 1519s Preparing to unpack .../151-libxcomposite1_1%3a0.4.5-1build2_arm64.deb ... 1519s Unpacking libxcomposite1:arm64 (1:0.4.5-1build2) ... 1519s Selecting previously unselected package libxfixes3:arm64. 1519s Preparing to unpack .../152-libxfixes3_1%3a6.0.0-2_arm64.deb ... 1519s Unpacking libxfixes3:arm64 (1:6.0.0-2) ... 1519s Selecting previously unselected package libxcursor1:arm64. 1519s Preparing to unpack .../153-libxcursor1_1%3a1.2.1-1_arm64.deb ... 1519s Unpacking libxcursor1:arm64 (1:1.2.1-1) ... 1519s Selecting previously unselected package libxdamage1:arm64. 1519s Preparing to unpack .../154-libxdamage1_1%3a1.1.6-1_arm64.deb ... 1519s Unpacking libxdamage1:arm64 (1:1.1.6-1) ... 1519s Selecting previously unselected package libxi6:arm64. 1519s Preparing to unpack .../155-libxi6_2%3a1.8.1-1_arm64.deb ... 1520s Unpacking libxi6:arm64 (2:1.8.1-1) ... 1520s Selecting previously unselected package libxinerama1:arm64. 1520s Preparing to unpack .../156-libxinerama1_2%3a1.1.4-3_arm64.deb ... 1520s Unpacking libxinerama1:arm64 (2:1.1.4-3) ... 1520s Selecting previously unselected package libxrandr2:arm64. 1520s Preparing to unpack .../157-libxrandr2_2%3a1.5.2-2_arm64.deb ... 1520s Unpacking libxrandr2:arm64 (2:1.5.2-2) ... 1520s Selecting previously unselected package gtk-update-icon-cache. 1520s Preparing to unpack .../158-gtk-update-icon-cache_3.24.40-2ubuntu1_arm64.deb ... 1520s Unpacking gtk-update-icon-cache (3.24.40-2ubuntu1) ... 1520s Selecting previously unselected package hicolor-icon-theme. 1520s Preparing to unpack .../159-hicolor-icon-theme_0.17-2_all.deb ... 1520s Unpacking hicolor-icon-theme (0.17-2) ... 1520s Selecting previously unselected package humanity-icon-theme. 1520s Preparing to unpack .../160-humanity-icon-theme_0.6.16_all.deb ... 1520s Unpacking humanity-icon-theme (0.6.16) ... 1522s Selecting previously unselected package ubuntu-mono. 1522s Preparing to unpack .../161-ubuntu-mono_20.10-0ubuntu2_all.deb ... 1522s Unpacking ubuntu-mono (20.10-0ubuntu2) ... 1523s Selecting previously unselected package adwaita-icon-theme. 1523s Preparing to unpack .../162-adwaita-icon-theme_46~rc-1_all.deb ... 1523s Unpacking adwaita-icon-theme (46~rc-1) ... 1524s Selecting previously unselected package libgtk2.0-0:arm64. 1524s Preparing to unpack .../163-libgtk2.0-0_2.24.33-2ubuntu2_arm64.deb ... 1524s Unpacking libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ... 1524s Selecting previously unselected package libglvnd0:arm64. 1524s Preparing to unpack .../164-libglvnd0_1.7.0-1_arm64.deb ... 1524s Unpacking libglvnd0:arm64 (1.7.0-1) ... 1524s Selecting previously unselected package libglapi-mesa:arm64. 1524s Preparing to unpack .../165-libglapi-mesa_24.0.1-1ubuntu1_arm64.deb ... 1524s Unpacking libglapi-mesa:arm64 (24.0.1-1ubuntu1) ... 1524s Selecting previously unselected package libx11-xcb1:arm64. 1524s Preparing to unpack .../166-libx11-xcb1_2%3a1.8.7-1_arm64.deb ... 1524s Unpacking libx11-xcb1:arm64 (2:1.8.7-1) ... 1524s Selecting previously unselected package libxcb-dri2-0:arm64. 1525s Preparing to unpack .../167-libxcb-dri2-0_1.15-1_arm64.deb ... 1525s Unpacking libxcb-dri2-0:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxcb-dri3-0:arm64. 1525s Preparing to unpack .../168-libxcb-dri3-0_1.15-1_arm64.deb ... 1525s Unpacking libxcb-dri3-0:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxcb-glx0:arm64. 1525s Preparing to unpack .../169-libxcb-glx0_1.15-1_arm64.deb ... 1525s Unpacking libxcb-glx0:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxcb-present0:arm64. 1525s Preparing to unpack .../170-libxcb-present0_1.15-1_arm64.deb ... 1525s Unpacking libxcb-present0:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxcb-randr0:arm64. 1525s Preparing to unpack .../171-libxcb-randr0_1.15-1_arm64.deb ... 1525s Unpacking libxcb-randr0:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxcb-sync1:arm64. 1525s Preparing to unpack .../172-libxcb-sync1_1.15-1_arm64.deb ... 1525s Unpacking libxcb-sync1:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxcb-xfixes0:arm64. 1525s Preparing to unpack .../173-libxcb-xfixes0_1.15-1_arm64.deb ... 1525s Unpacking libxcb-xfixes0:arm64 (1.15-1) ... 1525s Selecting previously unselected package libxshmfence1:arm64. 1525s Preparing to unpack .../174-libxshmfence1_1.3-1build4_arm64.deb ... 1525s Unpacking libxshmfence1:arm64 (1.3-1build4) ... 1525s Selecting previously unselected package libxxf86vm1:arm64. 1525s Preparing to unpack .../175-libxxf86vm1_1%3a1.1.4-1build3_arm64.deb ... 1525s Unpacking libxxf86vm1:arm64 (1:1.1.4-1build3) ... 1525s Selecting previously unselected package libvulkan1:arm64. 1525s Preparing to unpack .../176-libvulkan1_1.3.275.0-1_arm64.deb ... 1525s Unpacking libvulkan1:arm64 (1.3.275.0-1) ... 1525s Selecting previously unselected package libdrm-amdgpu1:arm64. 1525s Preparing to unpack .../177-libdrm-amdgpu1_2.4.120-2_arm64.deb ... 1525s Unpacking libdrm-amdgpu1:arm64 (2.4.120-2) ... 1525s Selecting previously unselected package libdrm-nouveau2:arm64. 1525s Preparing to unpack .../178-libdrm-nouveau2_2.4.120-2_arm64.deb ... 1525s Unpacking libdrm-nouveau2:arm64 (2.4.120-2) ... 1525s Selecting previously unselected package libdrm-radeon1:arm64. 1526s Preparing to unpack .../179-libdrm-radeon1_2.4.120-2_arm64.deb ... 1526s Unpacking libdrm-radeon1:arm64 (2.4.120-2) ... 1526s Selecting previously unselected package libllvm17:arm64. 1526s Preparing to unpack .../180-libllvm17_1%3a17.0.6-5build1_arm64.deb ... 1526s Unpacking libllvm17:arm64 (1:17.0.6-5build1) ... 1528s Selecting previously unselected package libgl1-mesa-dri:arm64. 1528s Preparing to unpack .../181-libgl1-mesa-dri_24.0.1-1ubuntu1_arm64.deb ... 1528s Unpacking libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ... 1529s Selecting previously unselected package libglx-mesa0:arm64. 1529s Preparing to unpack .../182-libglx-mesa0_24.0.1-1ubuntu1_arm64.deb ... 1529s Unpacking libglx-mesa0:arm64 (24.0.1-1ubuntu1) ... 1529s Selecting previously unselected package libglx0:arm64. 1529s Preparing to unpack .../183-libglx0_1.7.0-1_arm64.deb ... 1529s Unpacking libglx0:arm64 (1.7.0-1) ... 1529s Selecting previously unselected package libgl1:arm64. 1529s Preparing to unpack .../184-libgl1_1.7.0-1_arm64.deb ... 1529s Unpacking libgl1:arm64 (1.7.0-1) ... 1529s Selecting previously unselected package libgif7:arm64. 1529s Preparing to unpack .../185-libgif7_5.2.1-2.5_arm64.deb ... 1529s Unpacking libgif7:arm64 (5.2.1-2.5) ... 1529s Selecting previously unselected package libxtst6:arm64. 1529s Preparing to unpack .../186-libxtst6_2%3a1.2.3-1.1_arm64.deb ... 1529s Unpacking libxtst6:arm64 (2:1.2.3-1.1) ... 1529s Selecting previously unselected package openjdk-21-jre:arm64. 1529s Preparing to unpack .../187-openjdk-21-jre_21.0.2+13-2_arm64.deb ... 1529s Unpacking openjdk-21-jre:arm64 (21.0.2+13-2) ... 1529s Selecting previously unselected package default-jre. 1529s Preparing to unpack .../188-default-jre_2%3a1.21-75+exp1_arm64.deb ... 1529s Unpacking default-jre (2:1.21-75+exp1) ... 1529s Selecting previously unselected package libapksig-java. 1529s Preparing to unpack .../189-libapksig-java_31.0.2-1_all.deb ... 1529s Unpacking libapksig-java (31.0.2-1) ... 1529s Selecting previously unselected package apksigner. 1529s Preparing to unpack .../190-apksigner_31.0.2-1_all.deb ... 1529s Unpacking apksigner (31.0.2-1) ... 1529s Selecting previously unselected package openjdk-21-jdk-headless:arm64. 1529s Preparing to unpack .../191-openjdk-21-jdk-headless_21.0.2+13-2_arm64.deb ... 1529s Unpacking openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ... 1531s Selecting previously unselected package default-jdk-headless. 1531s Preparing to unpack .../192-default-jdk-headless_2%3a1.21-75+exp1_arm64.deb ... 1531s Unpacking default-jdk-headless (2:1.21-75+exp1) ... 1531s Selecting previously unselected package fdroidserver. 1531s Preparing to unpack .../193-fdroidserver_2.2.1-2_all.deb ... 1531s Unpacking fdroidserver (2.2.1-2) ... 1531s Setting up libgraphite2-3:arm64 (1.3.14-2) ... 1531s Setting up libxcb-dri3-0:arm64 (1.15-1) ... 1531s Setting up liblcms2-2:arm64 (2.14-2) ... 1531s Setting up libpixman-1-0:arm64 (0.42.2-1) ... 1531s Setting up python3-lockfile (1:0.12.2-3) ... 1531s Setting up libsharpyuv0:arm64 (1.3.2-0.4) ... 1531s Setting up libx11-xcb1:arm64 (2:1.8.7-1) ... 1531s Setting up python3-pure-eval (0.2.2-1) ... 1532s Setting up libdrm-nouveau2:arm64 (2.4.120-2) ... 1532s Setting up libsodium23:arm64 (1.0.18-1build2) ... 1532s Setting up libxdamage1:arm64 (1:1.1.6-1) ... 1532s Setting up libxcb-xfixes0:arm64 (1.15-1) ... 1532s Setting up liblerc4:arm64 (4.0.0+ds-4ubuntu1) ... 1532s Setting up libxpm4:arm64 (1:3.5.17-1) ... 1532s Setting up hicolor-icon-theme (0.17-2) ... 1532s Setting up libxi6:arm64 (2:1.8.1-1) ... 1532s Setting up java-common (0.75+exp1) ... 1532s Setting up libxrender1:arm64 (1:0.9.10-1.1) ... 1532s Setting up libdatrie1:arm64 (0.2.13-3) ... 1532s Setting up python3-parso (0.8.3-1) ... 1533s Setting up python3-colorama (0.4.6-4) ... 1533s Setting up python3-lz4 (4.0.2+dfsg-1build2) ... 1533s Setting up libxcb-render0:arm64 (1.15-1) ... 1533s Setting up python3-defusedxml (0.7.1-2) ... 1534s Setting up python3-asttokens (2.4.1-1) ... 1534s Setting up libdrm-radeon1:arm64 (2.4.120-2) ... 1534s Setting up libglvnd0:arm64 (1.7.0-1) ... 1534s Setting up python3-unicodedata2 (15.1.0+ds-1) ... 1534s Setting up fonts-lyx (2.4.0~RC3-1) ... 1534s Setting up libxcb-glx0:arm64 (1.15-1) ... 1534s Setting up python3-bcrypt (3.2.2-1) ... 1534s Setting up liblab-gamut1:arm64 (2.42.2-8build1) ... 1534s Setting up libgdk-pixbuf2.0-common (2.42.10+dfsg-3) ... 1534s Setting up python3-ruamel.yaml.clib:arm64 (0.2.8-1) ... 1535s Setting up x11-common (1:7.7+23ubuntu2) ... 1536s Setting up libdeflate0:arm64 (1.19-1) ... 1536s Setting up libqhull-r8.0:arm64 (2020.2-6) ... 1536s Setting up libxcb-shm0:arm64 (1.15-1) ... 1536s Setting up libgomp1:arm64 (14-20240303-1ubuntu1) ... 1536s Setting up python3-click (8.1.6-1) ... 1536s Setting up python3-networkx (2.8.8-1ubuntu1) ... 1539s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:556: SyntaxWarning: invalid octal escape sequence '\420' 1539s "graph [edge [ source u'u\4200' target u'u\4200' ] " 1539s /usr/lib/python3/dist-packages/networkx/readwrite/tests/test_gml.py:557: SyntaxWarning: invalid octal escape sequence '\420' 1539s + "node [ id u'u\4200' label b ] ]" 1540s Setting up libjbig0:arm64 (2.1-6.1ubuntu1) ... 1540s Setting up libxxf86vm1:arm64 (1:1.1.4-1build3) ... 1540s Setting up python3-png (0.20231004.0-2) ... 1540s Setting up libxcb-present0:arm64 (1.15-1) ... 1540s Setting up liberror-perl (0.17029-2) ... 1540s Setting up unicode-data (15.1.0-1) ... 1540s Setting up libgts-0.7-5:arm64 (0.7.6+darcs121130-5) ... 1540s Setting up python3-simplejson (3.19.2-1build1) ... 1541s Setting up libasound2-data (1.2.10-3build1) ... 1541s Setting up python3-decorator (5.1.1-5) ... 1541s Setting up libblas3:arm64 (3.12.0-3) ... 1541s update-alternatives: using /usr/lib/aarch64-linux-gnu/blas/libblas.so.3 to provide /usr/lib/aarch64-linux-gnu/libblas.so.3 (libblas.so.3-aarch64-linux-gnu) in auto mode 1541s Setting up python3-packaging (23.2-1) ... 1541s Setting up python3-wcwidth (0.2.5+dfsg1-1.1ubuntu1) ... 1542s Setting up python3-args (0.1.0-5) ... 1542s Setting up libxfixes3:arm64 (1:6.0.0-2) ... 1542s Setting up libxcb-sync1:arm64 (1.15-1) ... 1542s Setting up python3-executing (2.0.1-0.1) ... 1543s Setting up libpathplan4:arm64 (2.42.2-8build1) ... 1543s Setting up python3-brotli (1.1.0-2) ... 1543s Setting up libavahi-common-data:arm64 (0.8-13ubuntu2) ... 1543s Setting up libann0 (1.1.2+doc-9) ... 1543s Setting up python3-cycler (0.11.0-2) ... 1544s Setting up libxinerama1:arm64 (2:1.1.4-3) ... 1544s Setting up libimagequant0:arm64 (2.18.0-1) ... 1544s Setting up fonts-dejavu-mono (2.37-8) ... 1544s Setting up python3-kiwisolver (1.4.4-1build2) ... 1544s Setting up libxrandr2:arm64 (2:1.5.2-2) ... 1544s Setting up libtcl8.6:arm64 (8.6.13+dfsg-2) ... 1544s Setting up fonts-dejavu-core (2.37-8) ... 1544s Setting up libpcsclite1:arm64 (2.0.0-1) ... 1544s Setting up libjpeg-turbo8:arm64 (2.1.5-2ubuntu1) ... 1544s Setting up libltdl7:arm64 (2.4.7-7) ... 1544s Setting up libglapi-mesa:arm64 (24.0.1-1ubuntu1) ... 1544s Setting up libgfortran5:arm64 (14-20240303-1ubuntu1) ... 1544s Setting up libvulkan1:arm64 (1.3.275.0-1) ... 1544s Setting up libwebp7:arm64 (1.3.2-0.4) ... 1544s Setting up libxcb-dri2-0:arm64 (1.15-1) ... 1544s Setting up python3-ruamel.yaml (0.17.21-1) ... 1545s Setting up libgif7:arm64 (5.2.1-2.5) ... 1545s Setting up libxshmfence1:arm64 (1.3-1build4) ... 1545s Setting up at-spi2-common (2.50.0-1) ... 1545s Setting up libxcb-randr0:arm64 (1.15-1) ... 1545s Setting up python3-traitlets (5.5.0-2) ... 1545s Setting up libasound2:arm64 (1.2.10-3build1) ... 1545s Setting up libxslt1.1:arm64 (1.1.35-1) ... 1545s Setting up python3-pyasn1 (0.4.8-4) ... 1546s Setting up libopenjp2-7:arm64 (2.5.0-2) ... 1546s Setting up git-man (1:2.43.0-1ubuntu1) ... 1546s Setting up libharfbuzz0b:arm64 (8.3.0-2) ... 1546s Setting up libthai-data (0.1.29-2) ... 1546s Setting up python3-dateutil (2.8.2-3) ... 1546s Setting up libgtk2.0-common (2.24.33-2ubuntu2) ... 1546s Setting up libcdt5:arm64 (2.42.2-8build1) ... 1546s Setting up libatk1.0-0:arm64 (2.50.0-1) ... 1546s Setting up libcgraph6:arm64 (2.42.2-8build1) ... 1546s Setting up libxss1:arm64 (1:1.2.3-1build2) ... 1546s Setting up libjs-jquery (3.6.1+dfsg+~3.5.14-1) ... 1546s Setting up ca-certificates-java (20240118) ... 1546s No JRE found. Skipping Java certificates setup. 1546s Setting up python3-mpmath (1.2.1-3) ... 1548s Setting up python3-magic (2:0.4.27-2) ... 1548s Setting up python-matplotlib-data (3.6.3-1ubuntu3) ... 1548s Setting up libwebpmux3:arm64 (1.3.2-0.4) ... 1548s Setting up python3-pathspec (0.12.1-1) ... 1549s Setting up libllvm17:arm64 (1:17.0.6-5build1) ... 1549s Setting up python3-appdirs (1.4.4-4) ... 1549s Setting up python3-smmap (6.0.0-1) ... 1549s Setting up libxcomposite1:arm64 (1:0.4.5-1build2) ... 1549s Setting up python3-stack-data (0.6.3-1) ... 1550s Setting up python3-asn1crypto (1.5.1-3) ... 1550s Setting up python3-nacl (1.5.0-4) ... 1551s Setting up libapksig-java (31.0.2-1) ... 1551s Setting up python3-ptyprocess (0.7.0-5) ... 1551s Setting up libdrm-amdgpu1:arm64 (2.4.120-2) ... 1551s Setting up libjpeg8:arm64 (8c-2ubuntu11) ... 1551s Setting up python3-prompt-toolkit (3.0.43-1) ... 1552s Setting up python3-sympy (1.12-7) ... 1568s Setting up libice6:arm64 (2:1.0.10-1build2) ... 1568s Setting up liblapack3:arm64 (3.12.0-3) ... 1568s update-alternatives: using /usr/lib/aarch64-linux-gnu/lapack/liblapack.so.3 to provide /usr/lib/aarch64-linux-gnu/liblapack.so.3 (liblapack.so.3-aarch64-linux-gnu) in auto mode 1568s Setting up python3-clint (0.5.1-4) ... 1568s /usr/lib/python3/dist-packages/clint/packages/appdirs.py:82: SyntaxWarning: invalid escape sequence '\D' 1568s """Return full path to the user-shared data dir for this application. 1568s /usr/lib/python3/dist-packages/clint/packages/colorama/ansitowin32.py:43: SyntaxWarning: invalid escape sequence '\[' 1568s ANSI_RE = re.compile('\033\[((?:\d|;)*)([a-zA-Z])') 1568s /usr/lib/python3/dist-packages/clint/textui/colored.py:118: SyntaxWarning: invalid escape sequence '\$' 1568s strip = re.compile("([^-_a-zA-Z0-9!@#%&=,/'\";:~`\$\^\*\(\)\+\[\]\.\{\}\|\?\<\>\\]+|[^\s]+)") 1568s Setting up python3-jedi (0.18.2-1ubuntu1) ... 1569s Setting up fontconfig-config (2.15.0-1ubuntu1) ... 1570s Setting up libxtst6:arm64 (2:1.2.3-1.1) ... 1570s Setting up libwebpdemux2:arm64 (1.3.2-0.4) ... 1570s Setting up libxcursor1:arm64 (1:1.2.1-1) ... 1570s Setting up libgl1-mesa-dri:arm64 (24.0.1-1ubuntu1) ... 1570s Setting up libavahi-common3:arm64 (0.8-13ubuntu2) ... 1570s Setting up python3-libcloud (3.4.1-5) ... 1573s Setting up python3-gitdb (4.0.11-1) ... 1573s Setting up python3-matplotlib-inline (0.1.6-2) ... 1574s Setting up python3-fs (2.4.16-3) ... 1575s Setting up libthai0:arm64 (0.1.29-2) ... 1575s Setting up yamllint (1.33.0-1) ... 1575s Setting up python3-oscrypto (1.3.0-5) ... 1576s Setting up libjs-jquery-ui (1.13.2+dfsg-1) ... 1576s Setting up python3-pexpect (4.9-2) ... 1576s Setting up python3-pyasn1-modules (0.2.8-1) ... 1577s Setting up libraqm0:arm64 (0.10.1-1) ... 1577s Setting up git (1:2.43.0-1ubuntu1) ... 1577s Setting up python3-numpy (1:1.24.2-2) ... 1587s Setting up libgvpr2:arm64 (2.42.2-8build1) ... 1587s Setting up python3-lxml:arm64 (5.1.0-1) ... 1588s Setting up libtiff6:arm64 (4.5.1+git230720-3ubuntu1) ... 1588s Setting up libgdk-pixbuf-2.0-0:arm64 (2.42.10+dfsg-3) ... 1588s Setting up python3-contourpy (1.0.7-1build2) ... 1588s Setting up libfontconfig1:arm64 (2.15.0-1ubuntu1) ... 1588s Setting up python3-paramiko (2.12.0-2ubuntu4) ... 1589s Setting up libsm6:arm64 (2:1.2.3-1build2) ... 1589s Setting up libavahi-client3:arm64 (0.8-13ubuntu2) ... 1589s Setting up liblbfgsb0:arm64 (3.0+dfsg.4-1) ... 1589s Setting up gtk-update-icon-cache (3.24.40-2ubuntu1) ... 1589s Setting up fontconfig (2.15.0-1ubuntu1) ... 1591s Regenerating fonts cache... done. 1591s Setting up libxft2:arm64 (2.3.6-1) ... 1591s Setting up libglx-mesa0:arm64 (24.0.1-1ubuntu1) ... 1591s Setting up python3-scipy (1.11.4-6) ... 1617s Setting up libglx0:arm64 (1.7.0-1) ... 1617s Setting up libtk8.6:arm64 (8.6.13-2) ... 1617s Setting up libpango-1.0-0:arm64 (1.51.0+ds-4) ... 1617s Setting up libcairo2:arm64 (1.18.0-1) ... 1617s Setting up python3-pil:arm64 (10.2.0-1) ... 1618s Setting up libgl1:arm64 (1.7.0-1) ... 1618s Setting up python3-ipython (8.20.0-1) ... 1620s Setting up python3-git (3.1.37-3) ... 1621s Setting up libgd3:arm64 (2.3.3-9ubuntu1) ... 1621s Setting up libxt6:arm64 (1:1.2.1-1.1) ... 1621s Setting up libcups2:arm64 (2.4.6-0ubuntu3) ... 1621s Setting up python3-qrcode (7.4.2-4) ... 1621s update-alternatives: using /usr/bin/python3-qr to provide /usr/bin/qr (qr) in auto mode 1621s Setting up libpangoft2-1.0-0:arm64 (1.51.0+ds-4) ... 1621s Setting up libpangocairo-1.0-0:arm64 (1.51.0+ds-4) ... 1621s Setting up tk8.6-blt2.5 (2.5.3+dfsg-7) ... 1621s Setting up libxmu6:arm64 (2:1.1.3-3) ... 1621s Setting up openjdk-21-jre-headless:arm64 (21.0.2+13-2) ... 1621s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/java to provide /usr/bin/java (java) in auto mode 1621s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jpackage to provide /usr/bin/jpackage (jpackage) in auto mode 1621s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode 1621s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode 1621s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode 1621s Setting up blt (2.5.3+dfsg-7) ... 1621s Setting up python3-tk:arm64 (3.11.5-1) ... 1622s Setting up libxaw7:arm64 (2:1.0.14-1) ... 1622s Setting up python3-pil.imagetk:arm64 (10.2.0-1) ... 1622s Setting up libgvc6 (2.42.2-8build1) ... 1622s Setting up graphviz (2.42.2-8build1) ... 1622s Setting up python3-pydot (1.4.2-2) ... 1623s Setting up python3-fonttools (4.46.0-1) ... 1628s Setting up adwaita-icon-theme (46~rc-1) ... 1628s update-alternatives: using /usr/share/icons/Adwaita/cursor.theme to provide /usr/share/icons/default/index.theme (x-cursor-theme) in auto mode 1628s Setting up python3-ufolib2 (0.16.0+dfsg1-1) ... 1630s Setting up python3-matplotlib (3.6.3-1ubuntu3) ... 1635s Setting up libgtk2.0-0:arm64 (2.24.33-2ubuntu2) ... 1635s Setting up androguard (3.4.0~a1-10) ... 1635s /usr/lib/python3/dist-packages/androguard/core/bytecodes/apk.py:1027: SyntaxWarning: invalid escape sequence '\>' 1635s """ 1636s Setting up humanity-icon-theme (0.6.16) ... 1637s Setting up ubuntu-mono (20.10-0ubuntu2) ... 1637s Processing triggers for man-db (2.12.0-3) ... 1639s Processing triggers for libc-bin (2.39-0ubuntu2) ... 1639s Processing triggers for ca-certificates-java (20240118) ... 1642s Adding debian:ACCVRAIZ1.pem 1642s Adding debian:AC_RAIZ_FNMT-RCM.pem 1642s Adding debian:AC_RAIZ_FNMT-RCM_SERVIDORES_SEGUROS.pem 1642s Adding debian:ANF_Secure_Server_Root_CA.pem 1642s Adding debian:Actalis_Authentication_Root_CA.pem 1642s Adding debian:AffirmTrust_Commercial.pem 1642s Adding debian:AffirmTrust_Networking.pem 1642s Adding debian:AffirmTrust_Premium.pem 1642s Adding debian:AffirmTrust_Premium_ECC.pem 1642s Adding debian:Amazon_Root_CA_1.pem 1642s Adding debian:Amazon_Root_CA_2.pem 1642s Adding debian:Amazon_Root_CA_3.pem 1642s Adding debian:Amazon_Root_CA_4.pem 1642s Adding debian:Atos_TrustedRoot_2011.pem 1642s Adding debian:Atos_TrustedRoot_Root_CA_ECC_TLS_2021.pem 1642s Adding debian:Atos_TrustedRoot_Root_CA_RSA_TLS_2021.pem 1642s Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem 1642s Adding debian:BJCA_Global_Root_CA1.pem 1642s Adding debian:BJCA_Global_Root_CA2.pem 1642s Adding debian:Baltimore_CyberTrust_Root.pem 1642s Adding debian:Buypass_Class_2_Root_CA.pem 1642s Adding debian:Buypass_Class_3_Root_CA.pem 1642s Adding debian:CA_Disig_Root_R2.pem 1642s Adding debian:CFCA_EV_ROOT.pem 1642s Adding debian:COMODO_Certification_Authority.pem 1642s Adding debian:COMODO_ECC_Certification_Authority.pem 1642s Adding debian:COMODO_RSA_Certification_Authority.pem 1642s Adding debian:Certainly_Root_E1.pem 1642s Adding debian:Certainly_Root_R1.pem 1642s Adding debian:Certigna.pem 1642s Adding debian:Certigna_Root_CA.pem 1642s Adding debian:Certum_EC-384_CA.pem 1642s Adding debian:Certum_Trusted_Network_CA.pem 1642s Adding debian:Certum_Trusted_Network_CA_2.pem 1642s Adding debian:Certum_Trusted_Root_CA.pem 1642s Adding debian:CommScope_Public_Trust_ECC_Root-01.pem 1642s Adding debian:CommScope_Public_Trust_ECC_Root-02.pem 1642s Adding debian:CommScope_Public_Trust_RSA_Root-01.pem 1642s Adding debian:CommScope_Public_Trust_RSA_Root-02.pem 1642s Adding debian:Comodo_AAA_Services_root.pem 1642s Adding debian:D-TRUST_BR_Root_CA_1_2020.pem 1642s Adding debian:D-TRUST_EV_Root_CA_1_2020.pem 1642s Adding debian:D-TRUST_Root_Class_3_CA_2_2009.pem 1642s Adding debian:D-TRUST_Root_Class_3_CA_2_EV_2009.pem 1642s Adding debian:DigiCert_Assured_ID_Root_CA.pem 1642s Adding debian:DigiCert_Assured_ID_Root_G2.pem 1642s Adding debian:DigiCert_Assured_ID_Root_G3.pem 1642s Adding debian:DigiCert_Global_Root_CA.pem 1642s Adding debian:DigiCert_Global_Root_G2.pem 1642s Adding debian:DigiCert_Global_Root_G3.pem 1642s Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem 1642s Adding debian:DigiCert_TLS_ECC_P384_Root_G5.pem 1642s Adding debian:DigiCert_TLS_RSA4096_Root_G5.pem 1642s Adding debian:DigiCert_Trusted_Root_G4.pem 1642s Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem 1642s Adding debian:Entrust_Root_Certification_Authority.pem 1642s Adding debian:Entrust_Root_Certification_Authority_-_EC1.pem 1642s Adding debian:Entrust_Root_Certification_Authority_-_G2.pem 1642s Adding debian:Entrust_Root_Certification_Authority_-_G4.pem 1642s Adding debian:GDCA_TrustAUTH_R5_ROOT.pem 1642s Adding debian:GLOBALTRUST_2020.pem 1642s Adding debian:GTS_Root_R1.pem 1642s Adding debian:GTS_Root_R2.pem 1642s Adding debian:GTS_Root_R3.pem 1642s Adding debian:GTS_Root_R4.pem 1642s Adding debian:GlobalSign_ECC_Root_CA_-_R4.pem 1642s Adding debian:GlobalSign_ECC_Root_CA_-_R5.pem 1642s Adding debian:GlobalSign_Root_CA.pem 1642s Adding debian:GlobalSign_Root_CA_-_R3.pem 1642s Adding debian:GlobalSign_Root_CA_-_R6.pem 1642s Adding debian:GlobalSign_Root_E46.pem 1642s Adding debian:GlobalSign_Root_R46.pem 1642s Adding debian:Go_Daddy_Class_2_CA.pem 1642s Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem 1642s Adding debian:HARICA_TLS_ECC_Root_CA_2021.pem 1642s Adding debian:HARICA_TLS_RSA_Root_CA_2021.pem 1642s Adding debian:Hellenic_Academic_and_Research_Institutions_ECC_RootCA_2015.pem 1642s Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2015.pem 1642s Adding debian:HiPKI_Root_CA_-_G1.pem 1642s Adding debian:Hongkong_Post_Root_CA_3.pem 1642s Adding debian:ISRG_Root_X1.pem 1642s Adding debian:ISRG_Root_X2.pem 1642s Adding debian:IdenTrust_Commercial_Root_CA_1.pem 1642s Adding debian:IdenTrust_Public_Sector_Root_CA_1.pem 1642s Adding debian:Izenpe.com.pem 1642s Adding debian:Microsec_e-Szigno_Root_CA_2009.pem 1642s Adding debian:Microsoft_ECC_Root_Certificate_Authority_2017.pem 1642s Adding debian:Microsoft_RSA_Root_Certificate_Authority_2017.pem 1642s Adding debian:NAVER_Global_Root_Certification_Authority.pem 1642s Adding debian:NetLock_Arany_=Class_Gold=_Főtanúsítvány.pem 1642s Adding debian:OISTE_WISeKey_Global_Root_GB_CA.pem 1642s Adding debian:OISTE_WISeKey_Global_Root_GC_CA.pem 1642s Adding debian:QuoVadis_Root_CA_1_G3.pem 1642s Adding debian:QuoVadis_Root_CA_2.pem 1642s Adding debian:QuoVadis_Root_CA_2_G3.pem 1642s Adding debian:QuoVadis_Root_CA_3.pem 1642s Adding debian:QuoVadis_Root_CA_3_G3.pem 1642s Adding debian:SSL.com_EV_Root_Certification_Authority_ECC.pem 1642s Adding debian:SSL.com_EV_Root_Certification_Authority_RSA_R2.pem 1642s Adding debian:SSL.com_Root_Certification_Authority_ECC.pem 1642s Adding debian:SSL.com_Root_Certification_Authority_RSA.pem 1642s Adding debian:SSL.com_TLS_ECC_Root_CA_2022.pem 1642s Adding debian:SSL.com_TLS_RSA_Root_CA_2022.pem 1642s Adding debian:SZAFIR_ROOT_CA2.pem 1642s Adding debian:Sectigo_Public_Server_Authentication_Root_E46.pem 1642s Adding debian:Sectigo_Public_Server_Authentication_Root_R46.pem 1642s Adding debian:SecureSign_RootCA11.pem 1642s Adding debian:SecureTrust_CA.pem 1642s Adding debian:Secure_Global_CA.pem 1642s Adding debian:Security_Communication_ECC_RootCA1.pem 1642s Adding debian:Security_Communication_RootCA2.pem 1642s Adding debian:Security_Communication_RootCA3.pem 1642s Adding debian:Security_Communication_Root_CA.pem 1642s Adding debian:Starfield_Class_2_CA.pem 1642s Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem 1642s Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem 1642s Adding debian:SwissSign_Gold_CA_-_G2.pem 1642s Adding debian:SwissSign_Silver_CA_-_G2.pem 1642s Adding debian:T-TeleSec_GlobalRoot_Class_2.pem 1642s Adding debian:T-TeleSec_GlobalRoot_Class_3.pem 1642s Adding debian:TUBITAK_Kamu_SM_SSL_Kok_Sertifikasi_-_Surum_1.pem 1642s Adding debian:TWCA_Global_Root_CA.pem 1642s Adding debian:TWCA_Root_Certification_Authority.pem 1642s Adding debian:TeliaSonera_Root_CA_v1.pem 1642s Adding debian:Telia_Root_CA_v2.pem 1642s Adding debian:TrustAsia_Global_Root_CA_G3.pem 1642s Adding debian:TrustAsia_Global_Root_CA_G4.pem 1642s Adding debian:Trustwave_Global_Certification_Authority.pem 1642s Adding debian:Trustwave_Global_ECC_P256_Certification_Authority.pem 1642s Adding debian:Trustwave_Global_ECC_P384_Certification_Authority.pem 1642s Adding debian:TunTrust_Root_CA.pem 1642s Adding debian:UCA_Extended_Validation_Root.pem 1642s Adding debian:UCA_Global_G2_Root.pem 1642s Adding debian:USERTrust_ECC_Certification_Authority.pem 1642s Adding debian:USERTrust_RSA_Certification_Authority.pem 1642s Adding debian:XRamp_Global_CA_Root.pem 1642s Adding debian:certSIGN_ROOT_CA.pem 1642s Adding debian:certSIGN_Root_CA_G2.pem 1642s Adding debian:e-Szigno_Root_CA_2017.pem 1642s Adding debian:ePKI_Root_Certification_Authority.pem 1642s Adding debian:emSign_ECC_Root_CA_-_C3.pem 1642s Adding debian:emSign_ECC_Root_CA_-_G3.pem 1642s Adding debian:emSign_Root_CA_-_C1.pem 1642s Adding debian:emSign_Root_CA_-_G1.pem 1642s Adding debian:vTrus_ECC_Root_CA.pem 1642s Adding debian:vTrus_Root_CA.pem 1643s done. 1643s Setting up openjdk-21-jre:arm64 (21.0.2+13-2) ... 1643s Setting up openjdk-21-jdk-headless:arm64 (21.0.2+13-2) ... 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jar to provide /usr/bin/jar (jar) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javac to provide /usr/bin/javac (javac) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/javap to provide /usr/bin/javap (javap) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jcmd to provide /usr/bin/jcmd (jcmd) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeprscan to provide /usr/bin/jdeprscan (jdeprscan) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jdeps to provide /usr/bin/jdeps (jdeps) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jfr to provide /usr/bin/jfr (jfr) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jimage to provide /usr/bin/jimage (jimage) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jlink to provide /usr/bin/jlink (jlink) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jmod to provide /usr/bin/jmod (jmod) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jps to provide /usr/bin/jps (jps) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jshell to provide /usr/bin/jshell (jshell) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jwebserver to provide /usr/bin/jwebserver (jwebserver) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode 1643s update-alternatives: using /usr/lib/jvm/java-21-openjdk-arm64/bin/jhsdb to provide /usr/bin/jhsdb (jhsdb) in auto mode 1643s Setting up default-jre-headless (2:1.21-75+exp1) ... 1643s Setting up apksigner (31.0.2-1) ... 1643s Setting up fdroidserver (2.2.1-2) ... 1644s Setting up default-jre (2:1.21-75+exp1) ... 1644s Setting up default-jdk-headless (2:1.21-75+exp1) ... 1644s Setting up autopkgtest-satdep (0) ... 1683s (Reading database ... 103012 files and directories currently installed.) 1683s Removing autopkgtest-satdep (0) ... 1691s autopkgtest [20:20:18]: test locales: [----------------------- 1691s + LC_ALL=bo fdroid update --help 1691s + grep པ 1695s + + LC_ALL=de fdroid update --help 1695s grep gewöhnlich 1697s + + LC_ALL=en fdroid update --help 1697s grep show this help 1698s + + grep información 1698s LC_ALL=es fdroid update --help 1700s + LC_ALL=fr fdroid update --help 1700s + grep métadonnées 1702s + + grep Metaadatfájl 1702s LC_ALL=hu fdroid update --help 1704s + LC_ALL=ko+ fdroid update --help 1704s grep 명 1705s + LC_ALL=ru fdroid update --help 1705s + grep неподписанны 1707s + LC_ALL=uk+ grep репозитор 1707s fdroid update --help 1708s + + grep 签 1708s LC_ALL=zh_Hans fdroid update --help 1710s + + LC_ALL=zh_Hant fdroid update --help 1710s grep 簽 1711s autopkgtest [20:20:38]: test locales: -----------------------] 1712s autopkgtest [20:20:39]: test locales: - - - - - - - - - - results - - - - - - - - - - 1712s locales PASS 1712s autopkgtest [20:20:39]: @@@@@@@@@@@@@@@@@@@@ summary 1712s command1 PASS 1712s locales PASS 1751s Creating nova instance adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-proposed-migration-environment-2 from image adt/ubuntu-noble-arm64-server-20240306.img (UUID fe83f9af-4e32-48b1-9e6a-30d9e6eedf79)... 1751s Creating nova instance adt-noble-arm64-fdroidserver-20240307-195206-juju-7f2275-prod-proposed-migration-environment-2 from image adt/ubuntu-noble-arm64-server-20240306.img (UUID fe83f9af-4e32-48b1-9e6a-30d9e6eedf79)...